3CD61

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6100
1VQLZ 3I56Z 1YI2Z 1VQP1 1QVGZ 1K731 1K9M1 3I55Z 2QA4Z 3CCUZ 1VQO1 1KQSZ 1VQPZ 1Q822 1VQ5Z 3CCRZ 3CCLZ 1Q7Y2 2OTJZ 1W2BY 1VQL1 1YHQZ 3CCSZ 3CME1 1VQ6Z 3G6E1 2OTJ1 1KC81 1VQ51 1YJ9Z 2QA41 1JJ2Z 3CXCZ 3CCU1 1VQOZ 3CCQZ 1VQKZ 1KD12 3G4SZ 3I561 1YI21 1VQ7Z 1M902 1KQSY 3OW2Y 1M901 1YIT1 3OW2Z 1YIJ1 3G6EZ 1S721 1VQM1 3CMEZ 1N8R2 1K732 3CPWY 1VQNZ 2OTLZ 1VQK1 3CCJ1 3CC71 3CC2Z 1KC82 3CMA1 1YJW1 1YJ91 3CCMZ 3CCR1 1VQ9Z 3CXCY 1M1K2 1VQN1 1S72Z 3CD6Z 3CCS1 1VQMZ 1VQ4Z 1W2BZ 1Q812 1YITZ 3G4S1 3CCVZ 1K9M2 3CC7Z 3CC41 1K8A1 1VQ81 2QEXZ 1Q7Y1 3CCEZ 1VQ41 1YJWZ 1YIJZ 1QVFY 1YJN1 1QVFZ 1QVGY 3CC21 1Q861 1VQ71 3CCJZ 3CD61 1M1K1 3G71Z 3CCQ1 1VQ91 1Q821 2QEX1 1Q811 3CCM1 3CCL1 1VQ8Z 1KD11 3CC4Z 1K8A2 3I551 1VQ61 1NJI1 3CMAZ 3CPWZ 3G711 3CCV1 1NJI2 2OTL1 1Q862 1N8R1 1YJNZ 1JJ2Y 1YHQ1 3CCE1
chains in the Genus database with same CATH superfamily
2AYDA 1YI2Z 3GKQA 4NOZA 2V3VA 1K731 1TWFI 2QA4Z 4Y7NI 2F4MA 1KQSZ 1X0TA 4E2YA 3GTPI 4A3MI 3EEDA 1Q7Y2 3J80b 3GCFA 2IZ4A 1TWAI 3VMGA 3CME1 1VQ6Z 2PK7A 2YU9I 3G6E1 5IT9f 3D2LA 2KI7B 1RO0A 4E31A 2LEXA 1VQOZ 4HGZA 1P9NA 3CCQZ 3JAMb 1NUIA 4MD9A 4E2ZA 2YADA 3I561 3ESWA 3OW2Z 1I3QI 2IV2X 5D1OA 1S721 3NH5A 2PM9A 1L1OC 1VQK1 4MRIA 2JIMA 1YJ91 3GTMS 4HH4A 2KPIA 2H85A 3VMIA 2NAPA 1I6HI 3HOUI 1VQMZ 2VPWA 3QWUA 1YITZ 1RNIA 4EWCA 1K9M2 2JA7I 3CC41 3EERA 4MONA 5C4JI 1YJWZ 1USPA 5CM2M 3LUSA 3CC21 1VQ71 2GTIA 3J81f 4AYBA 3FKII 2QRDB 2JR6A 1VQ8Z 3J80f 1KD11 2K3RA 2V45A 4RVGA 2JIQA 1RO2A 3GTOI 2R92I 1NJI2 4BY1I 1Q862 2VUGA 4BBRI 1YHQ1 2V8JA 3MZLB 2O4HA 1VQP1 1QVGZ 3TE5B 1RO4A 4E2WA 4BXXI 1VQO1 2Q51A 5C4XI 1VQPZ 1RQFA 5T6BA 4NBDA 1YHQZ 3NH8A 3CCSZ 3NFZA 4A3EI 4DQYB 1VLAA 2VPZA 3PO3I 1Z01A 1TWGI 2OTJ1 1WCMI 1KC81 4A3LI 1USPB 2OZKA 1Y8CA 2RIQA 4TNUA 2E2HI 4NBCA 1VQ7Z 1KQSY 2ZAEB 3FQMA 1YIT1 1VQM1 1WJ2A 1N8R2 1S7MA 2PMZA 3S1RI 5T64A 1JWHC 3CCMZ 3T4NB 3D6WA 4BBSI 1VQ9Z 3M4OI 2VUMI 4E33A 1NP6A 1ZB9A 1AA6A 2JIOA 2HU9A 2M48A 3CCS1 4A3FI 3CD6Z 1ZB8A 4A3DI 1VQ4Z 1Z03A 2WB1A 4NBAA 3NH4A 3S15I 1PFTA 1QXFA 2GTHA 2P3YA 1Y1WI 1QYPA 