3CCJH

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2534u
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 30
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3ccjH00
5GAEN 3CCLH 3PIOJ 3CCQH 1QVFH 1Q86J 3G6EH 5MLCO 5DM6J 1VQKH 2OTJH 1W2BH 1Q81J 1VQMH 3CC4H 1KD1J 1WKIA 1YHQH 3CCJH 1VQ5H 3J7ZM 4WFNJ 3G71H 3CF5J 1VQ8H 3CC2H 3G4SH 5JVGJ 4U67J 4WF9J 2PA2A 5DM7J 2OTLH 5HL7J 3CCSH 1VQ7H 3CCRH 3CD6H 5GAGN 1KC8J 1YITH 1VQ6H 1Q7YJ 1S72H 2QEXH 1VQOH 1KQSH 3CMEH 2ZJPJ 1M90J 3CPWH 1VQ9H 4IOAJ 1VQPH 3CC7H 1VQLH 1Q82J 2ZJRJ 4WCEJ 4IOCJ 3I55H 4WFBJ 3CXCH 3PIPJ 1Y69K 1NJIJ 1VQ4H 1YI2H 5GAHN 5AN9F 2QA4H 3OW2H 4UY8M 3CMAH 4IO9J 3I56H 5GADN 1K73J 1K9MJ 1K8AJ 1QVGH 4WFAJ 1YJWH 1YJ9H 3CCMH 3DLLJ 1VQNH 5H1SO 1JJ2H 1YIJH 1YJNH 1M1KJ 3CCVH 3CCUH 3CCEH 1N8RJ 2ZJQJ 5JVHJ
chains in the Genus database with same CATH superfamily
5GAEN 1YTKA 3RPFA 2WP4A 3CCLH 1QPNA 3PIOJ 3C2OA 3CCQH 3WNZA 1QVFH 1Q86J 2DSJA 3ETRC 3B9JC 3EUB4 3G6EH 5MLCO 5DM6J 1VQKH 1N5XA 5EP8A 1W2BH 2OTJH 1O4UA 1Q81J 1FFVB 1VQMH 3NVZC 3FC4A 4US9A 5EY3A 1N62B 1VLBA 3CC4H 1UOUA 5JVHJ 1KD1J 5HUOA 1N63B 1WKIA 1YHQH 3CCJH 3VMMA 4USAA 1VQ5H 3NVYC 3J7ZM 4WFNJ 2I1OA 3G71H 3WO1A 2W3RB 3CF5J 1VQ8H 3NRZC 1N60B 1VDVA 1AZYA 2B7QA 5HULA 3CC2H 3L4PA 3G4SH 5JVGJ 1N5WB 2OMDA 4U67J 1NVIE 1FMAE 3C2RA 4I9AA 4WF9J 2PA2A 4ZOHA 5DM7J 1OTPA 2OTLH 3GNNA 5HL7J 3CCSH 4KWWA 5AYYA 1FO4A 4XR5A 1VQ7H 2WK5A 1QAPA 2W54B 3NVWC 3BIIE 3CCRH 4C7YA 3CD6H 5GAGN 3C2EA 1KC8J 4GA6A 1DGJA 1YITH 1VQ6H 1Q7YJ 1FM0E 2B7NA 4C80A 1S72H 1JROB 2QEXH 1VQOH 1KQSH 3AMZA 4EAFA 3AN1A 5AYXA 1NVJA 3CMEH 2ZJPJ 3AM9A 2W3SB 4YEKA 2TPTA 5AYZA 5MPOC 2E3TA 1M90J 3CPWH 1VQ9H 4IOAJ 1JRPB 2QIEA 1VQPH 5HUPA 1ZXIB 1FFUB 3CC7H 4C7ZA 1VQLH 1SIJA 3FAHA 3L0GA 1Q82J 2ZJRJ 1QPQA 2I14A 4WCEJ 3NVVC 3I55H 4WFBJ 1FIQC 4IOCJ 3CXCH 2W55B 3PIPJ 4GA5A 1Y69K 1NJIJ 4US8A 1VQ4H 2J0FA 3WO0A 3NS1C 3C2FA 1YI2H 1RM6A 3TQVA 2B7PA 1YTEA 5AN9F 5GAHN 2QA4H 3OW2H 1V97A 4UY8M 3PAJA 1N61B 4EADA 3CMAH 4IO9J 3I56H 5GADN 1X1OA 3SR6C 1QPOA 1K73J 1K9MJ 1K8AJ 2Q5WE 1QVGH 3H5QA 1WYGA 4KWVA 4YYYA 4WFAJ 1QPRA 1SB3A 1YJWH 1YJ9H 3CCMH 3DLLJ 1VQNH 2JBMA 2WK6A 3C2VA 5H1SO 1JJ2H 4GA4A 1YIJH 1YJNH 4X46A 3CCVH 1M1KJ 3CCUH 4AP8A 4LHMA 3CCEH 1N8RJ 1YTDA 2ZJQJ 1BRWA
chains in the Genus database with same CATH topology
