3CD6Z

Co-cystal of large ribosomal subunit mutant g2616a with cc-puromycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cd6Z00
1VQL1 1Q821 1KC82 1YIJZ 1Q7Y1 3CCE1 1YI2Z 3CC7Z 3CCQZ 3CPWZ 3CD61 1K732 1VQ8Z 1VQN1 3CCR1 1KD12 3CC2Z 2OTJ1 2OTLZ 1VQ71 3CC4Z 3G6EZ 3CPWY 1YJWZ 1K731 1N8R2 1YJN1 1W2BZ 1QVGZ 1K8A1 3CC71 1YI21 3CCL1 3CCEZ 1K9M1 1M1K2 3CD6Z 3CCM1 1VQPZ 1QVFZ 1KC81 1S721 1Q7Y2 1M902 1YJ9Z 3CME1 2QA4Z 3G711 3I551 1VQO1 1K8A2 1VQ41 1Q812 2OTJZ 3CCU1 1YIT1 1VQKZ 1VQ61 3I56Z 1VQ81 2QEX1 1KD11 1VQNZ 1VQ7Z 3OW2Z 1W2BY 1QVGY 1VQ51 1JJ2Y 3CCV1 1QVFY 1YJW1 3I55Z 3G71Z 1K9M2 1M1K1 1VQP1 3CMAZ 3G4SZ 1S72Z 3CC41 1Q862 1NJI1 3CCS1 1JJ2Z 3CCJZ 1VQ91 1YJNZ 3CXCY 3CCUZ 1YHQZ 1KQSY 1YITZ 1VQK1 1Q822 1VQ6Z 2QEXZ 1N8R1 3I561 1NJI2 3CCSZ 1VQM1 1VQLZ 3CMEZ 3G4S1 3CCQ1 1VQOZ 3CMA1 1Q811 1KQSZ 1VQ5Z 1YIJ1 3CCVZ 3CCLZ 1Q861 3CCMZ 1M901 3G6E1 3CXCZ 1VQMZ 3CCRZ 3CC21 3CCJ1 1VQ9Z 1VQ4Z 2OTL1 1YHQ1 3OW2Y 1YJ91 2QA41
chains in the Genus database with same CATH superfamily
4A3LI 2BJOA 1YIJZ 1Q7Y1 3MZLB 4A3GI 2VPYA 3D6WA 4A3BI 1FDOA 3FQQA 4NB9A 2OZKA 1K732 3GTOI 1VQN1 3H0GI 2JR6A 2JA7I 1LQLA 2IV2X 3IX0A 5IT9b 3G6EZ 2B63I 2PMZA 1K731 2R93I 2O4HA 4HGZA 1YI21 3CD6Z 3J80f 2W03A 2DE5A 5C4XI 1YJ9Z 2RT9A 2NVYI 3G711 3BG1B 4MH4A 3HOZI 4E33A 3J81b 1ZH1A 2QRCB 1VQ61 3ESWA 1WZNA 2ZAEB 4NBFA 3S1QI 3EEDA 1VQNZ 3JAMf 4E2YA 2Q4ZA 1VQ7Z 3QWUA 5IP9I 4CL1A 1W2BY 2YU9I 1TWHI 1YJW1 5C4JI 3I55Z 3G71Z 3S1NI 1S72Z 3CCS1 3H3VJ 2NVXI 1YJNZ 2JIOA 1RO4A 2VPZA 4MD9A 4BBRI 1VQ6Z 2QEXZ 1WW9A 2GU2A 2JA5I 2E2HI 4RVDA 1R9TI 1USPA 2I3CA 2E9HA 2JIRA 2R92I 3CCVZ 4NBDA 1Q861 3J7A4 3TDHB 1M901 1ZB8A 5C44I 2WAQA 4DQYB 3IR7A 3GTJI 1YUAA 3CCJ1 1RO2A 3LUSA 1SFOI 1Z02A 2OTL1 1DL6A 2P3YA 1TWFI 2QA41 1Y1VI 1VQL1 3S2DI 1L1OC 4A3MI 3IF8A 1YI2Z 2V8IA 1TFIA 2GTIA 2JA8I 2VUMI 1VQ8Z 2VPXA 4MONA 4NBHA 1KD12 3CC2Z 4NBCA 2OTJ1 2OTLZ 1VQ71 3I4NI 2QKDA 2QRDB 5IP7I 3CCEZ 3PO3I 3CCM1 1VQPZ 1QVFZ 1KC81 3S1MI 4A3KI 2E2JI 1NUIA 2OOXB 2Y0SA 3NH4A 5FLMI 3I551 1VQ41 2JIMA 5T67A 2OTJZ 1YIT1 2V8JA 1VQKZ 2E2II 3EERA 1VQ81 4RS4A 1I3QI 5D1PA 4MD7A 1Y1WI 3OW2Z 5T6BA 1Q16A 1QVGY 