3CD6L

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
145
Chain Sequence
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 24
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cd6L02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 3cd6L01
3CMEL 1N8RM 1K73P 3CCEL 1Q82M 3CCLO 1S72O 3CCRL 2QA4O 1QVFK 3CMEO 1KC8M 1M1KP 1YI2L 3G71L 1K9MP 3CCRO 1VQLL 1YJ9L 1QVGN 3I56L 1N8RP 3CCVL 1YITO 1Q82P 3G6EL 1JJ2N 1VQ4O 1YI2O 1VQ6O 3G4SL 1Q7YM 1YIJL 1VQLO 3CMAO 3I56O 1KC8P 1VQKL 2QEXO 3CCJL 3OW2N 1W2BN 3CCML 1VQ5L 3CCEO 1YJWL 3CPWN 3CCSL 1M90M 1KQSN 3CCMO 1Q7YP 3CCUL 1K8AM 1QVFN 1VQOL 3G71O 3CCSO 1NJIM 1YJ9O 3CCVO 1JJ2K 3G6EO 1VQ8L 2OTJL 3CCQL 2OTLL 3G4SO 3CXCN 1YIJO 1YJNL 1M90P 1VQNL 1KD1M 3OW2K 1K8AP 1VQKO 3CCJO 1VQML 1W2BK 1VQ8O 1VQ9L 2OTLO 1VQ5O 3CPWK 1NJIP 3I55L 1YJWO 3CD6L 3CC2L 1Q81M 1Q86M 1VQMO 1KQSK 1VQ9O 1VQPL 1K73M 1QVGK 3I55O 3CCUO 3CD6O 3CC2O 1VQOO 1YITL 3CC4L 1VQ7L 1KD1P 1VQ4L 1VQ6L 1YHQL 1VQPO 3CC7L 3CMAL 3CCLL 1M1KM 1K9MM 2OTJO 3CC4O 1S72L 3CCQO 1VQ7O 1Q81P 1Q86P 3CXCK 2QEXL 1YHQO 2QA4L 1YJNO 1VQNO 3CC7O
chains in the Genus database with same CATH superfamily
3CMEL 1N8RM 1K73P 5DS6A 3CCEL 1Q82M 3CCLO 3NKDA 4WJ0A 5DQZA 1S72O 3CCRL 2QA4O 1QVFK 3CMEO 1KC8M 1M1KP 1YI2L 3G71L 1K9MP 3CCRO 1VQLL 4P6IC 1YJ9L 1QVGN 3I56L 1N8RP 3CCVL 1YITO 1Q82P 3G6EL 4QDLA 1JJ2N 1VQ4O 1YI2O 1VQ6O 3G4SL 1Q7YM 1YIJL 1VQLO 3CMAO 3GODA 3I56O 1KC8P 1VQKL 2QEXO 3CCJL 3OW2N 1W2BN 3CCML 1VQ5L 3CCEO 1YJWL 3CPWN 5DLJA 4N06A 3CCSL 1M90M 1KQSN 3CCMO 4XTKA 1Q7YP 3CCUL 1K8AM 1QVFN 1VQOL 3G71O 3CCSO 2YZSA 1NJIM 1YJ9O 3CCVO 1JJ2K 5FCLA 3G6EO 1VQ8L 2OTJL 3CCQL 2OTLL 3G4SO 3CXCN 1YIJO 1YJNL 1M90P 1VQNL 5DS4A 1KD1M 3OW2K 1K8AP 1VQKO 3CCJO 1VQML 1W2BK 5DS5A 1VQ8O 1VQ9L 2OTLO 1VQ5O 3CPWK 1NJIP 3I55L 1YJWO 3CD6L 3CC2L 1Q81M 1Q86M 1VQMO 1KQSK 1VQ9O 1VQPL 1K73M 1QVGK 4W8KA 3I55O 3CCUO 3CD6O 5DQTA 3CC2O 1VQOO 1YITL 3CC4L 1VQ7L 1KD1P 1VQ4L 1VQ6L 1YHQL 1VQPO 3CC7L 3CMAL 3CCLL 1M1KM 1K9MM 2OTJO 3CC4O 1S72L 3CCQO 1VQ7O 1Q81P 1Q86P 3CXCK 2QEXL 1YHQO 2QA4L 1YJNO 1VQNO 3CC7O
chains in the Genus database with same CATH topology