4QTTA 2W04A 3VB9A 1VQ81 3I07A 1Q7Y1 2R93I 1VQ41 1WW9A 2IZ3A 1QVFZ 1Q861 3M3YI 3S1NI 2O53A 3KIFA 3CCQ1 4E32A 1RLYA 1VQ91 1Q821 1Y1VS 3P5JB 4NBFA 1Q811 3CCM1 5LL6f 3HOZI 3CC4Z 1VQ61 3GTLI 4BY7I 4A3JI 2J6AA 2OTL1 3I4MI 1DL6A 2QREB 3GTGI 1JJ2Z 2DE7A 4NFRA 5A2Qf 1WZNA 2E7ZA 3CCUZ 1SIWA 2QR1B 4RVFA 3J7A4 1VQ5Z 3F3PC 2NVQI 3CCLZ 2OTJZ 3H3VJ 2LFUA 4MH4A 2B63I 3IR7A 3GTMI 2LIYA 3U50C 4NBGA 4DK1A 3MONA 3J81b 5IT9b 2JA6I 4X6AI 4Y52I 3IFUA 2R7ZI 1WIIA 2OOXB 1YJ9Z 1QF8A 1ZH1A 2RHBA 2W03A 2I3CA 1R9TI 2JA8I 1VQKZ 3NDJA 3NDIA 1KD12 3G4SZ 2OOYB 3I4NI 4S1TA 1M902 3S16I 3CQZI 3OW2Y 1YIJ1 2P28A 3G6EZ 2JMOA 2VF1A 5D1OB 3CMEZ 4RV9A 3KIHA 1K732 3CPWY 1VQNZ 3CC2Z 2V8KA 3CMA1 4NB9A 1YJW1 1X3ZA 1Z02A 2HF1A 3CXCY 1M1K2 4DGLA 1N2FA 4MD7A 2M6NA 5IP7I 2K5RA 2G2KA 1Q812 2NVXI 3S1MI 4XX2A 5T67A 5FLXf 4NBBA 2DE5A 2R6MA 3CC7Z 2QKDA 2NVTI 3D9XA 2JA5I 3HKZA 2JIRA 3CCEZ 2JUBA 1YJN1 3HOVI 3BG0B 3PO3S 2RT9A 4A3GI 2BJOA 2JS4A 3TDHB 3IF8A 2QEX1 1K8A2 3I551 2NVYI 3CMAZ 3G711 3CCV1 1TWCI 2VPYA 2E2II 1Y1VI 4CL1A 1VQLZ 3I56Z 5C3EI 1KRLA 4RS4A 1K9M1 1TFIA 4A3BI 1TWHI 3I55Z 3BG1B 3HOYI 4RVDA 1X3WA 4QTUA 1Q822 3CCRZ 5A2Qb 1W2BY 1VQL1 3PO2I 4MXUA 4RVHA 3S2DI 3VMHA 2JIPA 5IP9I 2QRCB 3HOWI 1VQ51 2QA41 3CXCZ 2JNYA 3CCU1 4A3KI 3FQQA 5AN9F 2F4OA 1YI21 1M901 3IX0A 1I50I 2QLVB 2RBLA 3GTQI 1YUAA 4NBEA 4NH1C 2OTLZ 1LQLA 3CCJ1 3CC71 1KC82 3RZOI 5D1PA 1K83I 3HOXI 3CCR1 4A93I 2Y0SA 3S14I 3S17I 1YUKA 3K7AI 2Q4ZA 4NB8A 3H0GI 4HGYA 3VTNA 1VQN1 1S72Z 1W2BZ 3G4S1 3CCVZ 3GTJI 4MD8A 4A3CI 1K8A1 1Q16A 1FDIA 3Q87A 1ML8A 2V8IA 2QEXZ 3GTKI 1YIJZ 1FDOA 1QVFY 1QVGY 5FLXb 3CCJZ 3CD61 1M1K1 3G71Z 3RZDI 4NBHA 4E2XA 3S2HI 2WAQA 3S1QI 4A3II 3JAMf 2VPXA 2DE6A 1SFOI 3CCL1 5C44I 2E9HA 2EGTA 3MZKB 5FLMI 2E2JI 1NJI1 3F3FC 3CPWZ 2AKLA 2RPRA 2GU2A 1N8R1 1YJNZ 1JJ2Y 4E30A 3CCE1
chains in the Genus database with same CATH topology