1P9NA 4RVHA 3T4NB 1K9M2 1M1K1 3RZOI 5D1OA 4A3FI 3CC41 1Q862 2QR1B 1WJ2A 1ZB9A 2G2KA 4E2XA 2H85A 3CCUZ 5A2Qb 4QTUA 1Q822 1AA6A 3CMEZ 2F4MA 4S1TA 1Z03A 4BBSI 3I07A 4DK1A 2JA6I 1QXFA 2VF1A 3CCMZ 3GKQA 3NH8A 3NDIA 3M4OI 1S7MA 4A3II 4MXUA 1RNIA 3J81f 1USPB 3VTNA 1NP6A 2HF1A 2JNYA 1VQ9Z 3GTQI 4QTTA 1YJ91 2JIPA 1KC82 4NFRA 3F3FC 3CCQZ 3CPWZ 2JS4A 4Y52I 3P5JB 4NBEA 3S15I 2K5RA 2PM9A 3F3PC 3CC4Z 2K3RA 3HOXI 2EGTA 1VLAA 1YJWZ 2RIQA 1N8R2 1W2BZ 1K8A1 3CC71 2LIYA 3CCL1 2Q51A 2JIQA 2GTHA 4A3JI 3BG0B 1S721 1QF8A 1M902 3NFZA 2JMOA 3CME1 2R6MA 3FQMA 3NH5A 1K83I 2J6AA 1Q812 2AYDA 2QEX1 4XX2A 3GTMS 4A3DI 2OOYB 3S17I 3S1RI 1ML8A 1WCMI 1VQ51 1JJ2Y 3HOYI 3CCV1 3GTMI 1RO0A 5LL6f 4MRIA 4E2ZA 3GTPI 4NH1C 4E32A 2IZ3A 4X6AI 2V8KA 1VQ91 4RV9A 2LEXA 1YHQZ 1I6HI 1KQSY 1YITZ 5D1OB 1VQK1 1N8R1 3I561 3CCSZ 4NBAA 1VQLZ 3HOVI 2RPRA 3G4S1 2QLVB 3CCQ1 1VQOZ 1QYPA 3JAMb 2NAPA 1VQ5Z 4Y7NI 1N2FA 2RHBA 3CCLZ 2IZ4A 2HU9A 3MZKB 1X3WA 3CXCZ 4RVGA 1VQMZ 3CCRZ 3CC21 2DE6A 1I50I 5IT9f 2AKLA 4TNUA 1YHQ1 1RQFA 2P28A 3GCFA 3OW2Y 3GTKI 1Q821 5FLXf 3CCE1 1TWAI 5AN9F 3CC7Z 2JUBA 2RBLA 2O53A 3CD61 4A93I 3HOWI 2KPIA 3Q87A 5CM2M 4HGYA 3CCR1 4HH4A 3RZDI 4NOZA 3PO3S 4DGLA 3CPWY 4NB8A 4BY1I 2YADA 1YJN1 3PO2I 3KIHA 1QVGZ 1X0TA 4E2WA 5A2Qf 1K9M1 4AYBA 1M1K2 1SIWA 3TE5B 2V3VA 1Q7Y2 4EWCA 2E7ZA 3S16I 2QA4Z 3S2HI 1VQO1 1K8A2 3CCU1 1RLYA 3I56Z 1X3ZA 1KD11 2M48A 3U50C 4E31A 1TWCI 3GTGI 2V45A 3IFUA 5FLXb 4RVFA 3VMGA 3K7AI 1QVFY 4NBGA 2DE7A 3VMHA 1VQP1 3CMAZ 3G4SZ 3MONA 1NJI1 1PFTA 1Y8CA 2M6NA 1JJ2Z 3CCJZ 3HKZA 2W04A 3NDJA 3I4MI 4NBBA 2R7ZI 3CXCY 2VPWA 3VB9A 1WIIA 1NJI2 2KI7B 5T64A 3KIFA 1VQM1 1Z01A 3HOUI 4A3EI 3VMIA 3CQZI 3GTLI 5C3EI 3CMA1 2LFUA 3J80b 3D2LA 4BXXI 2VUGA 3D9XA 1Q811 2WB1A 2PK7A 1KQSZ 1YIJ1 2NVTI 4BY7I 1Y1VS 1KRLA 2QREB 1YUKA 1TWGI 4MD8A 3S14I 3G6E1 3FKII 4A3CI 4E30A 1VQ4Z 2NVQI 1FDIA 1JWHC 3M3YI 2F4OA
chains in the Genus database with same CATH topology
