3CTZA

Structure of human cytosolic x-prolyl aminopeptidase
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
617
structure length
617
Chain Sequence
PKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPTGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFETPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTLEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase 1
total genus 207
structure length 617
sequence length 617
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2008-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
A PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
A PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA02
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ctzA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ctzA03
4IKSA 3PN9A 1Y1NA 4U69A 2BWVA 2GU6A 1C24A 3S6BA 2GG7A 1JAWA 2BWTA 4QR8A 2GU5A 4U6WA 1BOAA 2B3HA 5E2CA 4FO8A 2OAZA 2V3ZA 5CDVA 3PKEA 4IF7A 4PNCA 4IKTA 4U73A 2ZSGA 4U6EA 5FCHA 3PKBA 4FKCA 2HOWA 1YW9A 2EA2A 2GU4A 4ZWPA 3MX6A 2BWYA 2NQ7A 1XGNA 5JHUA 2Q94A 1YW7A 2BWSA 4RZZA 1KQ9A 4Z7MA 1WL6A 5E5BA 1W2MA 1QXYA 1YJ3A 5CDLA 2V6CA 3BIPA 3L24A 4ZNGA 4JUQA 3PKDA 2OKNA 2GG3A 2BWUA 1R5GA 3FM3A 3FMRA 4IKUA 4MATA 2P99A 2Q8KA 4U70A 1B59A 1WN1A 4FLKA 2GG2A 1MATA 2GU7A 4S2RP 2P9AA 4IPAA 2NQ6A 2GG9A 3IU8A 2BN7A 3L7GA 4FO7A 4EGEA 2BHCA 2Q93A 5JI6A 1BN5A 4A6WA 4U6ZA 4KM3A 4U75A 3PEBA 3FMQA 3MATA 1C27A 2ADUA 4IKRA 1M35A 5FCFA 3D27A 2EVOA 3RVAA 2MATA 2GGCA 3QOCA 1QXWA 2BHDA 3BIQA 1N51A 2BB7A 1C22A 1XGOA 5D6EA 3RORA 2BHAA 5CLSA 2GTXA 3IU7A 4U6JA 1WY2A 4U76A 3O5VA 1QXZA 2Q96A 4IDYA 2Q92A 2Q95A 1W7VA 2DFIA 1CHMA 1YW8A 4RGZ1 2V3YA 3Q6DA 1XGSA 3OOOA 2EA4A 2GG8A 1WLRA 1PV9A 2GG5A 2P98A 4IECA 5CIKA 1XNZA 1YVMA 1KQ0A 2B3LA 4U71A 3CB5A 1O0XA 4U1BA 4FLIA 4ZWUA 3BITA 1C23A 1WL9A 3CB6A 4IU6A 4FLLA 2GG0A 3IU9A 2GA2A 3MR1A 5CDEA 4S01A 4FUKA 3TAVA 2GZ5A 1KP0A 4B28A 4ZWOA 4R60A 2V3XA 1WBQA 1C21A 3PKAA 3PKCA 2BWWA 2GGBA 2IW2A 3IL0A 3CTZA 2BH3A 4OOKA 4HXXA 4U6CA 5JFRA 1WKMA 2BWXA 1A16A 1R5HA 2G6PA 3IG4A 4S00A 5CNXA 4S2TP 1QZYA 2EVMA 1XGMA 2B3KA 3OVKA 2BHBA 5D6FA 2EVCA 1R58A 4FLJA 3TB5A 4A6VA 4RZYA 5CE6A 4PV4A 3I7MA 1B6AA
chains in the Genus database with same CATH superfamily