1YI2Z 3GKQA 4NOZA 1K731 1TWFI 2QA4Z 4Y7NI 2F4MA 1KQSZ 1X0TA 4E2YA 3GTPI 4A3MI 3EEDA 1Q7Y2 3J80b 3GCFA 2IZ4A 1TWAI 3VMGA 3CME1 1VQ6Z 2PK7A 2YU9I 3G6E1 5IT9f 2KI7B 1RO0A 4E31A 1VQOZ 4HGZA 1P9NA 3CCQZ 3JAMb 1NUIA 4MD9A 4E2ZA 2YADA 3I561 3ESWA 3OW2Z 1I3QI 5D1OA 1S721 3NH5A 2PM9A 1L1OC 1VQK1 4MRIA 1YJ91 3GTMS 4HH4A 2KPIA 2H85A 3VMIA 1I6HI 3HOUI 1VQMZ 3QWUA 1YITZ 1RNIA 4EWCA 1K9M2 2JA7I 3CC41 3EERA 4MONA 5C4JI 1YJWZ 1USPA 5CM2M 3LUSA 3CC21 1VQ71 2GTIA 3J81f 4AYBA 3FKII 2QRDB 2JR6A 1VQ8Z 3J80f 1KD11 2K3RA 4RVGA 1RO2A 3GTOI 2R92I 1NJI2 4BY1I 1Q862 2VUGA 4BBRI 1YHQ1 2V8JA 3MZLB 2O4HA 1VQP1 1QVGZ 3TE5B 1RO4A 4E2WA 4BXXI 5C4XI 2Q51A 1VQO1 1VQPZ 1RQFA 5T6BA 4NBDA 1YHQZ 3NH8A 3CCSZ 3NFZA 4A3EI 4DQYB 1VLAA 3PO3I 1Z01A 1TWGI 2OTJ1 1WCMI 1KC81 4A3LI 1USPB 2OZKA 2RIQA 4TNUA 2E2HI 4NBCA 1VQ7Z 1KQSY 2ZAEB 3FQMA 1YIT1 1VQM1 1N8R2 1S7MA 2PMZA 3S1RI 5T64A 1JWHC 3CCMZ 3T4NB 3D6WA 4BBSI 1VQ9Z 3M4OI 2VUMI 4E33A 1NP6A 1ZB9A 2HU9A 2M48A 3CCS1 4A3FI 3CD6Z 1ZB8A 4A3DI 1VQ4Z 1Z03A 2WB1A 4NBAA 3NH4A 3S15I 1PFTA 2GTHA 2P3YA 1Y1WI 1QYPA 4QTTA 2W04A 3VB9A 1VQ81 3I07A 1Q7Y1 2R93I 1VQ41 1WW9A 2IZ3A 1QVFZ 1Q861 3M3YI 3S1NI 2O53A 3KIFA 3CCQ1 4E32A 1RLYA 1VQ91 1Q821 1Y1VS 3P5JB 4NBFA 1Q811 3CCM1 5LL6f 3HOZI 3CC4Z 1VQ61 3GTLI 4BY7I 4A3JI 2J6AA 2OTL1 3I4MI 1DL6A 2QREB 3GTGI 1JJ2Z 2DE7A 4NFRA 5A2Qf 3CCUZ 2QR1B 4RVFA 3J7A4 1VQ5Z 3F3PC 2NVQI 3CCLZ 2OTJZ 3H3VJ 2LFUA 4MH4A 2B63I 3GTMI 2LIYA 3U50C 4NBGA 4DK1A 3MONA 3J81b 5IT9b 2JA6I 4X6AI 4Y52I 3IFUA 2R7ZI 1WIIA 2OOXB 1YJ9Z 1QF8A 1ZH1A 2RHBA 2W03A 2I3CA 1R9TI 2JA8I 1VQKZ 3NDJA 3NDIA 1KD12 3G4SZ 2OOYB 3I4NI 4S1TA 1M902 3S16I 3CQZI 3OW2Y 1YIJ1 2P28A 3G6EZ 2JMOA 2VF1A 5D1OB 3CMEZ 4RV9A 3KIHA 1K732 3CPWY 1VQNZ 3CC2Z 2V8KA 3CMA1 4NB9A 1YJW1 1X3ZA 1Z02A 2HF1A 3CXCY 1M1K2 4DGLA 1N2FA 4MD7A 2M6NA 5IP7I 2K5RA 2G2KA 1Q812 2NVXI 3S1MI 4XX2A 5T67A 5FLXf 4NBBA 2DE5A 2R6MA 3CC7Z 2QKDA 2NVTI 3D9XA 2JA5I 3HKZA 3CCEZ 2JUBA 1YJN1 3HOVI 3BG0B 3PO3S 2RT9A 4A3GI 2BJOA 2JS4A 3TDHB 3IF8A 2QEX1 1K8A2 3I551 2NVYI 3CMAZ 3G711 3CCV1 1TWCI 2E2II 1Y1VI 4CL1A 1VQLZ 3I56Z 5C3EI 1KRLA 4RS4A 1K9M1 1TFIA 4A3BI 1TWHI 3I55Z 3BG1B 3HOYI 4RVDA 1X3WA 4QTUA 1Q822 3CCRZ 5A2Qb 1W2BY 1VQL1 3PO2I 4MXUA 4RVHA 3S2DI 3VMHA 5IP9I 2QRCB 3HOWI 1VQ51 2QA41 3CXCZ 2JNYA 3CCU1 4A3KI 3FQQA 5AN9F 2F4OA 1YI21 1M901 3IX0A 1I50I 2QLVB 2RBLA 3GTQI 1YUAA 4NBEA 4NH1C 