3CD6O

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 31
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 3cd6O00
1S72L 1VQ9L 1JJ2N 1Q81P 1QVFN 3G4SL 1VQLO 1Q86M 3CD6L 1VQ4L 3CMEL 1KC8M 1NJIM 1VQKL 1VQ4O 1VQ6O 1JJ2K 1YHQL 1YI2L 1QVFK 1VQ7L 1Q7YP 1K8AM 2OTLL 1YI2O 1M1KP 1YIJL 3CXCN 3CCRO 1VQ7O 1VQPO 3CCMO 3CPWK 2OTLO 1VQLL 2QA4O 1N8RP 1YJNL 3CCLO 1M90P 3CC2L 2QEXO 1VQ6L 3CXCK 2OTJO 1Q81M 1K9MP 3CPWN 1YJNO 1VQNO 1QVGN 3CC2O 3CCQO 3CCRL 3CCSO 1VQPL 3CCML 1VQ8L 3CC4O 3CCJO 2QA4L 1Q82P 1VQOO 3OW2N 1Q7YM 1YITL 1VQ8O 1QVGK 1M1KM 3CCLL 1VQMO 2QEXL 3CCEO 1YJWO 3G6EO 3G71O 1YITO 2OTJL 1KD1P 1K73P 1KQSK 3CCUO 1VQNL 3CCQL 3CC7L 3OW2K 1N8RM 1YJ9L 3I55L 3CCSL 1M90M 3CC4L 3CC7O 3CCJL 1YJ9O 3I55O 3I56O 1VQOL 1K9MM 1KQSN 1W2BN 1Q86P 1VQ5O 1VQML 1YJWL 3CCEL 3G6EL 3G71L 1KC8P 1NJIP 1S72O 1VQ9O 3CCUL 3G4SO 1Q82M 1K8AP 1W2BK 3CD6O 3CMEO 3CMAL 3I56L 1KD1M 3CCVL 1K73M 1VQKO 1YHQO 3CMAO 1VQ5L 3CCVO 1YIJO
chains in the Genus database with same CATH superfamily
1S72L 1VQ9L 1JJ2N 1Q81P 1QVFN 3G4SL 1VQLO 1Q86M 3CD6L 1VQ4L 3CMEL 1KC8M 1NJIM 1VQKL 1VQ4O 1VQ6O 1JJ2K 1YHQL 1YI2L 1QVFK 1VQ7L 1Q7YP 1K8AM 2OTLL 1YI2O 1M1KP 1YIJL 5DQTA 3CXCN 3CCRO 1VQ7O 1VQPO 3CCMO 3CPWK 2OTLO 1VQLL 4P6IC 5FCLA 2QA4O 1N8RP 1YJNL 3CCLO 1M90P 3CC2L 2QEXO 1VQ6L 3CXCK 2OTJO 1Q81M 1K9MP 3CPWN 1YJNO 1VQNO 3GODA 1QVGN 3CC2O 3CCQO 4XTKA 4WJ0A 5DS6A 3CCRL 3CCSO 1VQPL 3CCML 5DS5A 1VQ8L 3CC4O 3CCJO 2QA4L 4N06A 1VQOO 1Q82P 3OW2N 1Q7YM 1YITL 1VQ8O 1QVGK 3NKDA 1M1KM 3CCLL 1VQMO 2QEXL 3CCEO 1YJWO 3G6EO 4QDLA 3G71O 1YITO 2OTJL 1KD1P 1K73P 1KQSK 3CCUO 1VQNL 2YZSA 5DLJA 3CCQL 5DQZA 3CC7L 3OW2K 1N8RM 1YJ9L 3I55L 3CCSL 1M90M 3CC4L 3CC7O 3CCJL 1YJ9O 3I55O 3I56O 1VQOL 1K9MM 1KQSN 1W2BN 1Q86P 5DS4A 1VQ5O 1VQML 1YJWL 3CCEL 3G6EL 3G71L 1KC8P 1NJIP 1S72O 1VQ9O 3CCUL 3G4SO 4W8KA 1Q82M 1K8AP 1W2BK 3CD6O 3CMEO 3CMAL 3I56L 1KD1M 3CCVL 1K73M 1VQKO 1YHQO 3CMAO 1VQ5L 3CCVO 1YIJO
chains in the Genus database with same CATH topology
1S72L 1VQ9L 1JJ2N 1Q81P 1QVFN 3G4SL 1VQLO 1Q86M 3CD6L 1VQ4L 3CMEL 1KC8M 1NJIM 1VQKL 1VQ4O 1VQ6O 1JJ2K 1YHQL 1YI2L 1QVFK 1VQ7L 1Q7YP 1K8AM 2OTLL 1YI2O 1M1KP 1YIJL 5DQTA 3CXCN 3CCRO 1VQ7O 1VQPO 3CCMO 3CPWK 2OTLO 1VQLL 4P6IC 5FCLA 2QA4O 1N8RP 1YJNL 3CCLO 1M90P 3CC2L 2QEXO 1VQ6L 3CXCK 2OTJO 1Q81M 1K9MP 3CPWN 1YJNO 1VQNO 3GODA 1QVGN 3CC2O 3CCQO 4XTKA 4WJ0A 5DS6A 3CCRL 