3CMEH

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
160
Chain Sequence
KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
total genus 37
structure length 160
sequence length 171
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3cmeH00
1Y69K 1VQOH 4WFBJ 5JVHJ 3CCUH 5GAGN 1N8RJ 5GADN 1Q81J 1VQKH 2QA4H 3I56H 1K73J 2PA2A 3CCMH 1VQ8H 3CMEH 3CCJH 1K9MJ 3J7ZM 1M1KJ 5MLCO 1K8AJ 5AN9F 4UY8M 2OTLH 4WF9J 3PIOJ 5GAEN 1VQLH 3CCSH 2OTJH 1YITH 3CC7H 1VQNH 1VQ5H 4WFNJ 3CCVH 1Q82J 1Q7YJ 3DLLJ 1YJNH 1VQ7H 4IOAJ 1QVGH 5HL7J 3G4SH 1YI2H 1YJWH 1VQMH 3OW2H 4U67J 1M90J 3G6EH 3CCRH 1YHQH 3CCEH 4WFAJ 3CD6H 4WCEJ 1VQ9H 3CMAH 1VQ4H 5H1SO 1JJ2H 3CCLH 3PIPJ 1KC8J 2ZJQJ 1KQSH 3CC2H 1S72H 1VQPH 5JVGJ 1Q86J 3CC4H 5DM7J 4IOCJ 4IO9J 2QEXH 3CF5J 1NJIJ 1W2BH 3G71H 3CCQH 1YIJH 5GAHN 3CXCH 1YJ9H 1VQ6H 3I55H 1QVFH 5DM6J 1KD1J 2ZJRJ 1WKIA 2ZJPJ 3CPWH
chains in the Genus database with same CATH superfamily
5HULA 3L4PA 1FIQC 1NVJA 1Y69K 1VQOH 4C7ZA 4USAA 4EAFA 4WFBJ 3ETRC 3C2FA 2B7QA 2W55B 5JVHJ 5AYZA 5GAGN 3CCUH 1N8RJ 5GADN 5HUPA 1Q81J 4GA4A 1VQKH 2B7NA 2Q5WE 3SR6C 2QA4H 1VLBA 1O4UA 1RM6A 3I56H 1K73J 3PAJA 3AN1A 1N63B 2PA2A 3CCMH 1VQ8H 3NVWC 3CMEH 4I9AA 3CCJH 1DGJA 1K9MJ 4US9A 3J7ZM 1M1KJ 5MLCO 1K8AJ 3NVZC 3C2OA 2J0FA 1AZYA 3NVYC 1VDVA 1OTPA 2QIEA 5AN9F 2WK6A 4UY8M 2OTLH 3EUB4 1QVFH 4KWVA 4AP8A 3TQVA 4WF9J 3PIOJ 5MPOC 5GAEN 1VQLH 3CCSH 2OMDA 2OTJH 1YITH 3CC7H 1VQNH 1FFVB 5AYYA 1QPRA 1VQ5H 1JROB 4WFNJ 3CCVH 1Q82J 1YTEA 1Q7YJ 3DLLJ 1YJNH 3FC4A 1VQ7H 4IOAJ 1QVGH 4YEKA 2B7PA 1QPNA 4LHMA 1N61B 5HL7J 3C2EA 3G4SH 2TPTA 2W3RB 4US8A 3RPFA 4GA5A 1YI2H 1YJWH 1JRPB 3NRZC 1VQMH 3OW2H 1N5XA 3GNNA 2DSJA 2E3TA 4U67J 5AYXA 1WYGA 1NVIE 3C2VA 3G6EH 1M90J 3BIIE 3AMZA 3CCRH 5EY3A 3CCEH 1YHQH 2WP4A 3B9JC 3NVVC 4EADA 4KWWA 4WFAJ 1YTDA 3CD6H 4WCEJ 1VQ9H 3CMAH 3C2RA 1VQ4H 1UOUA 1BRWA 1V97A 5H1SO 3WO1A 3CCLH 3PIPJ 1JJ2H 1KC8J 4XR5A 1FFUB 1ZXIB 4GA6A 1QAPA 2WK5A 2I14A 2ZJQJ 1KQSH 3AM9A 3VMMA 2W54B 3CC2H 1N60B 3WO0A 3NS1C 1S72H 1VQPH 1YTKA 4C7YA 5JVGJ 1SB3A 1Q86J 3CC4H 1N5WB 1FM0E 2W3SB 5DM7J 4IOCJ 4IO9J 2QEXH 4ZOHA 3WNZA 1QPOA 3CF5J 1NJIJ 1W2BH 3G71H 1SIJA 3CCQH 1YIJH 5GAHN 3CXCH 1YJ9H 4C80A 3FAHA 1VQ6H 2I1OA 1FMAE 1QPQA 3L0GA 3H5QA 4X46A 5HUOA 4YYYA 5DM6J 3I55H 1KD1J 2ZJRJ 1N62B 1WKIA 3CPWH 2JBMA 1FO4A 2ZJPJ 1X1OA 5EP8A
chains in the Genus database with same CATH topology