2OTLZ 1LQLA 3CCJ1 3CC71 1KC82 3RZOI 5D1PA 1K83I 3HOXI 3CCR1 4A93I 2Y0SA 3S14I 3S17I 1YUKA 3K7AI 2Q4ZA 4NB8A 3H0GI 4HGYA 3VTNA 1VQN1 1S72Z 1W2BZ 3G4S1 3CCVZ 3GTJI 4MD8A 4A3CI 1K8A1 3Q87A 1ML8A 2V8IA 2QEXZ 3GTKI 1YIJZ 1QVFY 1QVGY 5FLXb 3CCJZ 3CD61 1M1K1 3G71Z 3RZDI 4NBHA 4E2XA 3S2HI 2WAQA 3S1QI 4A3II 3JAMf 1SFOI 2DE6A 3CCL1 5C44I 2E9HA 2EGTA 3MZKB 5FLMI 2E2JI 1NJI1 3F3FC 3CPWZ 2AKLA 2RPRA 2GU2A 1N8R1 1YJNZ 1JJ2Y 4E30A 3CCE1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL Z;  3I56 Z;  1YI2 Z;  1VQP 1;  1QVG Z;  1K73 1;  1K9M 1;  3I55 Z;  2QA4 Z;  3CCU Z;  1VQO 1;  1KQS Z;  1VQP Z;  1Q82 2;  1VQ5 Z;  3CCR Z;  3CCL Z;  1Q7Y 2;  2OTJ Z;  1W2B Y;  1VQL 1;  1YHQ Z;  3CCS Z;  3CME 1;  1VQ6 Z;  3G6E 1;  2OTJ 1;  1KC8 1;  1VQ5 1;  1YJ9 Z;  2QA4 1;  1JJ2 Z;  3CXC Z;  3CCU 1;  1VQO Z;  3CCQ Z;  1VQK Z;  1KD1 2;  3G4S Z;  3I56 1;  1YI2 1;  1VQ7 Z;  1M90 2;  1KQS Y;  3OW2 Y;  1M90 1;  1YIT 1;  3OW2 Z;  1YIJ 1;  3G6E Z;  1S72 1;  1VQM 1;  3CME Z;  1N8R 2;  1K73 2;  3CPW Y;  1VQN Z;  2OTL Z;  1VQK 1;  3CCJ 1;  3CC7 1;  3CC2 Z;  1KC8 2;  3CMA 1;  1YJW 1;  1YJ9 1;  3CCM Z;  3CCR 1;  1VQ9 Z;  3CXC Y;  1M1K 2;  1VQN 1;  1S72 Z;  3CD6 Z;  3CCS 1;  1VQM Z;  1VQ4 Z;  1W2B Z;  1Q81 2;  1YIT Z;  3G4S 1;  3CCV Z;  1K9M 2;  3CC7 Z;  3CC4 1;  1K8A 1;  1VQ8 1;  2QEX Z;  1Q7Y 1;  3CCE Z;  1VQ4 1;  1YJW Z;  1YIJ Z;  1QVF Y;  1YJN 1;  1QVF Z;  1QVG Y;  3CC2 1;  1Q86 1;  1VQ7 1;  3CCJ Z;  3CD6 1;  1M1K 1;  3G71 Z;  3CCQ 1;  1VQ9 1;  1Q82 1;  2QEX 1;  1Q81 1;  3CCM 1;  3CCL 1;  1VQ8 Z;  1KD1 1;  3CC4 Z;  1K8A 2;  3I55 1;  1VQ6 1;  1NJI 1;  3CMA Z;  3CPW Z;  3G71 1;  3CCV 1;  1NJI 2;  2OTL 1;  1Q86 2;  1N8R 1;  1YJN Z;  1JJ2 Y;  1YHQ 1;  3CCE 1; 
#chains in the Genus database with same CATH topology
 2AYD A;  1YI2 Z;  3GKQ A;  4NOZ A;  2V3V A;  1K73 1;  1TWF I;  2QA4 Z;  4Y7N I;  2F4M A;  1KQS Z;  1X0T A;  4E2Y A;  3GTP I;  4A3M I;  3EED A;  1Q7Y 2;  3J80 b;  3GCF A;  2IZ4 A;  1TWA I;  3VMG A;  3CME 1;  1VQ6 Z;  2PK7 A;  2YU9 I;  3G6E 1;  5IT9 f;  3D2L A;  2KI7 B;  1RO0 A;  4E31 A;  2LEX A;  1VQO Z;  4HGZ A;  1P9N