4A3LI 2BJOA 1YIJZ 1Q7Y1 3MZLB 4A3GI 4A3BI 3D6WA 3FQQA 4NB9A 2OZKA 1K732 3GTOI 1VQN1 3H0GI 2JR6A 2JA7I 1LQLA 3IX0A 5IT9b 3G6EZ 2B63I 2PMZA 1K731 2R93I 2O4HA 4HGZA 1YI21 3CD6Z 3J80f 2W03A 2DE5A 5C4XI 1YJ9Z 2RT9A 2NVYI 3G711 3BG1B 4MH4A 3HOZI 4E33A 3J81b 1ZH1A 2QRCB 1VQ61 3ESWA 2ZAEB 4NBFA 3S1QI 3EEDA 1VQNZ 3JAMf 4E2YA 2Q4ZA 1VQ7Z 3QWUA 5IP9I 4CL1A 1W2BY 2YU9I 1TWHI 1YJW1 5C4JI 3I55Z 3G71Z 3S1NI 1S72Z 3CCS1 3H3VJ 2NVXI 1YJNZ 1RO4A 4MD9A 4BBRI 1VQ6Z 2QEXZ 1WW9A 2GU2A 2JA5I 2E2HI 4RVDA 1R9TI 1USPA 2I3CA 2E9HA 2R92I 3CCVZ 4NBDA 1Q861 3J7A4 3TDHB 1M901 1ZB8A 5C44I 2WAQA 4DQYB 3GTJI 1YUAA 3CCJ1 1RO2A 3LUSA 1SFOI 1Z02A 2OTL1 1DL6A 2P3YA 1TWFI 2QA41 1Y1VI 1VQL1 3S2DI 1L1OC 4A3MI 3IF8A 1YI2Z 2V8IA 1TFIA 2GTIA 2JA8I 2VUMI 1VQ8Z 4MONA 4NBHA 1KD12 3CC2Z 4NBCA 2OTJ1 2OTLZ 1VQ71 3I4NI 2QKDA 2QRDB 5IP7I 3CCEZ 3PO3I 3CCM1 1VQPZ 1QVFZ 1KC81 3S1MI 4A3KI 2E2JI 1NUIA 2OOXB 2Y0SA 3NH4A 5FLMI 3I551 1VQ41 2OTJZ 5T67A 1YIT1 2V8JA 1VQKZ 2E2II 3EERA 1VQ81 4RS4A 1I3QI 5D1PA 4MD7A 1Y1WI 3OW2Z 5T6BA 1QVGY 1P9NA 4RVHA 3T4NB 1K9M2 1M1K1 3RZOI 5D1OA 4A3FI 3CC41 1Q862 2QR1B 1ZB9A 2G2KA 4E2XA 2H85A 3CCUZ 5A2Qb 4QTUA 1Q822 3CMEZ 2F4MA 4S1TA 1Z03A 4BBSI 3I07A 4DK1A 2JA6I 2VF1A 3CCMZ 3GKQA 3NH8A 3NDIA 3M4OI 1S7MA 4A3II 4MXUA 1RNIA 3J81f 1USPB 3VTNA 1NP6A 2HF1A 2JNYA 1VQ9Z 3GTQI 4QTTA 1YJ91 1KC82 4NFRA 3F3FC 3CCQZ 3CPWZ 2JS4A 4Y52I 3P5JB 4NBEA 3S15I 2K5RA 2PM9A 3F3PC 3CC4Z 2K3RA 3HOXI 2EGTA 1VLAA 1YJWZ 2RIQA 1N8R2 1W2BZ 1K8A1 3CC71 2LIYA 3CCL1 2Q51A 2GTHA 4A3JI 3BG0B 1S721 1QF8A 1M902 3NFZA 2JMOA 3CME1 2R6MA 3FQMA 3NH5A 1K83I 2J6AA 1Q812 2QEX1 4XX2A 3GTMS 4A3DI 2OOYB 3S17I 3S1RI 1ML8A 1WCMI 1VQ51 1JJ2Y 3HOYI 3CCV1 3GTMI 1RO0A 5LL6f 4MRIA 4E2ZA 3GTPI 4NH1C 4E32A 2IZ3A 4X6AI 2V8KA 1VQ91 4RV9A 1YHQZ 1I6HI 1KQSY 1YITZ 5D1OB 1VQK1 1N8R1 3I561 3CCSZ 4NBAA 1VQLZ 3HOVI 2RPRA 3G4S1 2QLVB 3CCQ1 1VQOZ 1QYPA 3JAMb 1VQ5Z 4Y7NI 1N2FA 2RHBA 3CCLZ 2IZ4A 2HU9A 3MZKB 1X3WA 3CXCZ 4RVGA 1VQMZ 3CCRZ 3CC21 2DE6A 1I50I 5IT9f 2AKLA 4TNUA 1YHQ1 1RQFA 2P28A 3GCFA 3OW2Y 3GTKI 1Q821 5FLXf 3CCE1 1TWAI 5AN9F 3CC7Z 2JUBA 2RBLA 2O53A 3CD61 4A93I 3HOWI 2KPIA 3Q87A 5CM2M 4HGYA 3CCR1 4HH4A 3RZDI 4NOZA 3PO3S 4DGLA 3CPWY 4NB8A 4BY1I 2YADA 1YJN1 3PO2I 3KIHA 1QVGZ 1X0TA 4E2WA 5A2Qf 1K9M1 4AYBA 1M1K2 3TE5B 1Q7Y2 4EWCA 3S16I 2QA4Z 3S2HI 1VQO1 1K8A2 