3CMEL 1N8RM 1K73P 5DS6A 3CCEL 1Q82M 3CCLO 3NKDA 4WJ0A 5DQZA 1S72O 3CCRL 2QA4O 1QVFK 3CMEO 1KC8M 1M1KP 1YI2L 3G71L 1K9MP 3CCRO 1VQLL 4P6IC 1YJ9L 1QVGN 3I56L 1N8RP 3CCVL 1YITO 1Q82P 3G6EL 4QDLA 1JJ2N 1VQ4O 1YI2O 1VQ6O 3G4SL 1Q7YM 1YIJL 1VQLO 3CMAO 3GODA 3I56O 1KC8P 1VQKL 2QEXO 3CCJL 3OW2N 1W2BN 3CCML 1VQ5L 3CCEO 1YJWL 3CPWN 5DLJA 4N06A 3CCSL 1M90M 1KQSN 3CCMO 4XTKA 1Q7YP 3CCUL 1K8AM 1QVFN 1VQOL 3G71O 3CCSO 2YZSA 1NJIM 1YJ9O 3CCVO 1JJ2K 5FCLA 3G6EO 1VQ8L 2OTJL 3CCQL 2OTLL 3G4SO 3CXCN 1YIJO 1YJNL 1M90P 1VQNL 5DS4A 1KD1M 3OW2K 1K8AP 1VQKO 3CCJO 1VQML 1W2BK 5DS5A 1VQ8O 1VQ9L 2OTLO 1VQ5O 3CPWK 1NJIP 3I55L 1YJWO 3CD6L 3CC2L 1Q81M 1Q86M 1VQMO 1KQSK 1VQ9O 1VQPL 1K73M 1QVGK 4W8KA 3I55O 3CCUO 3CD6O 5DQTA 3CC2O 1VQOO 1YITL 3CC4L 1VQ7L 1KD1P 1VQ4L 1VQ6L 1YHQL 1VQPO 3CC7L 3CMAL 3CCLL 1M1KM 1K9MM 2OTJO 3CC4O 1S72L 3CCQO 1VQ7O 1Q81P 1Q86P 3CXCK 2QEXL 1YHQO 2QA4L 1YJNO 1VQNO 3CC7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME L;  1N8R M;  1K73 P;  3CCE L;  1Q82 M;  3CCL O;  1S72 O;  3CCR L;  2QA4 O;  1QVF K;  3CME O;  1KC8 M;  1M1K P;  1YI2 L;  3G71 L;  1K9M P;  3CCR O;  1VQL L;  1YJ9 L;  1QVG N;  3I56 L;  1N8R P;  3CCV L;  1YIT O;  1Q82 P;  3G6E L;  1JJ2 N;  1VQ4 O;  1YI2 O;  1VQ6 O;  3G4S L;  1Q7Y M;  1YIJ L;  1VQL O;  3CMA O;  3I56 O;  1KC8 P;  1VQK L;  2QEX O;  3CCJ L;  3OW2 N;  1W2B N;  3CCM L;  1VQ5 L;  3CCE O;  1YJW L;  3CPW N;  3CCS L;  1M90 M;  1KQS N;  3CCM O;  1Q7Y P;  3CCU L;  1K8A M;  1QVF N;  1VQO L;  3G71 O;  3CCS O;  1NJI M;  1YJ9 O;  3CCV O;  1JJ2 K;  3G6E O;  1VQ8 L;  2OTJ L;  3CCQ L;  2OTL L;  3G4S O;  3CXC N;  1YIJ O;  1YJN L;  1M90 P;  1VQN L;  1KD1 M;  3OW2 K;  1K8A P;  1VQK O;  3CCJ O;  1VQM L;  1W2B K;  1VQ8 O;  1VQ9 L;  2OTL O;  1VQ5 O;  3CPW K;  1NJI P;  3I55 L;  1YJW O;  3CD6 L;  3CC2 L;  1Q81 M;  1Q86 M;  1VQM O;  1KQS K;  1VQ9 O;  1VQP L;  1K73 M;  1QVG K;  3I55 O;  3CCU O;  3CD6 O;  3CC2 O;  1VQO O;  1YIT L;  3CC4 L;  1VQ7 L;  1KD1 P;  1VQ4 L;  1VQ6 L;  1YHQ L;  1VQP O;  3CC7 L;  3CMA L;  3CCL L;  1M1K M;  1K9M M;  2OTJ O;  3CC4 O;  1S72 L;  3CCQ O;  1VQ7 O;  1Q81 P;  1Q86 P;  3CXC K;  2QEX L;  1YHQ O;  2QA4 L;  1YJN O;  1VQN O;  3CC7 O; 
#chains in the Genus database with same CATH topology
 3CME L;  1N8R M;  1K73 P;  5DS6 A;  3CCE L;  1Q82 M;  3CCL O;  3NKD A;  4WJ0 A;  5DQZ A;  1S72 O;  3CCR L;  2QA4 O;  1QVF K;  3CME O;  1KC8 M;  1M1K P;  1YI2 L;  3G71 L;  1K9M P;  3CCR O;  1VQL L;  4P6I C;  1YJ9 L;  1QVG N;  3I56 L;  1N8R P;  3CCV L;  1YIT O;  1Q82 P;  3G6E L;  4QDL A;  1JJ2 N;  1VQ4 O;  1YI2 O;  1VQ6 O;  3G4S L;  1Q7Y M;  1YIJ L;  1VQL O;  3CMA O;  3GOD A;  3I56 O;  1KC8 P;  1VQK L;  2QEX O;  3CCJ L;  3OW2 N;  