3CWTA

Crystal structure of an alka host/guest complex 2'-fluoro-2'-deoxyinosine:adenine base pair
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
282
Chain Sequence
MYTLNWQPPYDWSWMLGFLAARAVSSVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKMSRLFDLQCNPQIVNGALGRLGAARPGLRLPGCVDAFEQGVRAILGQLVSVAMAAKLTARVAQLYGERLDDFPEYICFPTPQRLAAADPQALKALGMPLKRAEALIHLANAALEGTLPMTIPGDVEQAMKTLQTFPGIGRWTANYFALRGWQAKDVFLPDDYLIKQRFPGMTPAQIRRYAERWKPWRSYALLHIWYTEGWQPDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the E. coli DNA Glycosylase AlkA Bound to the Ends of Duplex DNA: A System for the Structure Determination of Lesion-Containing DNA.
pubmed doi rcsb
molecule keywords DNA-3-methyladenine glycosylase 2
molecule tags Hydrolase/dna
source organism Escherichia coli
total genus 88
structure length 282
sequence length 282
chains with identical sequence B, C, D
ec nomenclature ec 3.2.2.21: DNA-3-methyladenine glycosylase II.
pdb deposition date 2008-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
A PF06029 AlkA_N AlkA N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3cwtA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3cwtA03
3.30.310.20 Alpha Beta 2-Layer Sandwich TATA-Binding Protein DNA-3-methyladenine glycosylase AlkA, N-terminal domain 3cwtA01
1KG6A 2OFIA 4B21A 3I0WA 3F10A 4E9GA 3N0UA 3CWUA 2ABKA 3CWAA 3S6IA 3IH7A 2NOLA 1NGNA 3FHFA 4YPRA 3OGDA 1KO9A 4EVVA 1YQRA 1N3CA 2NOBA 4EJYA 3G0QA 1KG5A 1DIZA 1VRLA 1NKUA 2NOHA 4OFEA 1M3QA 5KN8A 3OH6A 1N39A 1RRSA 4EW4A 4DK9A 4HSBA 1LWYA 4E9FA 1KG2A 1PU8A 2NOFA 1XQPA 5AN4A 1WEFA 3CWTA 1YQMA 4B24A 1KG7A 1WEIA 3KNTA 2XHIA 5CHZA 4OFHA 4PIIA 1RRQA 4OFAA 1N3AA 1P7MA 5DPKA 4EW0A 4YPHA 2JHJA 2YG9A 3FHGA 1HU0A 4EA5A 3F0ZA 2YG8A 1XG7A 4EJZA 3CWSA 1MUYA 3IHOA 1KG3A 2JHNA 2NOZA 2NOIA 4E9EA 1P59A 1FN7A 2NOEA 1MUNA 3OH9A 2OFKA 4UOBA 3CVSA 4AIAA 5KN9A 4E9HA 1MUDA 2H56A 1EBMA 1YQKA 1KG4A 1LMZA 4UNFA 1ORNA 1LWWA 1PU6A 4AI4A 4B22A 1MPGA 4AI5A 4EA4A 1PU7A 1YQLA 4B23A 1M3HA 3N5NX 3CW7A 3I0XA 3CVTA 1KQJA 1LWVA 4YOQA 3D4VA 1KEAA 1XQOA 1WEGA 3KTUA 2I5WA 1ORPA 2JG6A 3FSPA 1PVSA