A;  3CCQ Z;  3JAM b;  1NUI A;  4MD9 A;  4E2Z A;  2YAD A;  3I56 1;  3ESW A;  3OW2 Z;  1I3Q I;  2IV2 X;  5D1O A;  1S72 1;  3NH5 A;  2PM9 A;  1L1O C;  1VQK 1;  4MRI A;  2JIM A;  1YJ9 1;  3GTM S;  4HH4 A;  2KPI A;  2H85 A;  3VMI A;  2NAP A;  1I6H I;  3HOU I;  1VQM Z;  2VPW A;  3QWU A;  1YIT Z;  1RNI A;  4EWC A;  1K9M 2;  2JA7 I;  3CC4 1;  3EER A;  4MON A;  5C4J I;  1YJW Z;  1USP A;  5CM2 M;  3LUS A;  3CC2 1;  1VQ7 1;  2GTI A;  3J81 f;  4AYB A;  3FKI I;  2QRD B;  2JR6 A;  1VQ8 Z;  3J80 f;  1KD1 1;  2K3R A;  2V45 A;  4RVG A;  2JIQ A;  1RO2 A;  3GTO I;  2R92 I;  1NJI 2;  4BY1 I;  1Q86 2;  2VUG A;  4BBR I;  1YHQ 1;  2V8J A;  3MZL B;  2O4H A;  1VQP 1;  1QVG Z;  3TE5 B;  1RO4 A;  4E2W A;  4BXX I;  1VQO 1;  2Q51 A;  5C4X I;  1VQP Z;  1RQF A;  5T6B A;  4NBD A;  1YHQ Z;  3NH8 A;  3CCS Z;  3NFZ A;  4A3E I;  4DQY B;  1VLA A;  2VPZ A;  3PO3 I;  1Z01 A;  1TWG I;  2OTJ 1;  1WCM I;  1KC8 1;  4A3L I;  1USP B;  2OZK A;  1Y8C A;  2RIQ A;  4TNU A;  2E2H I;  4NBC A;  1VQ7 Z;  1KQS Y;  2ZAE B;  3FQM A;  1YIT 1;  1VQM 1;  1WJ2 A;  1N8R 2;  1S7M A;  2PMZ A;  3S1R I;  5T64 A;  1JWH C;  3CCM Z;  3T4N B;  3D6W A;  4BBS I;  1VQ9 Z;  3M4O I;  2VUM I;  4E33 A;  1NP6 A;  1ZB9 A;  1AA6 A;  2JIO A;  2HU9 A;  2M48 A;  3CCS 1;  4A3F I;  3CD6 Z;  1ZB8 A;  4A3D I;  1VQ4 Z;  1Z03 A;  2WB1 A;  4NBA A;  3NH4 A;  3S15 I;  1PFT A;  1QXF A;  2GTH A;  2P3Y A;  1Y1W I;  1QYP A;  4QTT A;  2W04 A;  3VB9 A;  1VQ8 1;  3I07 A;  1Q7Y 1;  2R93 I;  1VQ4 1;  1WW9 A;  2IZ3 A;  1QVF Z;  1Q86 1;  3M3Y I;  3S1N I;  2O53 A;  3KIF A;  3CCQ 1;  4E32 A;  1RLY A;  1VQ9 1;  1Q82 1;  1Y1V S;  3P5J B;  4NBF A;  1Q81 1;  3CCM 1;  5LL6 f;  3HOZ I;  3CC4 Z;  1VQ6 1;  3GTL I;  4BY7 I;  4A3J I;  2J6A A;  2OTL 1;  3I4M I;  1DL6 A;  2QRE B;  3GTG I;  1JJ2 Z;  2DE7 A;  4NFR A;  5A2Q f;  1WZN A;  2E7Z A;  3CCU Z;  1SIW A;  2QR1 B;  4RVF A;  3J7A 4;  1VQ5 Z;  3F3P C;  2NVQ I;  3CCL Z;  2OTJ Z;  3H3V J;  2LFU A;  4MH4 A;  2B63 I;  3IR7 A;  3GTM I;  2LIY A;  3U50 C;  4NBG A;  4DK1 A;  3MON A;  3J81 b;  5IT9 b;  2JA6 I;  4X6A I;  4Y52 I;  3IFU A;  2R7Z I;  