4IKSA 3PN9A 1Y1NA 4U69A 2BWVA 2GU6A 1C24A 3S6BA 2GG7A 1JAWA 2BWTA 4QR8A 2GU5A 4U6WA 1BOAA 2B3HA 5E2CA 4FO8A 2OAZA 2V3ZA 5CDVA 3PKEA 4IF7A 4PNCA 4IKTA 4U73A 2ZSGA 4U6EA 5FCHA 3PKBA 4FKCA 2HOWA 1YW9A 2EA2A 2GU4A 4ZWPA 3MX6A 2BWYA 2NQ7A 1XGNA 5JHUA 2Q94A 1YW7A 2BWSA 4RZZA 1KQ9A 4Z7MA 1WL6A 5E5BA 1W2MA 1QXYA 1YJ3A 5CDLA 2V6CA 3BIPA 3L24A 4ZNGA 4JUQA 3PKDA 2OKNA 2GG3A 2BWUA 1R5GA 3FM3A 3FMRA 4IKUA 4MATA 2P99A 2Q8KA 4U70A 1B59A 1WN1A 4FLKA 2GG2A 1MATA 2GU7A 4S2RP 2P9AA 4IPAA 2NQ6A 2GG9A 3IU8A 2BN7A 3L7GA 4FO7A 4EGEA 2BHCA 2Q93A 5JI6A 1BN5A 4A6WA 4U6ZA 4KM3A 4U75A 3PEBA 3FMQA 3MATA 1C27A 2ADUA 4IKRA 1M35A 5FCFA 3D27A 2EVOA 3RVAA 2MATA 2GGCA 3QOCA 1QXWA 2BHDA 3BIQA 1N51A 2BB7A 1C22A 1XGOA 5D6EA 3RORA 2BHAA 5CLSA 2GTXA 3IU7A 4U6JA 1WY2A 4U76A 3O5VA 1QXZA 2Q96A 4IDYA 2Q92A 2Q95A 1W7VA 2DFIA 1CHMA 1YW8A 4RGZ1 2V3YA 3Q6DA 1XGSA 3OOOA 2EA4A 2GG8A 1WLRA 1PV9A 2GG5A 2P98A 4IECA 5CIKA 1XNZA 1YVMA 1KQ0A 2B3LA 4U71A 3CB5A 1O0XA 4U1BA 4FLIA 4ZWUA 3BITA 1C23A 1WL9A 3CB6A 4IU6A 4FLLA 2GG0A 3IU9A 2GA2A 3MR1A 5CDEA 4S01A 4FUKA 3TAVA 2GZ5A 1KP0A 4B28A 4ZWOA 4R60A 2V3XA 1WBQA 1C21A 3PKAA 3PKCA 2BWWA 2GGBA 2IW2A 3IL0A 3CTZA 2BH3A 4OOKA 4HXXA 4U6CA 5JFRA 1WKMA 2BWXA 1A16A 1R5HA 2G6PA 3IG4A 4S00A 5CNXA 4S2TP 1QZYA 2EVMA 1XGMA 2B3KA 3OVKA 2BHBA 5D6FA 2EVCA 1R58A 4FLJA 3TB5A 4A6VA 4RZYA 5CE6A 4PV4A 3I7MA 1B6AA
chains in the Genus database with same CATH topology
4IKSA 3PN9A 1Y1NA 4U69A 2BWVA 2GU6A 1C24A 3S6BA 2GG7A 1JAWA 2BWTA 4QR8A 2GU5A 4U6WA 1BOAA 2B3HA 5E2CA 4FO8A 2OAZA 2V3ZA 5CDVA 3PKEA 4IF7A 4PNCA 4IKTA 4U73A 2ZSGA 4U6EA 5FCHA 3PKBA 4FKCA 2HOWA 1YW9A 2EA2A 2GU4A 4ZWPA 3MX6A 2BWYA 2NQ7A 1XGNA 5JHUA 2Q94A 1YW7A 2BWSA 4RZZA 1KQ9A 4Z7MA 1WL6A 5E5BA 1W2MA 1QXYA 1YJ3A 5CDLA 2V6CA 3BIPA 3L24A 4ZNGA 4JUQA 3PKDA 2OKNA 2GG3A 2BWUA 1R5GA 3FM3A 3FMRA 4IKUA 4MATA 2P99A 2Q8KA 4U70A 1B59A 1WN1A 4FLKA 2GG2A 1MATA 2GU7A 4S2RP 2P9AA 4IPAA 2NQ6A 2GG9A 3IU8A 2BN7A 3L7GA 4FO7A 4EGEA 2BHCA 2Q93A 5JI6A 1BN5A 4A6WA 4U6ZA 4KM3A 4U75A 3PEBA 3FMQA 3MATA 1C27A 2ADUA 4IKRA 1M35A 5FCFA 3D27A 2EVOA 3RVAA 2MATA 2GGCA 3QOCA 1QXWA 2BHDA 3BIQA 1N51A 2BB7A 1C22A 1XGOA 5D6EA 3RORA 2BHAA 5CLSA 2GTXA 3IU7A 4U6JA 1WY2A 4U76A 3O5VA 1QXZA 2Q96A 4IDYA 2Q92A 2Q95A 1W7VA 2DFIA 1CHMA 1YW8A 4RGZ1 2V3YA 3Q6DA 1XGSA 3OOOA 2EA4A 2GG8A 