3CCSO 1VQPL 3CCML 5DS5A 1VQ8L 3CC4O 3CCJO 2QA4L 4N06A 1VQOO 1Q82P 3OW2N 1Q7YM 1YITL 1VQ8O 1QVGK 3NKDA 1M1KM 3CCLL 1VQMO 2QEXL 3CCEO 1YJWO 3G6EO 4QDLA 3G71O 1YITO 2OTJL 1KD1P 1K73P 1KQSK 3CCUO 1VQNL 2YZSA 5DLJA 3CCQL 5DQZA 3CC7L 3OW2K 1N8RM 1YJ9L 3I55L 3CCSL 1M90M 3CC4L 3CC7O 3CCJL 1YJ9O 3I55O 3I56O 1VQOL 1K9MM 1KQSN 1W2BN 1Q86P 5DS4A 1VQ5O 1VQML 1YJWL 3CCEL 3G6EL 3G71L 1KC8P 1NJIP 1S72O 1VQ9O 3CCUL 3G4SO 4W8KA 1Q82M 1K8AP 1W2BK 3CD6O 3CMEO 3CMAL 3I56L 1KD1M 3CCVL 1K73M 1VQKO 1YHQO 3CMAO 1VQ5L 3CCVO 1YIJO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 L;  1VQ9 L;  1JJ2 N;  1Q81 P;  1QVF N;  3G4S L;  1VQL O;  1Q86 M;  3CD6 L;  1VQ4 L;  3CME L;  1KC8 M;  1NJI M;  1VQK L;  1VQ4 O;  1VQ6 O;  1JJ2 K;  1YHQ L;  1YI2 L;  1QVF K;  1VQ7 L;  1Q7Y P;  1K8A M;  2OTL L;  1YI2 O;  1M1K P;  1YIJ L;  3CXC N;  3CCR O;  1VQ7 O;  1VQP O;  3CCM O;  3CPW K;  2OTL O;  1VQL L;  2QA4 O;  1N8R P;  1YJN L;  3CCL O;  1M90 P;  3CC2 L;  2QEX O;  1VQ6 L;  3CXC K;  2OTJ O;  1Q81 M;  1K9M P;  3CPW N;  1YJN O;  1VQN O;  1QVG N;  3CC2 O;  3CCQ O;  3CCR L;  3CCS O;  1VQP L;  3CCM L;  1VQ8 L;  3CC4 O;  3CCJ O;  2QA4 L;  1Q82 P;  1VQO O;  3OW2 N;  1Q7Y M;  1YIT L;  1VQ8 O;  1QVG K;  1M1K M;  3CCL L;  1VQM O;  2QEX L;  3CCE O;  1YJW O;  3G6E O;  3G71 O;  1YIT O;  2OTJ L;  1KD1 P;  1K73 P;  1KQS K;  3CCU O;  1VQN L;  3CCQ L;  3CC7 L;  3OW2 K;  1N8R M;  1YJ9 L;  3I55 L;  3CCS L;  1M90 M;  3CC4 L;  3CC7 O;  3CCJ L;  1YJ9 O;  3I55 O;  3I56 O;  1VQO L;  1K9M M;  1KQS N;  1W2B N;  1Q86 P;  1VQ5 O;  1VQM L;  1YJW L;  3CCE L;  3G6E L;  3G71 L;  1KC8 P;  1NJI P;  1S72 O;  1VQ9 O;  3CCU L;  3G4S O;  1Q82 M;  1K8A P;  1W2B K;  3CD6 O;  3CME O;  3CMA L;  3I56 L;  1KD1 M;  3CCV L;  1K73 M;  1VQK O;  1YHQ O;  3CMA O;  1VQ5 L;  3CCV O;  1YIJ O; 
#chains in the Genus database with same CATH topology
 1S72 L;  1VQ9 L;  1JJ2 N;  1Q81 P;  1QVF N;  3G4S L;  1VQL O;  1Q86 M;  3CD6 L;  1VQ4 L;  3CME L;  1KC8 M;  1NJI M;  1VQK L;  1VQ4 O;  1VQ6 O;  1JJ2 K;  1YHQ L;  1YI2 L;  1QVF K;  1VQ7 L;  1Q7Y P;  1K8A M;  2OTL L;  1YI2 O;  1M1K P;  1YIJ L;  5DQT A;  3CXC N;  3CCR O;  1VQ7 O;  1VQP O;  3CCM O;  3CPW K;  2OTL O;  1VQL L;  4P6I C;  5FCL A;  2QA4 O;  1N8R P;  1YJN L;  3CCL O;  1M90 P;  3CC2 L;  2QEX O;  1VQ6 L;  3CXC K;  2OTJ O;  1Q81 M;  1K9M P;  3CPW N;  1YJN O;  1VQN O;  