chains in the Genus database with same CATH superfamily
4B0AA 1K35A 2ABKA 2NWVA 3S6IA 3FHFA 2Y8QA 3ENCA 2IV9A 4EVVA 3BKQX 1N3CA 3G0QA 1DIZA 3R2XC 4CFFA 5KN8A 5IYDP 4DULA 1QN7A 4BJUA 1LWYA 1QN4A 3ASMA 3TE5A 4ROCB 3EAYA 2W03A 4BE0A 3I3WA 4EAIA 3C04A 3OLPA 2DKCA 2FUVA 2H5AX 3OC3C 1NVPA 3DPTA 1RRQA 4OFAA 1P7MA 4EAGA 1HU0A 2D0BA 1PCMX 2YA3A 1KY6A 3PDKA 4E9EA 4WZSD 4AIAA 1D3UA 1LMZA 4UNFA 1ORNA 3OYFA 2HZMA 1QN6A 1MPGA 1VOKA 2MZ8A 2HL9A 1PU7A 2Y8LA 4B23A 3CW7A 2EHBD 1R4XA 3OYJA 1YTBA 1Q9UA 2DKDA 4EAKA 2V75A 1E42A 3RPJA 2HL8A 3VN5A 3KTUA 2I5WA 5KL0A 1C9BB 1PVSA 4E9HA 2YH5A 5IYBP 4TPSA 4B21A 3F10A 4E9GA 1M5Q1 3VW4A 3D7QA 3CWAA 2NOLA 1NGNA 3RSMA 3OGDA 1KO9A 2NOBA 3PMGA 4EJYA 1KG5A 4NZGA 1LXTA 1KFIA 1RRSA 1VOLB 1KYFA 2FKFA 2W04A 3OYCA 1KG2A 3OYLA 2NOFA 3KRMA 1XQPA 2G30A 5AN4A 5F9CA 3EIKA 1W80A 4BACA 1WEIA 1QN9A 2QRDA 4OFHA 1QNBA 4PIIA 4QG5A 3OSEA 3OS0A 4EW0A 2OOXA 1P5DX 1C4GA 1QN5A 2FGTA 4IL8A 3OYIA 1K2YX 3CWSA 2NOIA 1FN7A 2NOEA 3OH9A 2IV8A 2PWWA 5KN9A 1MUDA 1WQAA 1LWWA 1QNCA 4AI4A 5IYCP 2QREA 3DPUA 3HS9A 1TBAB 1YQLA 1M3HA 3N5NX 3NNQA 1T6AA 3I0XA 1QN3A 1JFIC 4E7IA 3S3OA 3OSMA 4YOQA 3OYHA 3S3NA 2QR1A 3D4VA 1KEAA 1WEGA 3L2RA 2HKPA 3FSPA 4ROEB 5JN5A 1KG6A 3SNSA 2OFIA 1TUOA 3I0WA 3OS1A 3HS8A 3N0UA 3CWUA 1P5GX 4ZTFA 3IH7A 1QNAA 1NH2A 2Z8UA 1U84A 5HSHA 3OSTA 1UL7A 4WX8A 1WJWA 5FROA 3LCNA 3OYGA 3OCIA 5BMPA 2NOHA 1EUVA 1QTPA 1M3QA 2FKMX 3L2VA 4EAJA 2H4LX 1TGHA 2MJ7A 1MP9A 2HZSA 1PU8A 1TBPA 3L2QA 4PY5A 3CWTA 1YQMA 1KG7A 3OY9A 3KNTA 5FRNA 5CHZA 3OYKA 4E7HA 4MRQA 1J3MA 5DPKA 1V5SA 4YPHA 2JHJA 3F0ZA 2YG8A 3N89A 2O3OA 2NLVA 2QLVA 4EJZA 3IHOA 2JHNA 2NOZA 1P59A 1MUNA 4HJHA 3CVSA 2QRCA 2F7LA 3OYMA 1PZDA 2H56A 4C7PA 1EBMA 4WXAA 1C47A 1KG4A 1PCJX 4E7JA 4E7LA 1PU6A 3T4NA 1QNEA 1JDYA 5EPCA 3TDHA 2V92A 4BDZA 