3CCU1 1RLYA 3I56Z 1X3ZA 1KD11 2M48A 3U50C 4E31A 1TWCI 3GTGI 3IFUA 5FLXb 4RVFA 3VMGA 3K7AI 1QVFY 4NBGA 2DE7A 3VMHA 1VQP1 3CMAZ 3G4SZ 3MONA 1NJI1 1PFTA 2M6NA 1JJ2Z 3CCJZ 3HKZA 2W04A 3NDJA 3I4MI 4NBBA 2R7ZI 3CXCY 3VB9A 1WIIA 1NJI2 2KI7B 5T64A 3KIFA 1VQM1 1Z01A 3HOUI 4A3EI 3VMIA 3CQZI 3GTLI 5C3EI 3CMA1 2LFUA 3J80b 4BXXI 2VUGA 3D9XA 1Q811 2WB1A 2PK7A 1KQSZ 1YIJ1 2NVTI 4BY7I 1Y1VS 1KRLA 2QREB 1YUKA 1TWGI 4MD8A 3S14I 3G6E1 3FKII 4A3CI 4E30A 1VQ4Z 2NVQI 1JWHC 3M3YI 2F4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL 1;  1Q82 1;  1KC8 2;  1YIJ Z;  1Q7Y 1;  3CCE 1;  1YI2 Z;  3CC7 Z;  3CCQ Z;  3CPW Z;  3CD6 1;  1K73 2;  1VQ8 Z;  1VQN 1;  3CCR 1;  1KD1 2;  3CC2 Z;  2OTJ 1;  2OTL Z;  1VQ7 1;  3CC4 Z;  3G6E Z;  3CPW Y;  1YJW Z;  1K73 1;  1N8R 2;  1YJN 1;  1W2B Z;  1QVG Z;  1K8A 1;  3CC7 1;  1YI2 1;  3CCL 1;  3CCE Z;  1K9M 1;  1M1K 2;  3CD6 Z;  3CCM 1;  1VQP Z;  1QVF Z;  1KC8 1;  1S72 1;  1Q7Y 2;  1M90 2;  1YJ9 Z;  3CME 1;  2QA4 Z;  3G71 1;  3I55 1;  1VQO 1;  1K8A 2;  1VQ4 1;  1Q81 2;  2OTJ Z;  3CCU 1;  1YIT 1;  1VQK Z;  1VQ6 1;  3I56 Z;  1VQ8 1;  2QEX 1;  1KD1 1;  1VQN Z;  1VQ7 Z;  3OW2 Z;  1W2B Y;  1QVG Y;  1VQ5 1;  1JJ2 Y;  3CCV 1;  1QVF Y;  1YJW 1;  3I55 Z;  3G71 Z;  1K9M 2;  1M1K 1;  1VQP 1;  3CMA Z;  3G4S Z;  1S72 Z;  3CC4 1;  1Q86 2;  1NJI 1;  3CCS 1;  1JJ2 Z;  3CCJ Z;  1VQ9 1;  1YJN Z;  3CXC Y;  3CCU Z;  1YHQ Z;  1KQS Y;  1YIT Z;  1VQK 1;  1Q82 2;  1VQ6 Z;  2QEX Z;  1N8R 1;  3I56 1;  1NJI 2;  3CCS Z;  1VQM 1;  1VQL Z;  3CME Z;  3G4S 1;  3CCQ 1;  1VQO Z;  3CMA 1;  1Q81 1;  1KQS Z;  1VQ5 Z;  1YIJ 1;  3CCV Z;  3CCL Z;  1Q86 1;  3CCM Z;  1M90 1;  3G6E 1;  3CXC Z;  1VQM Z;  3CCR Z;  3CC2 1;  3CCJ 1;  1VQ9 Z;  1VQ4 Z;  2OTL 1;  1YHQ 1;  3OW2 Y;  1YJ9 1;  2QA4 1; 
#chains in the Genus database with same CATH topology