1WLRA 1PV9A 2GG5A 2P98A 4IECA 5CIKA 1XNZA 1YVMA 1KQ0A 2B3LA 4U71A 3CB5A 1O0XA 4U1BA 4FLIA 4ZWUA 3BITA 1C23A 1WL9A 3CB6A 4IU6A 4FLLA 2GG0A 3IU9A 2GA2A 3MR1A 5CDEA 4S01A 4FUKA 3TAVA 2GZ5A 1KP0A 4B28A 4ZWOA 4R60A 2V3XA 1WBQA 1C21A 3PKAA 3PKCA 2BWWA 2GGBA 2IW2A 3IL0A 3CTZA 2BH3A 4OOKA 4HXXA 4U6CA 5JFRA 1WKMA 2BWXA 1A16A 1R5HA 2G6PA 3IG4A 4S00A 5CNXA 4S2TP 1QZYA 2EVMA 1XGMA 2B3KA 3OVKA 2BHBA 5D6FA 2EVCA 1R58A 4FLJA 3TB5A 4A6VA 4RZYA 5CE6A 4PV4A 3I7MA 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKS A;  3PN9 A;  1Y1N A;  4U69 A;  2BWV A;  2GU6 A;  1C24 A;  3S6B A;  2GG7 A;  1JAW A;  2BWT A;  4QR8 A;  2GU5 A;  4U6W A;  1BOA A;  2B3H A;  5E2C A;  4FO8 A;  2OAZ A;  2V3Z A;  5CDV A;  3PKE A;  4IF7 A;  4PNC A;  4IKT A;  4U73 A;  2ZSG A;  4U6E A;  5FCH A;  3PKB A;  4FKC A;  2HOW A;  1YW9 A;  2EA2 A;  2GU4 A;  4ZWP A;  3MX6 A;  2BWY A;  2NQ7 A;  1XGN A;  5JHU A;  2Q94 A;  1YW7 A;  2BWS A;  4RZZ A;  1KQ9 A;  4Z7M A;  1WL6 A;  5E5B A;  1W2M A;  1QXY A;  1YJ3 A;  5CDL A;  2V6C A;  3BIP A;  3L24 A;  4ZNG A;  4JUQ A;  3PKD A;  2OKN A;  2GG3 A;  2BWU A;  1R5G A;  3FM3 A;  3FMR A;  4IKU A;  4MAT A;  2P99 A;  2Q8K A;  4U70 A;  1B59 A;  1WN1 A;  4FLK A;  2GG2 A;  1MAT A;  2GU7 A;  4S2R P;  2P9A A;  4IPA A;  2NQ6 A;  2GG9 A;  3IU8 A;  2BN7 A;  3L7G A;  4FO7 A;  4EGE A;  2BHC A;  2Q93 A;  5JI6 A;  1BN5 A;  4A6W A;  4U6Z A;  4KM3 A;  4U75 A;  3PEB A;  3FMQ A;  3MAT A;  1C27 A;  2ADU A;  4IKR A;  1M35 A;  5FCF A;  3D27 A;  2EVO A;  3RVA A;  2MAT A;  2GGC A;  3QOC A;  1QXW A;  2BHD A;  3BIQ A;  1N51 A;  2BB7 A;  1C22 A;  1XGO A;  5D6E A;  3ROR A;  2BHA A;  5CLS A;  2GTX A;  3IU7 A;  4U6J A;  1WY2 A;  4U76 A;  3O5V A;  1QXZ A;  2Q96 A;  4IDY A;  2Q92 A;  2Q95 A;  1W7V A;  2DFI A;  1CHM A;  1YW8 A;  4RGZ 1;  2V3Y A;  3Q6D A;  1XGS A;  3OOO A;  2EA4 A;  2GG8 A;  1WLR A;  1PV9 A;  2GG5 A;  2P98 A;  4IEC A;  5CIK A;  1XNZ A;  1YVM A;  1KQ0 A;  2B3L A;  4U71 A;  3CB5 A;  1O0X A;  4U1B A;  4FLI A;  4ZWU A;  3BIT A;  1C23 A;  1WL9 A;  3CB6 A;  4IU6 A;  4FLL A;  2GG0 A;  3IU9 A;  2GA2 A;  3MR1 A;  5CDE A;  4S01 A;  4FUK A;  3TAV A;  2GZ5 A;  1KP0 A;  4B28 A;  4ZWO A;  4R60 A;  2V3X A;  1WBQ A;  1C21 A;  3PKA A;  3PKC A;  2BWW A;  2GGB A;  2IW2 A;  3IL0 A;  3CTZ A;  2BH3 A;  4OOK A;  4HXX A;  4U6C A;  5JFR A;  1WKM A;  2BWX A;  1A16 A;  1R5H A;  2G6P A;  3IG4 A;  4S00 A;  5CNX A;  4S2T P;  1QZY A;  2EVM A;  1XGM A;  2B3K A;  3OVK A;  2BHB A;  5D6F A;  2EVC A;  1R58 A;  4FLJ A;  3TB5 A;  4A6V A;  4RZY A;  5CE6 A;  4PV4 A;  3I7M A;  1B6A A; 