5GAEN 3CCLH 3PIOJ 3CCQH 1QVFH 1Q86J 3G6EH 5MLCO 5DM6J 1VQKH 2OTJH 1W2BH 1Q81J 1VQMH 3CC4H 1KD1J 1WKIA 1YHQH 3CCJH 1VQ5H 3J7ZM 4WFNJ 3G71H 3CF5J 1VQ8H 3CC2H 3G4SH 5JVGJ 4U67J 4WF9J 2PA2A 5DM7J 2OTLH 5HL7J 3CCSH 1VQ7H 3CCRH 3CD6H 5GAGN 1KC8J 1YITH 1VQ6H 1Q7YJ 1S72H 2QEXH 1VQOH 1KQSH 3CMEH 2ZJPJ 1M90J 3CPWH 1VQ9H 4IOAJ 1VQPH 3CC7H 1VQLH 1Q82J 2ZJRJ 4WCEJ 4IOCJ 3I55H 4WFBJ 3CXCH 3PIPJ 1Y69K 1NJIJ 1VQ4H 1YI2H 5GAHN 5AN9F 2QA4H 3OW2H 4UY8M 3CMAH 4IO9J 3I56H 5GADN 1K73J 1K9MJ 1K8AJ 1QVGH 4WFAJ 1YJWH 1YJ9H 3CCMH 3DLLJ 1VQNH 5H1SO 1JJ2H 1YIJH 1YJNH 1M1KJ 3CCVH 3CCUH 3CCEH 1N8RJ 2ZJQJ 5JVHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE N;  3CCL H;  3PIO J;  3CCQ H;  1QVF H;  1Q86 J;  3G6E H;  5MLC O;  5DM6 J;  1VQK H;  2OTJ H;  1W2B H;  1Q81 J;  1VQM H;  3CC4 H;  1KD1 J;  1WKI A;  1YHQ H;  3CCJ H;  1VQ5 H;  3J7Z M;  4WFN J;  3G71 H;  3CF5 J;  1VQ8 H;  3CC2 H;  3G4S H;  5JVG J;  4U67 J;  4WF9 J;  2PA2 A;  5DM7 J;  2OTL H;  5HL7 J;  3CCS H;  1VQ7 H;  3CCR H;  3CD6 H;  5GAG N;  1KC8 J;  1YIT H;  1VQ6 H;  1Q7Y J;  1S72 H;  2QEX H;  1VQO H;  1KQS H;  3CME H;  2ZJP J;  1M90 J;  3CPW H;  1VQ9 H;  4IOA J;  1VQP H;  3CC7 H;  1VQL H;  1Q82 J;  2ZJR J;  4WCE J;  4IOC J;  3I55 H;  4WFB J;  3CXC H;  3PIP J;  1Y69 K;  1NJI J;  1VQ4 H;  1YI2 H;  5GAH N;  5AN9 F;  2QA4 H;  3OW2 H;  4UY8 M;  3CMA H;  4IO9 J;  3I56 H;  5GAD N;  1K73 J;  1K9M J;  1K8A J;  1QVG H;  4WFA J;  1YJW H;  1YJ9 H;  3CCM H;  3DLL J;  1VQN H;  5H1S O;  1JJ2 H;  1YIJ H;  1YJN H;  1M1K J;  3CCV H;  3CCU H;  3CCE H;  1N8R J;  2ZJQ J;  5JVH J; 
#chains in the Genus database with same CATH topology
 5GAE N;  1YTK A;  3RPF A;  2WP4 A;  3CCL H;  1QPN A;  3PIO J;  3C2O A;  3CCQ H;  3WNZ A;  1QVF H;  1Q86 J;  2DSJ A;  3ETR C;  3B9J C;  3EUB 4;  3G6E H;  5MLC O;  5DM6 J;  1VQK H;  1N5X A;  5EP8 A;  1W2B H;  2OTJ H;  1O4U A;  1Q81 J;  1FFV B;  1VQM H;  3NVZ C;  3FC4 A;  4US9 A;  5EY3 A;  1N62 B;  1VLB A;  3CC4 H;  1UOU A;  5JVH J;  1KD1 J;  5HUO A;  1N63 B;  1WKI A;  1YHQ H;  3CCJ H;  3VMM A;  4USA A;  1VQ5 H;  3NVY C;  3J7Z M;  4WFN J;  2I1O A;  3G71 H;  3WO1 A;  2W3R B;  3CF5 J;  1VQ8 H;  3NRZ C;  1N60 B;  1VDV A;  1AZY A;  2B7Q A;  5HUL A;  3CC2 H;  3L4P A;  3G4S H;  5JVG J;  1N5W B;  2OMD A;  4U67 J;  1NVI E;  1FMA E;  3C2R A;  4I9A A;  4WF9 J;  2PA2 A;  4ZOH A;  5DM7 J;  1OTP A;  2OTL H;  3GNN A;  5HL7 