 4A3L I;  2BJO A;  1YIJ Z;  1Q7Y 1;  3MZL B;  4A3G I;  2VPY A;  3D6W A;  4A3B I;  1FDO A;  3FQQ A;  4NB9 A;  2OZK A;  1K73 2;  3GTO I;  1VQN 1;  3H0G I;  2JR6 A;  2JA7 I;  1LQL A;  2IV2 X;  3IX0 A;  5IT9 b;  3G6E Z;  2B63 I;  2PMZ A;  1K73 1;  2R93 I;  2O4H A;  4HGZ A;  1YI2 1;  3CD6 Z;  3J80 f;  2W03 A;  2DE5 A;  5C4X I;  1YJ9 Z;  2RT9 A;  2NVY I;  3G71 1;  3BG1 B;  4MH4 A;  3HOZ I;  4E33 A;  3J81 b;  1ZH1 A;  2QRC B;  1VQ6 1;  3ESW A;  1WZN A;  2ZAE B;  4NBF A;  3S1Q I;  3EED A;  1VQN Z;  3JAM f;  4E2Y A;  2Q4Z A;  1VQ7 Z;  3QWU A;  5IP9 I;  4CL1 A;  1W2B Y;  2YU9 I;  1TWH I;  1YJW 1;  5C4J I;  3I55 Z;  3G71 Z;  3S1N I;  1S72 Z;  3CCS 1;  3H3V J;  2NVX I;  1YJN Z;  2JIO A;  1RO4 A;  2VPZ A;  4MD9 A;  4BBR I;  1VQ6 Z;  2QEX Z;  1WW9 A;  2GU2 A;  2JA5 I;  2E2H I;  4RVD A;  1R9T I;  1USP A;  2I3C A;  2E9H A;  2JIR A;  2R92 I;  3CCV Z;  4NBD A;  1Q86 1;  3J7A 4;  3TDH B;  1M90 1;  1ZB8 A;  5C44 I;  2WAQ A;  4DQY B;  3IR7 A;  3GTJ I;  1YUA A;  3CCJ 1;  1RO2 A;  3LUS A;  1SFO I;  1Z02 A;  2OTL 1;  1DL6 A;  2P3Y A;  1TWF I;  2QA4 1;  1Y1V I;  1VQL 1;  3S2D I;  1L1O C;  4A3M I;  3IF8 A;  1YI2 Z;  2V8I A;  1TFI A;  2GTI A;  2JA8 I;  2VUM I;  1VQ8 Z;  2VPX A;  4MON A;  4NBH A;  1KD1 2;  3CC2 Z;  4NBC A;  2OTJ 1;  2OTL Z;  1VQ7 1;  3I4N I;  2QKD A;  2QRD B;  5IP7 I;  3CCE Z;  3PO3 I;  3CCM 1;  1VQP Z;  1QVF Z;  1KC8 1;  3S1M I;  4A3K I;  2E2J I;  1NUI A;  2OOX B;  2Y0S A;  3NH4 A;  5FLM I;  3I55 1;  1VQ4 1;  2JIM A;  5T67 A;  2OTJ Z;  1YIT 1;  2V8J A;  1VQK Z;  2E2I I;  3EER A;  1VQ8 1;  4RS4 A;  1I3Q I;  5D1P A;  4MD7 A;  1Y1W I;  3OW2 Z;  5T6B A;  1Q16 A;  1QVG Y;  1P9N A;  4RVH A;  3T4N B;  1K9M 2;  1M1K 1;  3RZO I;  5D1O A;  4A3F I;  3CC4 1;  1Q86 2;  2QR1 B;  1WJ2 A;  1ZB9 A;  2G2K A;  4E2X A;  2H85 A;  3CCU Z;  5A2Q b;  4QTU A;  1Q82 2;  1AA6 A;  3CME Z;  2F4M A;  4S1T A;  1Z03 A;  4BBS I;  3I07 A;  4DK1 A;  2JA6 I;  1QXF A;  2VF1 A;  3CCM Z;  3GKQ A;  3NH8 A;  3NDI A;  3M4O I;  1S7M A;  4A3I I;  4MXU A;  1RNI A;  3J81 f;  1USP B;  3VTN A;  1NP6 A;  2HF1 A;  2JNY A;  1VQ9 Z;  3GTQ I;  4QTT A;  1YJ9 1;  2JIP A;  1KC8 2;  4NFR A;  3F3F C;  3CCQ Z;  3CPW Z;  2JS4 A;  4Y52 I;  3P5J B;  4NBE A;  3S15 I;  2K5R A;  2PM9 A;  3F3P C;  3CC4 Z;  2K3R A;  3HOX I;  2EGT A;  1VLA A;  1YJW Z;  2RIQ A;  1N8R 2;  1W2B Z;  1K8A 1;  3CC7 1;  2LIY A;  3CCL 1;  2Q51 A;  2JIQ A;  2GTH A;  4A3J