1Y69K 1VQOH 4WFBJ 5JVHJ 3CCUH 5GAGN 1N8RJ 5GADN 1Q81J 1VQKH 2QA4H 3I56H 1K73J 2PA2A 3CCMH 1VQ8H 3CMEH 3CCJH 1K9MJ 3J7ZM 1M1KJ 5MLCO 1K8AJ 5AN9F 4UY8M 2OTLH 4WF9J 3PIOJ 5GAEN 1VQLH 3CCSH 2OTJH 1YITH 3CC7H 1VQNH 1VQ5H 4WFNJ 3CCVH 1Q82J 1Q7YJ 3DLLJ 1YJNH 1VQ7H 4IOAJ 1QVGH 5HL7J 3G4SH 1YI2H 1YJWH 1VQMH 3OW2H 4U67J 1M90J 3G6EH 3CCRH 1YHQH 3CCEH 4WFAJ 3CD6H 4WCEJ 1VQ9H 3CMAH 1VQ4H 5H1SO 1JJ2H 3CCLH 3PIPJ 1KC8J 2ZJQJ 1KQSH 3CC2H 1S72H 1VQPH 5JVGJ 1Q86J 3CC4H 5DM7J 4IOCJ 4IO9J 2QEXH 3CF5J 1NJIJ 1W2BH 3G71H 3CCQH 1YIJH 5GAHN 3CXCH 1YJ9H 1VQ6H 3I55H 1QVFH 5DM6J 1KD1J 2ZJRJ 1WKIA 2ZJPJ 3CPWH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y69 K;  1VQO H;  4WFB J;  5JVH J;  3CCU H;  5GAG N;  1N8R J;  5GAD N;  1Q81 J;  1VQK H;  2QA4 H;  3I56 H;  1K73 J;  2PA2 A;  3CCM H;  1VQ8 H;  3CME H;  3CCJ H;  1K9M J;  3J7Z M;  1M1K J;  5MLC O;  1K8A J;  5AN9 F;  4UY8 M;  2OTL H;  4WF9 J;  3PIO J;  5GAE N;  1VQL H;  3CCS H;  2OTJ H;  1YIT H;  3CC7 H;  1VQN H;  1VQ5 H;  4WFN J;  3CCV H;  1Q82 J;  1Q7Y J;  3DLL J;  1YJN H;  1VQ7 H;  4IOA J;  1QVG H;  5HL7 J;  3G4S H;  1YI2 H;  1YJW H;  1VQM H;  3OW2 H;  4U67 J;  1M90 J;  3G6E H;  3CCR H;  1YHQ H;  3CCE H;  4WFA J;  3CD6 H;  4WCE J;  1VQ9 H;  3CMA H;  1VQ4 H;  5H1S O;  1JJ2 H;  3CCL H;  3PIP J;  1KC8 J;  2ZJQ J;  1KQS H;  3CC2 H;  1S72 H;  1VQP H;  5JVG J;  1Q86 J;  3CC4 H;  5DM7 J;  4IOC J;  4IO9 J;  2QEX H;  3CF5 J;  1NJI J;  1W2B H;  3G71 H;  3CCQ H;  1YIJ H;  5GAH N;  3CXC H;  1YJ9 H;  1VQ6 H;  3I55 H;  1QVF H;  5DM6 J;  1KD1 J;  2ZJR J;  1WKI A;  2ZJP J;  3CPW H; 
#chains in the Genus database with same CATH topology
 5HUL A;  3L4P A;  1FIQ C;  1NVJ A;  1Y69 K;  1VQO H;  4C7Z A;  4USA A;  4EAF A;  4WFB J;  3ETR C;  3C2F A;  2B7Q A;  2W55 B;  5JVH J;  5AYZ A;  5GAG N;  3CCU H;  1N8R J;  5GAD N;  5HUP A;  1Q81 J;  4GA4 A;  1VQK H;  2B7N A;  2Q5W E;  3SR6 C;  2QA4 H;  1VLB A;  1O4U A;  1RM6 A;  3I56 H;  1K73 J;  3PAJ A;  3AN1 A;  1N63 B;  2PA2 A;  3CCM H;  1VQ8 H;  3NVW C;  3CME H;  4I9A A;  3CCJ H;  1DGJ A;  1K9M J;  4US9 A;  3J7Z M;  1M1K J;  5MLC O;  1K8A J;  3NVZ C;  3C2O A;  2J0F A;  1AZY A;  3NVY C;  1VDV A;  1OTP A;  2QIE A;  5AN9 F;  2WK6 A;  4UY8 M;  2OTL H;  3EUB 4;  1QVF H;  4KWV A;  4AP8 A;  3TQV A;  4WF9 J;  3PIO J;  5MPO C;  5GAE N;  1VQL H;  3CCS H;  2OMD A;  2OTJ H;  1YIT H;  3CC7 H;  