#chains in the Genus database with same CATH topology
 4IKS A;  3PN9 A;  1Y1N A;  4U69 A;  2BWV A;  2GU6 A;  1C24 A;  3S6B A;  2GG7 A;  1JAW A;  2BWT A;  4QR8 A;  2GU5 A;  4U6W A;  1BOA A;  2B3H A;  5E2C A;  4FO8 A;  2OAZ A;  2V3Z A;  5CDV A;  3PKE A;  4IF7 A;  4PNC A;  4IKT A;  4U73 A;  2ZSG A;  4U6E A;  5FCH A;  3PKB A;  4FKC A;  2HOW A;  1YW9 A;  2EA2 A;  2GU4 A;  4ZWP A;  3MX6 A;  2BWY A;  2NQ7 A;  1XGN A;  5JHU A;  2Q94 A;  1YW7 A;  2BWS A;  4RZZ A;  1KQ9 A;  4Z7M A;  1WL6 A;  5E5B A;  1W2M A;  1QXY A;  1YJ3 A;  5CDL A;  2V6C A;  3BIP A;  3L24 A;  4ZNG A;  4JUQ A;  3PKD A;  2OKN A;  2GG3 A;  2BWU A;  1R5G A;  3FM3 A;  3FMR A;  4IKU A;  4MAT A;  2P99 A;  2Q8K A;  4U70 A;  1B59 A;  1WN1 A;  4FLK A;  2GG2 A;  1MAT A;  2GU7 A;  4S2R P;  2P9A A;  4IPA A;  2NQ6 A;  2GG9 A;  3IU8 A;  2BN7 A;  3L7G A;  4FO7 A;  4EGE A;  2BHC A;  2Q93 A;  5JI6 A;  1BN5 A;  4A6W A;  4U6Z A;  4KM3 A;  4U75 A;  3PEB A;  3FMQ A;  3MAT A;  1C27 A;  2ADU A;  4IKR A;  1M35 A;  5FCF A;  3D27 A;  2EVO A;  3RVA A;  2MAT A;  2GGC A;  3QOC A;  1QXW A;  2BHD A;  3BIQ A;  1N51 A;  2BB7 A;  1C22 A;  1XGO A;  5D6E A;  3ROR A;  2BHA A;  5CLS A;  2GTX A;  3IU7 A;  4U6J A;  1WY2 A;  4U76 A;  3O5V A;  1QXZ A;  2Q96 A;  4IDY A;  2Q92 A;  2Q95 A;  1W7V A;  2DFI A;  1CHM A;  1YW8 A;  4RGZ 1;  2V3Y A;  3Q6D A;  1XGS A;  3OOO A;  2EA4 A;  2GG8 A;  1WLR A;  1PV9 A;  2GG5 A;  2P98 A;  4IEC A;  5CIK A;  1XNZ A;  1YVM A;  1KQ0 A;  2B3L A;  4U71 A;  3CB5 A;  1O0X A;  4U1B A;  4FLI A;  4ZWU A;  3BIT A;  1C23 A;  1WL9 A;  3CB6 A;  4IU6 A;  4FLL A;  2GG0 A;  3IU9 A;  2GA2 A;  3MR1 A;  5CDE A;  4S01 A;  4FUK A;  3TAV A;  2GZ5 A;  1KP0 A;  4B28 A;  4ZWO A;  4R60 A;  2V3X A;  1WBQ A;  1C21 A;  3PKA A;  3PKC A;  2BWW A;  2GGB A;  2IW2 A;  3IL0 A;  3CTZ A;  2BH3 A;  4OOK A;  4HXX A;  4U6C A;  5JFR A;  1WKM A;  2BWX A;  1A16 A;  1R5H A;  2G6P A;  3IG4 A;  4S00 A;  5CNX A;  4S2T P;  1QZY A;  2EVM A;  1XGM A;  2B3K A;  3OVK A;  2BHB A;  5D6F A;  2EVC A;  1R58 A;  4FLJ A;  3TB5 A;  4A6V A;  4RZY A;  5CE6 A;  4PV4 A;  3I7M A;  1B6A A; 