1XSZA 1KYUA 3CVTA 4BE2A 2V9JA 3UW2A 1LWVA 3OYBA 1VTLE 1XQOA 2JOIA 2V8QA 2OFKA 2JPSA 1PCZA 1VKLA 1RM1A 3OYDA 1B9KA 4YPRA 2NVMA 2R5XA 1YQRA 5JMVD 4EALA 1VRLA 1NKUA 1NGMA 5BMNA 2Z0FA 4OFEA 3ULXA 2LAEA 1KFQA 1N39A 3OH6A 4IKFA 5FRMA 4EW4A 4DK9A 4HSBA 4E9FA 3L2UA 4E7KA 2JPIA 4BE1A 1WEFA 2D0AA 3NA5A 4B24A 1AISA 1KY7A 2OOYA 1YTFA 1QTSA 2XHIA 3OYNA 1N3AA 4Q11A 4BDYA 1KYDA 2YG9A 3FHGA 3S3MA 4EA5A 1XG7A 1MUYA 1KG3A 1UT7A 3OYAA 4UOBA 1YQKA 3OYEA 4B22A 2VJ0A 1QN8A 4AI5A 4ZTJA 4EA4A 4D7QA 2ZFDB 3ENOC 1UT4A 1CDWA 4D7RA 4I8OA 3OS2A 3L2WA 1KQJA 2DKAA 4RODB 1VTOA 2D0CA 1ORPA 2JG6A 3H1ZA
chains in the Genus database with same CATH topology
1KG6A 2OFIA 4B21A 3I0WA 3F10A 4E9GA 3N0UA 3CWUA 2ABKA 3CWAA 3S6IA 3IH7A 2NOLA 1NGNA 3FHFA 4YPRA 3OGDA 1KO9A 4EVVA 1YQRA 1N3CA 2NOBA 4EJYA 3G0QA 1KG5A 1DIZA 1VRLA 1NKUA 2NOHA 4OFEA 1M3QA 5KN8A 3OH6A 1N39A 1RRSA 4EW4A 4DK9A 4HSBA 1LWYA 4E9FA 1KG2A 1PU8A 2NOFA 1XQPA 5AN4A 1WEFA 3CWTA 1YQMA 4B24A 1KG7A 1WEIA 3KNTA 2XHIA 5CHZA 4OFHA 4PIIA 1RRQA 4OFAA 1N3AA 1P7MA 5DPKA 4EW0A 4YPHA 2JHJA 2YG9A 3FHGA 1HU0A 4EA5A 3F0ZA 2YG8A 1XG7A 4EJZA 3CWSA 1MUYA 3IHOA 1KG3A 2JHNA 2NOZA 2NOIA 4E9EA 1P59A 1FN7A 2NOEA 1MUNA 3OH9A 2OFKA 4UOBA 3CVSA 4AIAA 5KN9A 4E9HA 1MUDA 2H56A 1EBMA 1YQKA 1KG4A 1LMZA 4UNFA 1ORNA 1LWWA 1PU6A 4AI4A 4B22A 1MPGA 4AI5A 4EA4A 1PU7A 1YQLA 4B23A 1M3HA 3N5NX 3CW7A 3I0XA 3CVTA 1KQJA 1LWVA 4YOQA 3D4VA 1KEAA 1XQOA 1WEGA 3KTUA 2I5WA 1ORPA 2JG6A 3FSPA 1PVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG6 A;  2OFI A;  4B21 A;  3I0W A;  3F10 A;  4E9G A;  3N0U A;  3CWU A;  2ABK A;  3CWA A;  3S6I A;  3IH7 A;  2NOL A;  1NGN A;  3FHF A;  4YPR A;  3OGD A;  1KO9 A;  4EVV A;  1YQR A;  1N3C A;  2NOB A;  4EJY A;  3G0Q A;  1KG5 A;  1DIZ A;  1VRL A;  1NKU A;  2NOH A;  4OFE A;  1M3Q A;  5KN8 A;  3OH6 A;  1N39 A;  1RRS A;  4EW4 A;  4DK9 A;  4HSB A;  1LWY A;  4E9F A;  1KG2 A;  1PU8 A;  2NOF A;  1XQP A;  5AN4 A;  1WEF A;  3CWT A;  1YQM A;  4B24 