1W2B N;  3CCM L;  1VQ5 L;  3CCE O;  1YJW L;  3CPW N;  5DLJ A;  4N06 A;  3CCS L;  1M90 M;  1KQS N;  3CCM O;  4XTK A;  1Q7Y P;  3CCU L;  1K8A M;  1QVF N;  1VQO L;  3G71 O;  3CCS O;  2YZS A;  1NJI M;  1YJ9 O;  3CCV O;  1JJ2 K;  5FCL A;  3G6E O;  1VQ8 L;  2OTJ L;  3CCQ L;  2OTL L;  3G4S O;  3CXC N;  1YIJ O;  1YJN L;  1M90 P;  1VQN L;  5DS4 A;  1KD1 M;  3OW2 K;  1K8A P;  1VQK O;  3CCJ O;  1VQM L;  1W2B K;  5DS5 A;  1VQ8 O;  1VQ9 L;  2OTL O;  1VQ5 O;  3CPW K;  1NJI P;  3I55 L;  1YJW O;  3CD6 L;  3CC2 L;  1Q81 M;  1Q86 M;  1VQM O;  1KQS K;  1VQ9 O;  1VQP L;  1K73 M;  1QVG K;  4W8K A;  3I55 O;  3CCU O;  3CD6 O;  5DQT A;  3CC2 O;  1VQO O;  1YIT L;  3CC4 L;  1VQ7 L;  1KD1 P;  1VQ4 L;  1VQ6 L;  1YHQ L;  1VQP O;  3CC7 L;  3CMA L;  3CCL L;  1M1K M;  1K9M M;  2OTJ O;  3CC4 O;  1S72 L;  3CCQ O;  1VQ7 O;  1Q81 P;  1Q86 P;  3CXC K;  2QEX L;  1YHQ O;  2QA4 L;  1YJN O;  1VQN O;  3CC7 O; 
#chains in the Genus database with same CATH homology
 3CME L;  1N8R M;  1K73 P;  5DS6 A;  3CCE L;  1Q82 M;  3CCL O;  3NKD A;  4WJ0 A;  5DQZ A;  1S72 O;  3CCR L;  2QA4 O;  1QVF K;  3CME O;  1KC8 M;  1M1K P;  1YI2 L;  3G71 L;  1K9M P;  3CCR O;  1VQL L;  4P6I C;  1YJ9 L;  1QVG N;  3I56 L;  1N8R P;  3CCV L;  1YIT O;  1Q82 P;  3G6E L;  4QDL A;  1JJ2 N;  1VQ4 O;  1YI2 O;  1VQ6 O;  3G4S L;  1Q7Y M;  1YIJ L;  1VQL O;  3CMA O;  3GOD A;  3I56 O;  1KC8 P;  1VQK L;  2QEX O;  3CCJ L;  3OW2 N;  1W2B N;  3CCM L;  1VQ5 L;  3CCE O;  1YJW L;  3CPW N;  5DLJ A;  4N06 A;  3CCS L;  1M90 M;  1KQS N;  3CCM O;  4XTK A;  1Q7Y P;  3CCU L;  1K8A M;  1QVF N;  1VQO L;  3G71 O;  3CCS O;  2YZS A;  1NJI M;  1YJ9 O;  3CCV O;  1JJ2 K;  5FCL A;  3G6E O;  1VQ8 L;  2OTJ L;  3CCQ L;  2OTL L;  3G4S O;  3CXC N;  1YIJ O;  1YJN L;  1M90 P;  1VQN L;  5DS4 A;  1KD1 M;  3OW2 K;  1K8A P;  1VQK O;  3CCJ O;  1VQM L;  1W2B K;  5DS5 A;  1VQ8 O;  1VQ9 L;  2OTL O;  1VQ5 O;  3CPW K;  1NJI P;  3I55 L;  1YJW O;  3CD6 L;  3CC2 L;  1Q81 M;  1Q86 M;  1VQM O;  1KQS K;  1VQ9 O;  1VQP L;  1K73 M;  1QVG K;  4W8K A;  3I55 O;  3CCU O;  3CD6 O;  5DQT A;  3CC2 O;  1VQO O;  1YIT L;  3CC4 L;  1VQ7 L;  1KD1 P;  1VQ4 L;  1VQ6 L;  1YHQ L;  1VQP O;  3CC7 L;  3CMA L;  3CCL L;  1M1K M;  1K9M M;  2OTJ O;  3CC4 O;  1S72 L;  3CCQ O;  1VQ7 O;  1Q81 P;  1Q86 P;  3CXC K;  2QEX L;  1YHQ O;  2QA4 L;  1YJN O;  1VQN O;  3CC7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...