1WII A;  2OOX B;  1YJ9 Z;  1QF8 A;  1ZH1 A;  2RHB A;  2W03 A;  2I3C A;  1R9T I;  2JA8 I;  1VQK Z;  3NDJ A;  3NDI A;  1KD1 2;  3G4S Z;  2OOY B;  3I4N I;  4S1T A;  1M90 2;  3S16 I;  3CQZ I;  3OW2 Y;  1YIJ 1;  2P28 A;  3G6E Z;  2JMO A;  2VF1 A;  5D1O B;  3CME Z;  4RV9 A;  3KIH A;  1K73 2;  3CPW Y;  1VQN Z;  3CC2 Z;  2V8K A;  3CMA 1;  4NB9 A;  1YJW 1;  1X3Z A;  1Z02 A;  2HF1 A;  3CXC Y;  1M1K 2;  4DGL A;  1N2F A;  4MD7 A;  2M6N A;  5IP7 I;  2K5R A;  2G2K A;  1Q81 2;  2NVX I;  3S1M I;  4XX2 A;  5T67 A;  5FLX f;  4NBB A;  2DE5 A;  2R6M A;  3CC7 Z;  2QKD A;  2NVT I;  3D9X A;  2JA5 I;  3HKZ A;  2JIR A;  3CCE Z;  2JUB A;  1YJN 1;  3HOV I;  3BG0 B;  3PO3 S;  2RT9 A;  4A3G I;  2BJO A;  2JS4 A;  3TDH B;  3IF8 A;  2QEX 1;  1K8A 2;  3I55 1;  2NVY I;  3CMA Z;  3G71 1;  3CCV 1;  1TWC I;  2VPY A;  2E2I I;  1Y1V I;  4CL1 A;  1VQL Z;  3I56 Z;  5C3E I;  1KRL A;  4RS4 A;  1K9M 1;  1TFI A;  4A3B I;  1TWH I;  3I55 Z;  3BG1 B;  3HOY I;  4RVD A;  1X3W A;  4QTU A;  1Q82 2;  3CCR Z;  5A2Q b;  1W2B Y;  1VQL 1;  3PO2 I;  4MXU A;  4RVH A;  3S2D I;  3VMH A;  2JIP A;  5IP9 I;  2QRC B;  3HOW I;  1VQ5 1;  2QA4 1;  3CXC Z;  2JNY A;  3CCU 1;  4A3K I;  3FQQ A;  5AN9 F;  2F4O A;  1YI2 1;  1M90 1;  3IX0 A;  1I50 I;  2QLV B;  2RBL A;  3GTQ I;  1YUA A;  4NBE A;  4NH1 C;  2OTL Z;  1LQL A;  3CCJ 1;  3CC7 1;  1KC8 2;  3RZO I;  5D1P A;  1K83 I;  3HOX I;  3CCR 1;  4A93 I;  2Y0S A;  3S14 I;  3S17 I;  1YUK A;  3K7A I;  2Q4Z A;  4NB8 A;  3H0G I;  4HGY A;  3VTN A;  1VQN 1;  1S72 Z;  1W2B Z;  3G4S 1;  3CCV Z;  3GTJ I;  4MD8 A;  4A3C I;  1K8A 1;  1Q16 A;  1FDI A;  3Q87 A;  1ML8 A;  2V8I A;  2QEX Z;  3GTK I;  1YIJ Z;  1FDO A;  1QVF Y;  1QVG Y;  5FLX b;  3CCJ Z;  3CD6 1;  1M1K 1;  3G71 Z;  3RZD I;  4NBH A;  4E2X A;  3S2H I;  2WAQ A;  3S1Q I;  4A3I I;  3JAM f;  2VPX A;  2DE6 A;  1SFO I;  3CCL 1;  5C44 I;  2E9H A;  2EGT A;  3MZK B;  5FLM I;  2E2J I;  1NJI 1;  3F3F C;  3CPW Z;  2AKL A;  2RPR A;  2GU2 A;  1N8R 1;  1YJN Z;  1JJ2 Y;  4E30 A;  3CCE 1; 
#chains in the Genus database with same CATH homology