I;  3BG0 B;  1S72 1;  1QF8 A;  1M90 2;  3NFZ A;  2JMO A;  3CME 1;  2R6M A;  3FQM A;  3NH5 A;  1K83 I;  2J6A A;  1Q81 2;  2AYD A;  2QEX 1;  4XX2 A;  3GTM S;  4A3D I;  2OOY B;  3S17 I;  3S1R I;  1ML8 A;  1WCM I;  1VQ5 1;  1JJ2 Y;  3HOY I;  3CCV 1;  3GTM I;  1RO0 A;  5LL6 f;  4MRI A;  4E2Z A;  3GTP I;  4NH1 C;  4E32 A;  2IZ3 A;  4X6A I;  2V8K A;  1VQ9 1;  4RV9 A;  2LEX A;  1YHQ Z;  1I6H I;  1KQS Y;  1YIT Z;  5D1O B;  1VQK 1;  1N8R 1;  3I56 1;  3CCS Z;  4NBA A;  1VQL Z;  3HOV I;  2RPR A;  3G4S 1;  2QLV B;  3CCQ 1;  1VQO Z;  1QYP A;  3JAM b;  2NAP A;  1VQ5 Z;  4Y7N I;  1N2F A;  2RHB A;  3CCL Z;  2IZ4 A;  2HU9 A;  3MZK B;  1X3W A;  3CXC Z;  4RVG A;  1VQM Z;  3CCR Z;  3CC2 1;  2DE6 A;  1I50 I;  5IT9 f;  2AKL A;  4TNU A;  1YHQ 1;  1RQF A;  2P28 A;  3GCF A;  3OW2 Y;  3GTK I;  1Q82 1;  5FLX f;  3CCE 1;  1TWA I;  5AN9 F;  3CC7 Z;  2JUB A;  2RBL A;  2O53 A;  3CD6 1;  4A93 I;  3HOW I;  2KPI A;  3Q87 A;  5CM2 M;  4HGY A;  3CCR 1;  4HH4 A;  3RZD I;  4NOZ A;  3PO3 S;  4DGL A;  3CPW Y;  4NB8 A;  4BY1 I;  2YAD A;  1YJN 1;  3PO2 I;  3KIH A;  1QVG Z;  1X0T A;  4E2W A;  5A2Q f;  1K9M 1;  4AYB A;  1M1K 2;  1SIW A;  3TE5 B;  2V3V A;  1Q7Y 2;  4EWC A;  2E7Z A;  3S16 I;  2QA4 Z;  3S2H I;  1VQO 1;  1K8A 2;  3CCU 1;  1RLY A;  3I56 Z;  1X3Z A;  1KD1 1;  2M48 A;  3U50 C;  4E31 A;  1TWC I;  3GTG I;  2V45 A;  3IFU A;  5FLX b;  4RVF A;  3VMG A;  3K7A I;  1QVF Y;  4NBG A;  2DE7 A;  3VMH A;  1VQP 1;  3CMA Z;  3G4S Z;  3MON A;  1NJI 1;  1PFT A;  1Y8C A;  2M6N A;  1JJ2 Z;  3CCJ Z;  3HKZ A;  2W04 A;  3NDJ A;  3I4M I;  4NBB A;  2R7Z I;  3CXC Y;  2VPW A;  3VB9 A;  1WII A;  1NJI 2;  2KI7 B;  5T64 A;  3KIF A;  1VQM 1;  1Z01 A;  3HOU I;  4A3E I;  3VMI A;  3CQZ I;  3GTL I;  5C3E I;  3CMA 1;  2LFU A;  3J80 b;  3D2L A;  4BXX I;  2VUG A;  3D9X A;  1Q81 1;  2WB1 A;  2PK7 A;  1KQS Z;  1YIJ 1;  2NVT I;  4BY7 I;  1Y1V S;  1KRL A;  2QRE B;  1YUK A;  1TWG I;  4MD8 A;  3S14 I;  3G6E 1;  3FKI I;  4A3C I;  4E30 A;  1VQ4 Z;  2NVQ I;  1FDI A;  1JWH C;  3M3Y I;  2F4O A; 
#chains in the Genus database with same CATH homology