1VQN H;  1FFV B;  5AYY A;  1QPR A;  1VQ5 H;  1JRO B;  4WFN J;  3CCV H;  1Q82 J;  1YTE A;  1Q7Y J;  3DLL J;  1YJN H;  3FC4 A;  1VQ7 H;  4IOA J;  1QVG H;  4YEK A;  2B7P A;  1QPN A;  4LHM A;  1N61 B;  5HL7 J;  3C2E A;  3G4S H;  2TPT A;  2W3R B;  4US8 A;  3RPF A;  4GA5 A;  1YI2 H;  1YJW H;  1JRP B;  3NRZ C;  1VQM H;  3OW2 H;  1N5X A;  3GNN A;  2DSJ A;  2E3T A;  4U67 J;  5AYX A;  1WYG A;  1NVI E;  3C2V A;  3G6E H;  1M90 J;  3BII E;  3AMZ A;  3CCR H;  5EY3 A;  3CCE H;  1YHQ H;  2WP4 A;  3B9J C;  3NVV C;  4EAD A;  4KWW A;  4WFA J;  1YTD A;  3CD6 H;  4WCE J;  1VQ9 H;  3CMA H;  3C2R A;  1VQ4 H;  1UOU A;  1BRW A;  1V97 A;  5H1S O;  3WO1 A;  3CCL H;  3PIP J;  1JJ2 H;  1KC8 J;  4XR5 A;  1FFU B;  1ZXI B;  4GA6 A;  1QAP A;  2WK5 A;  2I14 A;  2ZJQ J;  1KQS H;  3AM9 A;  3VMM A;  2W54 B;  3CC2 H;  1N60 B;  3WO0 A;  3NS1 C;  1S72 H;  1VQP H;  1YTK A;  4C7Y A;  5JVG J;  1SB3 A;  1Q86 J;  3CC4 H;  1N5W B;  1FM0 E;  2W3S B;  5DM7 J;  4IOC J;  4IO9 J;  2QEX H;  4ZOH A;  3WNZ A;  1QPO A;  3CF5 J;  1NJI J;  1W2B H;  3G71 H;  1SIJ A;  3CCQ H;  1YIJ H;  5GAH N;  3CXC H;  1YJ9 H;  4C80 A;  3FAH A;  1VQ6 H;  2I1O A;  1FMA E;  1QPQ A;  3L0G A;  3H5Q A;  4X46 A;  5HUO A;  4YYY A;  5DM6 J;  3I55 H;  1KD1 J;  2ZJR J;  1N62 B;  1WKI A;  3CPW H;  2JBM A;  1FO4 A;  2ZJP J;  1X1O A;  5EP8 A; 
#chains in the Genus database with same CATH homology
 1Y69 K;  1VQO H;  4WFB J;  5JVH J;  3CCU H;  5GAG N;  1N8R J;  5GAD N;  1Q81 J;  1VQK H;  2QA4 H;  3I56 H;  1K73 J;  2PA2 A;  3CCM H;  1VQ8 H;  3CME H;  3CCJ H;  1K9M J;  3J7Z M;  1M1K J;  5MLC O;  1K8A J;  5AN9 F;  4UY8 M;  2OTL H;  4WF9 J;  3PIO J;  5GAE N;  1VQL H;  3CCS H;  2OTJ H;  1YIT H;  3CC7 H;  1VQN H;  1VQ5 H;  4WFN J;  3CCV H;  1Q82 J;  1Q7Y J;  3DLL J;  1YJN H;  1VQ7 H;  4IOA J;  1QVG H;  5HL7 J;  3G4S H;  1YI2 H;  1YJW H;  1VQM H;  3OW2 H;  4U67 J;  1M90 J;  3G6E H;  3CCR H;  1YHQ H;  3CCE H;  4WFA J;  3CD6 H;  4WCE J;  1VQ9 H;  3CMA H;  1VQ4 H;  5H1S O;  1JJ2 H;  3CCL H;  3PIP J;  1KC8 J;  2ZJQ J;  1KQS H;  3CC2 H;  1S72 H;  1VQP H;  5JVG J;  1Q86 J;  3CC4 H;  5DM7 J;  4IOC J;  4IO9 J;  2QEX H;  3CF5 J;  1NJI J;  1W2B H;  3G71 H;  3CCQ H;  1YIJ H;  5GAH N;  3CXC H;  1YJ9 H;  1VQ6 H;  3I55 H;  1QVF H;  5DM6 J;  1KD1 J;  2ZJR J;  1WKI A;  2ZJP J;  3CPW H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...