 1YI2 Z;  3GKQ A;  4NOZ A;  1K73 1;  1TWF I;  2QA4 Z;  4Y7N I;  2F4M A;  1KQS Z;  1X0T A;  4E2Y A;  3GTP I;  4A3M I;  3EED A;  1Q7Y 2;  3J80 b;  3GCF A;  2IZ4 A;  1TWA I;  3VMG A;  3CME 1;  1VQ6 Z;  2PK7 A;  2YU9 I;  3G6E 1;  5IT9 f;  2KI7 B;  1RO0 A;  4E31 A;  1VQO Z;  4HGZ A;  1P9N A;  3CCQ Z;  3JAM b;  1NUI A;  4MD9 A;  4E2Z A;  2YAD A;  3I56 1;  3ESW A;  3OW2 Z;  1I3Q I;  5D1O A;  1S72 1;  3NH5 A;  2PM9 A;  1L1O C;  1VQK 1;  4MRI A;  1YJ9 1;  3GTM S;  4HH4 A;  2KPI A;  2H85 A;  3VMI A;  1I6H I;  3HOU I;  1VQM Z;  3QWU A;  1YIT Z;  1RNI A;  4EWC A;  1K9M 2;  2JA7 I;  3CC4 1;  3EER A;  4MON A;  5C4J I;  1YJW Z;  1USP A;  5CM2 M;  3LUS A;  3CC2 1;  1VQ7 1;  2GTI A;  3J81 f;  4AYB A;  3FKI I;  2QRD B;  2JR6 A;  1VQ8 Z;  3J80 f;  1KD1 1;  2K3R A;  4RVG A;  1RO2 A;  3GTO I;  2R92 I;  1NJI 2;  4BY1 I;  1Q86 2;  2VUG A;  4BBR I;  1YHQ 1;  2V8J A;  3MZL B;  2O4H A;  1VQP 1;  1QVG Z;  3TE5 B;  1RO4 A;  4E2W A;  4BXX I;  5C4X I;  2Q51 A;  1VQO 1;  1VQP Z;  1RQF A;  5T6B A;  4NBD A;  1YHQ Z;  3NH8 A;  3CCS Z;  3NFZ A;  4A3E I;  4DQY B;  1VLA A;  3PO3 I;  1Z01 A;  1TWG I;  2OTJ 1;  1WCM I;  1KC8 1;  4A3L I;  1USP B;  2OZK A;  2RIQ A;  4TNU A;  2E2H I;  4NBC A;  1VQ7 Z;  1KQS Y;  2ZAE B;  3FQM A;  1YIT 1;  1VQM 1;  1N8R 2;  1S7M A;  2PMZ A;  3S1R I;  5T64 A;  1JWH C;  3CCM Z;  3T4N B;  3D6W A;  4BBS I;  1VQ9 Z;  3M4O I;  2VUM I;  4E33 A;  1NP6 A;  1ZB9 A;  2HU9 A;  2M48 A;  3CCS 1;  4A3F I;  3CD6 Z;  1ZB8 A;  4A3D I;  1VQ4 Z;  1Z03 A;  2WB1 A;  4NBA A;  3NH4 A;  3S15 I;  1PFT A;  2GTH A;  2P3Y A;  1Y1W I;  1QYP A;  4QTT A;  2W04 A;  3VB9 A;  1VQ8 1;  3I07 A;  1Q7Y 1;  2R93 I;  1VQ4 1;  1WW9 A;  2IZ3 A;  1QVF Z;  1Q86 1;  3M3Y I;  3S1N I;  2O53 A;  3KIF A;  3CCQ 1;  4E32 A;  1RLY A;  1VQ9 1;  1Q82 1;  1Y1V S;  3P5J B;  4NBF A;  1Q81 1;  3CCM 1;  5LL6 f;  3HOZ I;  3CC4 Z;  1VQ6 1;  3GTL I;  4BY7 I;  4A3J I;  2J6A A;  2OTL 1;  3I4M I;  1DL6 A;  2QRE B;  3GTG I;  1JJ2 Z;  2DE7 A;  4NFR A;  5A2Q f;  3CCU Z;  2QR1 B;  4RVF A;  3J7A 4;  1VQ5 Z;  3F3P C;  2NVQ I;  3CCL Z;  2OTJ Z;  3H3V J;  2LFU A;  4MH4 A;  2B63 I;  3GTM I;  2LIY A;  