 4A3L I;  2BJO A;  1YIJ Z;  1Q7Y 1;  3MZL B;  4A3G I;  4A3B I;  3D6W A;  3FQQ A;  4NB9 A;  2OZK A;  1K73 2;  3GTO I;  1VQN 1;  3H0G I;  2JR6 A;  2JA7 I;  1LQL A;  3IX0 A;  5IT9 b;  3G6E Z;  2B63 I;  2PMZ A;  1K73 1;  2R93 I;  2O4H A;  4HGZ A;  1YI2 1;  3CD6 Z;  3J80 f;  2W03 A;  2DE5 A;  5C4X I;  1YJ9 Z;  2RT9 A;  2NVY I;  3G71 1;  3BG1 B;  4MH4 A;  3HOZ I;  4E33 A;  3J81 b;  1ZH1 A;  2QRC B;  1VQ6 1;  3ESW A;  2ZAE B;  4NBF A;  3S1Q I;  3EED A;  1VQN Z;  3JAM f;  4E2Y A;  2Q4Z A;  1VQ7 Z;  3QWU A;  5IP9 I;  4CL1 A;  1W2B Y;  2YU9 I;  1TWH I;  1YJW 1;  5C4J I;  3I55 Z;  3G71 Z;  3S1N I;  1S72 Z;  3CCS 1;  3H3V J;  2NVX I;  1YJN Z;  1RO4 A;  4MD9 A;  4BBR I;  1VQ6 Z;  2QEX Z;  1WW9 A;  2GU2 A;  2JA5 I;  2E2H I;  4RVD A;  1R9T I;  1USP A;  2I3C A;  2E9H A;  2R92 I;  3CCV Z;  4NBD A;  1Q86 1;  3J7A 4;  3TDH B;  1M90 1;  1ZB8 A;  5C44 I;  2WAQ A;  4DQY B;  3GTJ I;  1YUA A;  3CCJ 1;  1RO2 A;  3LUS A;  1SFO I;  1Z02 A;  2OTL 1;  1DL6 A;  2P3Y A;  1TWF I;  2QA4 1;  1Y1V I;  1VQL 1;  3S2D I;  1L1O C;  4A3M I;  3IF8 A;  1YI2 Z;  2V8I A;  1TFI A;  2GTI A;  2JA8 I;  2VUM I;  1VQ8 Z;  4MON A;  4NBH A;  1KD1 2;  3CC2 Z;  4NBC A;  2OTJ 1;  2OTL Z;  1VQ7 1;  3I4N I;  2QKD A;  2QRD B;  5IP7 I;  3CCE Z;  3PO3 I;  3CCM 1;  1VQP Z;  1QVF Z;  1KC8 1;  3S1M I;  4A3K I;  2E2J I;  1NUI A;  2OOX B;  2Y0S A;  3NH4 A;  5FLM I;  3I55 1;  1VQ4 1;  2OTJ Z;  5T67 A;  1YIT 1;  2V8J A;  1VQK Z;  2E2I I;  3EER A;  1VQ8 1;  4RS4 A;  1I3Q I;  5D1P A;  4MD7 A;  1Y1W I;  3OW2 Z;  5T6B A;  1QVG Y;  1P9N A;  4RVH A;  3T4N B;  1K9M 2;  1M1K 1;  3RZO I;  5D1O A;  4A3F I;  3CC4 1;  1Q86 2;  2QR1 B;  1ZB9 A;  2G2K A;  4E2X A;  2H85 A;  3CCU Z;  5A2Q b;  4QTU A;  1Q82 2;  3CME Z;  2F4M A;  4S1T A;  1Z03 A;  4BBS I;  3I07 A;  4DK1 A;  2JA6 I;  2VF1 A;  3CCM Z;  3GKQ A;  3NH8 A;  3NDI A;  3M4O I;  1S7M A;  4A3I I;  4MXU A;  1RNI A;  3J81 f;  1USP B;  3VTN A;  1NP6 A;  2HF1 A;  2JNY A;  1VQ9 Z;  3GTQ I;  4QTT A;  1YJ9 1;  1KC8 2;  4NFR A;  3F3F C;  3CCQ Z;  3CPW Z;  2JS4 A;  4Y52 I;  3P5J B;  4NBE A;  3S15 I;  2K5R A;  2PM9 A;  3F3P C;  3CC4 Z;  2K3R