3GOD A;  1QVG N;  3CC2 O;  3CCQ O;  4XTK A;  4WJ0 A;  5DS6 A;  3CCR L;  3CCS O;  1VQP L;  3CCM L;  5DS5 A;  1VQ8 L;  3CC4 O;  3CCJ O;  2QA4 L;  4N06 A;  1VQO O;  1Q82 P;  3OW2 N;  1Q7Y M;  1YIT L;  1VQ8 O;  1QVG K;  3NKD A;  1M1K M;  3CCL L;  1VQM O;  2QEX L;  3CCE O;  1YJW O;  3G6E O;  4QDL A;  3G71 O;  1YIT O;  2OTJ L;  1KD1 P;  1K73 P;  1KQS K;  3CCU O;  1VQN L;  2YZS A;  5DLJ A;  3CCQ L;  5DQZ A;  3CC7 L;  3OW2 K;  1N8R M;  1YJ9 L;  3I55 L;  3CCS L;  1M90 M;  3CC4 L;  3CC7 O;  3CCJ L;  1YJ9 O;  3I55 O;  3I56 O;  1VQO L;  1K9M M;  1KQS N;  1W2B N;  1Q86 P;  5DS4 A;  1VQ5 O;  1VQM L;  1YJW L;  3CCE L;  3G6E L;  3G71 L;  1KC8 P;  1NJI P;  1S72 O;  1VQ9 O;  3CCU L;  3G4S O;  4W8K A;  1Q82 M;  1K8A P;  1W2B K;  3CD6 O;  3CME O;  3CMA L;  3I56 L;  1KD1 M;  3CCV L;  1K73 M;  1VQK O;  1YHQ O;  3CMA O;  1VQ5 L;  3CCV O;  1YIJ O; 
#chains in the Genus database with same CATH homology
 1S72 L;  1VQ9 L;  1JJ2 N;  1Q81 P;  1QVF N;  3G4S L;  1VQL O;  1Q86 M;  3CD6 L;  1VQ4 L;  3CME L;  1KC8 M;  1NJI M;  1VQK L;  1VQ4 O;  1VQ6 O;  1JJ2 K;  1YHQ L;  1YI2 L;  1QVF K;  1VQ7 L;  1Q7Y P;  1K8A M;  2OTL L;  1YI2 O;  1M1K P;  1YIJ L;  5DQT A;  3CXC N;  3CCR O;  1VQ7 O;  1VQP O;  3CCM O;  3CPW K;  2OTL O;  1VQL L;  4P6I C;  5FCL A;  2QA4 O;  1N8R P;  1YJN L;  3CCL O;  1M90 P;  3CC2 L;  2QEX O;  1VQ6 L;  3CXC K;  2OTJ O;  1Q81 M;  1K9M P;  3CPW N;  1YJN O;  1VQN O;  3GOD A;  1QVG N;  3CC2 O;  3CCQ O;  4XTK A;  4WJ0 A;  5DS6 A;  3CCR L;  3CCS O;  1VQP L;  3CCM L;  5DS5 A;  1VQ8 L;  3CC4 O;  3CCJ O;  2QA4 L;  4N06 A;  1VQO O;  1Q82 P;  3OW2 N;  1Q7Y M;  1YIT L;  1VQ8 O;  1QVG K;  3NKD A;  1M1K M;  3CCL L;  1VQM O;  2QEX L;  3CCE O;  1YJW O;  3G6E O;  4QDL A;  3G71 O;  1YIT O;  2OTJ L;  1KD1 P;  1K73 P;  1KQS K;  3CCU O;  1VQN L;  2YZS A;  5DLJ A;  3CCQ L;  5DQZ A;  3CC7 L;  3OW2 K;  1N8R M;  1YJ9 L;  3I55 L;  3CCS L;  1M90 M;  3CC4 L;  3CC7 O;  3CCJ L;  1YJ9 O;  3I55 O;  3I56 O;  1VQO L;  1K9M M;  1KQS N;  1W2B N;  1Q86 P;  5DS4 A;  1VQ5 O;  1VQM L;  1YJW L;  3CCE L;  3G6E L;  3G71 L;  1KC8 P;  1NJI P;  1S72 O;  1VQ9 O;  3CCU L;  3G4S O;  4W8K A;  1Q82 M;  1K8A P;  1W2B K;  3CD6 O;  3CME O;  3CMA L;  3I56 L;  1KD1 M;  3CCV L;  1K73 M;  1VQK O;  1YHQ O;  3CMA O;  1VQ5 L;  3CCV O;  1YIJ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...