3U50 C;  4NBG A;  4DK1 A;  3MON A;  3J81 b;  5IT9 b;  2JA6 I;  4X6A I;  4Y52 I;  3IFU A;  2R7Z I;  1WII A;  2OOX B;  1YJ9 Z;  1QF8 A;  1ZH1 A;  2RHB A;  2W03 A;  2I3C A;  1R9T I;  2JA8 I;  1VQK Z;  3NDJ A;  3NDI A;  1KD1 2;  3G4S Z;  2OOY B;  3I4N I;  4S1T A;  1M90 2;  3S16 I;  3CQZ I;  3OW2 Y;  1YIJ 1;  2P28 A;  3G6E Z;  2JMO A;  2VF1 A;  5D1O B;  3CME Z;  4RV9 A;  3KIH A;  1K73 2;  3CPW Y;  1VQN Z;  3CC2 Z;  2V8K A;  3CMA 1;  4NB9 A;  1YJW 1;  1X3Z A;  1Z02 A;  2HF1 A;  3CXC Y;  1M1K 2;  4DGL A;  1N2F A;  4MD7 A;  2M6N A;  5IP7 I;  2K5R A;  2G2K A;  1Q81 2;  2NVX I;  3S1M I;  4XX2 A;  5T67 A;  5FLX f;  4NBB A;  2DE5 A;  2R6M A;  3CC7 Z;  2QKD A;  2NVT I;  3D9X A;  2JA5 I;  3HKZ A;  3CCE Z;  2JUB A;  1YJN 1;  3HOV I;  3BG0 B;  3PO3 S;  2RT9 A;  4A3G I;  2BJO A;  2JS4 A;  3TDH B;  3IF8 A;  2QEX 1;  1K8A 2;  3I55 1;  2NVY I;  3CMA Z;  3G71 1;  3CCV 1;  1TWC I;  2E2I I;  1Y1V I;  4CL1 A;  1VQL Z;  3I56 Z;  5C3E I;  1KRL A;  4RS4 A;  1K9M 1;  1TFI A;  4A3B I;  1TWH I;  3I55 Z;  3BG1 B;  3HOY I;  4RVD A;  1X3W A;  4QTU A;  1Q82 2;  3CCR Z;  5A2Q b;  1W2B Y;  1VQL 1;  3PO2 I;  4MXU A;  4RVH A;  3S2D I;  3VMH A;  5IP9 I;  2QRC B;  3HOW I;  1VQ5 1;  2QA4 1;  3CXC Z;  2JNY A;  3CCU 1;  4A3K I;  3FQQ A;  5AN9 F;  2F4O A;  1YI2 1;  1M90 1;  3IX0 A;  1I50 I;  2QLV B;  2RBL A;  3GTQ I;  1YUA A;  4NBE A;  4NH1 C;  2OTL Z;  1LQL A;  3CCJ 1;  3CC7 1;  1KC8 2;  3RZO I;  5D1P A;  1K83 I;  3HOX I;  3CCR 1;  4A93 I;  2Y0S A;  3S14 I;  3S17 I;  1YUK A;  3K7A I;  2Q4Z A;  4NB8 A;  3H0G I;  4HGY A;  3VTN A;  1VQN 1;  1S72 Z;  1W2B Z;  3G4S 1;  3CCV Z;  3GTJ I;  4MD8 A;  4A3C I;  1K8A 1;  3Q87 A;  1ML8 A;  2V8I A;  2QEX Z;  3GTK I;  1YIJ Z;  1QVF Y;  1QVG Y;  5FLX b;  3CCJ Z;  3CD6 1;  1M1K 1;  3G71 Z;  3RZD I;  4NBH A;  4E2X A;  3S2H I;  2WAQ A;  3S1Q I;  4A3I I;  3JAM f;  1SFO I;  2DE6 A;  3CCL 1;  5C44 I;  2E9H A;  2EGT A;  3MZK B;  5FLM I;  2E2J I;  1NJI 1;  3F3F C;  3CPW Z;  2AKL A;  2RPR A;  2GU2 A;  1N8R 1;  1YJN Z;  1JJ2 Y;  4E30 A;  3CCE 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...