#chains in the Genus database with same CATH homology
 4IKS A;  3PN9 A;  1Y1N A;  4U69 A;  2BWV A;  2GU6 A;  1C24 A;  3S6B A;  2GG7 A;  1JAW A;  2BWT A;  4QR8 A;  2GU5 A;  4U6W A;  1BOA A;  2B3H A;  5E2C A;  4FO8 A;  2OAZ A;  2V3Z A;  5CDV A;  3PKE A;  4IF7 A;  4PNC A;  4IKT A;  4U73 A;  2ZSG A;  4U6E A;  5FCH A;  3PKB A;  4FKC A;  2HOW A;  1YW9 A;  2EA2 A;  2GU4 A;  4ZWP A;  3MX6 A;  2BWY A;  2NQ7 A;  1XGN A;  5JHU A;  2Q94 A;  1YW7 A;  2BWS A;  4RZZ A;  1KQ9 A;  4Z7M A;  1WL6 A;  5E5B A;  1W2M A;  1QXY A;  1YJ3 A;  5CDL A;  2V6C A;  3BIP A;  3L24 A;  4ZNG A;  4JUQ A;  3PKD A;  2OKN A;  2GG3 A;  2BWU A;  1R5G A;  3FM3 A;  3FMR A;  4IKU A;  4MAT A;  2P99 A;  2Q8K A;  4U70 A;  1B59 A;  1WN1 A;  4FLK A;  2GG2 A;  1MAT A;  2GU7 A;  4S2R P;  2P9A A;  4IPA A;  2NQ6 A;  2GG9 A;  3IU8 A;  2BN7 A;  3L7G A;  4FO7 A;  4EGE A;  2BHC A;  2Q93 A;  5JI6 A;  1BN5 A;  4A6W A;  4U6Z A;  4KM3 A;  4U75 A;  3PEB A;  3FMQ A;  3MAT A;  1C27 A;  2ADU A;  4IKR A;  1M35 A;  5FCF A;  3D27 A;  2EVO A;  3RVA A;  2MAT A;  2GGC A;  3QOC A;  1QXW A;  2BHD A;  3BIQ A;  1N51 A;  2BB7 A;  1C22 A;  1XGO A;  5D6E A;  3ROR A;  2BHA A;  5CLS A;  2GTX A;  3IU7 A;  4U6J A;  1WY2 A;  4U76 A;  3O5V A;  1QXZ A;  2Q96 A;  4IDY A;  2Q92 A;  2Q95 A;  1W7V A;  2DFI A;  1CHM A;  1YW8 A;  4RGZ 1;  2V3Y A;  3Q6D A;  1XGS A;  3OOO A;  2EA4 A;  2GG8 A;  1WLR A;  1PV9 A;  2GG5 A;  2P98 A;  4IEC A;  5CIK A;  1XNZ A;  1YVM A;  1KQ0 A;  2B3L A;  4U71 A;  3CB5 A;  1O0X A;  4U1B A;  4FLI A;  4ZWU A;  3BIT A;  1C23 A;  1WL9 A;  3CB6 A;  4IU6 A;  4FLL A;  2GG0 A;  3IU9 A;  2GA2 A;  3MR1 A;  5CDE A;  4S01 A;  4FUK A;  3TAV A;  2GZ5 A;  1KP0 A;  4B28 A;  4ZWO A;  4R60 A;  2V3X A;  1WBQ A;  1C21 A;  3PKA A;  3PKC A;  2BWW A;  2GGB A;  2IW2 A;  3IL0 A;  3CTZ A;  2BH3 A;  4OOK A;  4HXX A;  4U6C A;  5JFR A;  1WKM A;  2BWX A;  1A16 A;  1R5H A;  2G6P A;  3IG4 A;  4S00 A;  5CNX A;  4S2T P;  1QZY A;  2EVM A;  1XGM A;  2B3K A;  3OVK A;  2BHB A;  5D6F A;  2EVC A;  1R58 A;  4FLJ A;  3TB5 A;  4A6V A;  4RZY A;  5CE6 A;  4PV4 A;  3I7M A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...