J;  3CCS H;  4KWW A;  5AYY A;  1FO4 A;  4XR5 A;  1VQ7 H;  2WK5 A;  1QAP A;  2W54 B;  3NVW C;  3BII E;  3CCR H;  4C7Y A;  3CD6 H;  5GAG N;  3C2E A;  1KC8 J;  4GA6 A;  1DGJ A;  1YIT H;  1VQ6 H;  1Q7Y J;  1FM0 E;  2B7N A;  4C80 A;  1S72 H;  1JRO B;  2QEX H;  1VQO H;  1KQS H;  3AMZ A;  4EAF A;  3AN1 A;  5AYX A;  1NVJ A;  3CME H;  2ZJP J;  3AM9 A;  2W3S B;  4YEK A;  2TPT A;  5AYZ A;  5MPO C;  2E3T A;  1M90 J;  3CPW H;  1VQ9 H;  4IOA J;  1JRP B;  2QIE A;  1VQP H;  5HUP A;  1ZXI B;  1FFU B;  3CC7 H;  4C7Z A;  1VQL H;  1SIJ A;  3FAH A;  3L0G A;  1Q82 J;  2ZJR J;  1QPQ A;  2I14 A;  4WCE J;  3NVV C;  3I55 H;  4WFB J;  1FIQ C;  4IOC J;  3CXC H;  2W55 B;  3PIP J;  4GA5 A;  1Y69 K;  1NJI J;  4US8 A;  1VQ4 H;  2J0F A;  3WO0 A;  3NS1 C;  3C2F A;  1YI2 H;  1RM6 A;  3TQV A;  2B7P A;  1YTE A;  5AN9 F;  5GAH N;  2QA4 H;  3OW2 H;  1V97 A;  4UY8 M;  3PAJ A;  1N61 B;  4EAD A;  3CMA H;  4IO9 J;  3I56 H;  5GAD N;  1X1O A;  3SR6 C;  1QPO A;  1K73 J;  1K9M J;  1K8A J;  2Q5W E;  1QVG H;  3H5Q A;  1WYG A;  4KWV A;  4YYY A;  4WFA J;  1QPR A;  1SB3 A;  1YJW H;  1YJ9 H;  3CCM H;  3DLL J;  1VQN H;  2JBM A;  2WK6 A;  3C2V A;  5H1S O;  1JJ2 H;  4GA4 A;  1YIJ H;  1YJN H;  4X46 A;  3CCV H;  1M1K J;  3CCU H;  4AP8 A;  4LHM A;  3CCE H;  1N8R J;  1YTD A;  2ZJQ J;  1BRW A; 
#chains in the Genus database with same CATH homology
 5GAE N;  3CCL H;  3PIO J;  3CCQ H;  1QVF H;  1Q86 J;  3G6E H;  5MLC O;  5DM6 J;  1VQK H;  2OTJ H;  1W2B H;  1Q81 J;  1VQM H;  3CC4 H;  1KD1 J;  1WKI A;  1YHQ H;  3CCJ H;  1VQ5 H;  3J7Z M;  4WFN J;  3G71 H;  3CF5 J;  1VQ8 H;  3CC2 H;  3G4S H;  5JVG J;  4U67 J;  4WF9 J;  2PA2 A;  5DM7 J;  2OTL H;  5HL7 J;  3CCS H;  1VQ7 H;  3CCR H;  3CD6 H;  5GAG N;  1KC8 J;  1YIT H;  1VQ6 H;  1Q7Y J;  1S72 H;  2QEX H;  1VQO H;  1KQS H;  3CME H;  2ZJP J;  1M90 J;  3CPW H;  1VQ9 H;  4IOA J;  1VQP H;  3CC7 H;  1VQL H;  1Q82 J;  2ZJR J;  4WCE J;  4IOC J;  3I55 H;  4WFB J;  3CXC H;  3PIP J;  1Y69 K;  1NJI J;  1VQ4 H;  1YI2 H;  5GAH N;  5AN9 F;  2QA4 H;  3OW2 H;  4UY8 M;  3CMA H;  4IO9 J;  3I56 H;  5GAD N;  1K73 J;  1K9M J;  1K8A J;  1QVG H;  4WFA J;  1YJW H;  1YJ9 H;  3CCM H;  3DLL J;  1VQN H;  5H1S O;  1JJ2 H;  1YIJ H;  1YJN H;  1M1K J;  3CCV H;  3CCU H;  3CCE H;  1N8R J;  2ZJQ J;  5JVH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...