A;  3HOX I;  2EGT A;  1VLA A;  1YJW Z;  2RIQ A;  1N8R 2;  1W2B Z;  1K8A 1;  3CC7 1;  2LIY A;  3CCL 1;  2Q51 A;  2GTH A;  4A3J I;  3BG0 B;  1S72 1;  1QF8 A;  1M90 2;  3NFZ A;  2JMO A;  3CME 1;  2R6M A;  3FQM A;  3NH5 A;  1K83 I;  2J6A A;  1Q81 2;  2QEX 1;  4XX2 A;  3GTM S;  4A3D I;  2OOY B;  3S17 I;  3S1R I;  1ML8 A;  1WCM I;  1VQ5 1;  1JJ2 Y;  3HOY I;  3CCV 1;  3GTM I;  1RO0 A;  5LL6 f;  4MRI A;  4E2Z A;  3GTP I;  4NH1 C;  4E32 A;  2IZ3 A;  4X6A I;  2V8K A;  1VQ9 1;  4RV9 A;  1YHQ Z;  1I6H I;  1KQS Y;  1YIT Z;  5D1O B;  1VQK 1;  1N8R 1;  3I56 1;  3CCS Z;  4NBA A;  1VQL Z;  3HOV I;  2RPR A;  3G4S 1;  2QLV B;  3CCQ 1;  1VQO Z;  1QYP A;  3JAM b;  1VQ5 Z;  4Y7N I;  1N2F A;  2RHB A;  3CCL Z;  2IZ4 A;  2HU9 A;  3MZK B;  1X3W A;  3CXC Z;  4RVG A;  1VQM Z;  3CCR Z;  3CC2 1;  2DE6 A;  1I50 I;  5IT9 f;  2AKL A;  4TNU A;  1YHQ 1;  1RQF A;  2P28 A;  3GCF A;  3OW2 Y;  3GTK I;  1Q82 1;  5FLX f;  3CCE 1;  1TWA I;  5AN9 F;  3CC7 Z;  2JUB A;  2RBL A;  2O53 A;  3CD6 1;  4A93 I;  3HOW I;  2KPI A;  3Q87 A;  5CM2 M;  4HGY A;  3CCR 1;  4HH4 A;  3RZD I;  4NOZ A;  3PO3 S;  4DGL A;  3CPW Y;  4NB8 A;  4BY1 I;  2YAD A;  1YJN 1;  3PO2 I;  3KIH A;  1QVG Z;  1X0T A;  4E2W A;  5A2Q f;  1K9M 1;  4AYB A;  1M1K 2;  3TE5 B;  1Q7Y 2;  4EWC A;  3S16 I;  2QA4 Z;  3S2H I;  1VQO 1;  1K8A 2;  3CCU 1;  1RLY A;  3I56 Z;  1X3Z A;  1KD1 1;  2M48 A;  3U50 C;  4E31 A;  1TWC I;  3GTG I;  3IFU A;  5FLX b;  4RVF A;  3VMG A;  3K7A I;  1QVF Y;  4NBG A;  2DE7 A;  3VMH A;  1VQP 1;  3CMA Z;  3G4S Z;  3MON A;  1NJI 1;  1PFT A;  2M6N A;  1JJ2 Z;  3CCJ Z;  3HKZ A;  2W04 A;  3NDJ A;  3I4M I;  4NBB A;  2R7Z I;  3CXC Y;  3VB9 A;  1WII A;  1NJI 2;  2KI7 B;  5T64 A;  3KIF A;  1VQM 1;  1Z01 A;  3HOU I;  4A3E I;  3VMI A;  3CQZ I;  3GTL I;  5C3E I;  3CMA 1;  2LFU A;  3J80 b;  4BXX I;  2VUG A;  3D9X A;  1Q81 1;  2WB1 A;  2PK7 A;  1KQS Z;  1YIJ 1;  2NVT I;  4BY7 I;  1Y1V S;  1KRL A;  2QRE B;  1YUK A;  1TWG I;  4MD8 A;  3S14 I;  3G6E 1;  3FKI I;  4A3C I;  4E30 A;  1VQ4 Z;  2NVQ I;  1JWH C;  3M3Y I;  2F4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...