A;  1KG7 A;  1WEI A;  3KNT A;  2XHI A;  5CHZ A;  4OFH A;  4PII A;  1RRQ A;  4OFA A;  1N3A A;  1P7M A;  5DPK A;  4EW0 A;  4YPH A;  2JHJ A;  2YG9 A;  3FHG A;  1HU0 A;  4EA5 A;  3F0Z A;  2YG8 A;  1XG7 A;  4EJZ A;  3CWS A;  1MUY A;  3IHO A;  1KG3 A;  2JHN A;  2NOZ A;  2NOI A;  4E9E A;  1P59 A;  1FN7 A;  2NOE A;  1MUN A;  3OH9 A;  2OFK A;  4UOB A;  3CVS A;  4AIA A;  5KN9 A;  4E9H A;  1MUD A;  2H56 A;  1EBM A;  1YQK A;  1KG4 A;  1LMZ A;  4UNF A;  1ORN A;  1LWW A;  1PU6 A;  4AI4 A;  4B22 A;  1MPG A;  4AI5 A;  4EA4 A;  1PU7 A;  1YQL A;  4B23 A;  1M3H A;  3N5N X;  3CW7 A;  3I0X A;  3CVT A;  1KQJ A;  1LWV A;  4YOQ A;  3D4V A;  1KEA A;  1XQO A;  1WEG A;  3KTU A;  2I5W A;  1ORP A;  2JG6 A;  3FSP A;  1PVS A; 
#chains in the Genus database with same CATH topology
 4B0A A;  1K35 A;  2ABK A;  2NWV A;  3S6I A;  3FHF A;  2Y8Q A;  3ENC A;  2IV9 A;  4EVV A;  3BKQ X;  1N3C A;  3G0Q A;  1DIZ A;  3R2X C;  4CFF A;  5KN8 A;  5IYD P;  4DUL A;  1QN7 A;  4BJU A;  1LWY A;  1QN4 A;  3ASM A;  3TE5 A;  4ROC B;  3EAY A;  2W03 A;  4BE0 A;  3I3W A;  4EAI A;  3C04 A;  3OLP A;  2DKC A;  2FUV A;  2H5A X;  3OC3 C;  1NVP A;  3DPT A;  1RRQ A;  4OFA A;  1P7M A;  4EAG A;  1HU0 A;  2D0B A;  1PCM X;  2YA3 A;  1KY6 A;  3PDK A;  4E9E A;  4WZS D;  4AIA A;  1D3U A;  1LMZ A;  4UNF A;  1ORN A;  3OYF A;  2HZM A;  1QN6 A;  1MPG A;  1VOK A;  2MZ8 A;  2HL9 A;  1PU7 A;  2Y8L A;  4B23 A;  3CW7 A;  2EHB D;  1R4X A;  3OYJ A;  1YTB A;  1Q9U A;  2DKD A;  4EAK A;  2V75 A;  1E42 A;  3RPJ A;  2HL8 A;  3VN5 A;  3KTU A;  2I5W A;  5KL0 A;  1C9B B;  1PVS A;  4E9H A;  2YH5 A;  5IYB P;  4TPS A;  4B21 A;  3F10 A;  4E9G A;  1M5Q 1;  3VW4 A;  3D7Q A;  3CWA A;  2NOL A;  1NGN A;  3RSM A;  3OGD A;  1KO9 A;  2NOB A;  3PMG A;  4EJY A;  1KG5 A;  4NZG A;  1LXT A;  1KFI A;  1RRS A;  1VOL B;  1KYF A;  2FKF A;  2W04 A;  3OYC A;  1KG2 A;  3OYL A;  2NOF A;  3KRM A;  1XQP A;  2G30 A;  5AN4 A;  5F9C A;  3EIK A;  1W80 A;  4BAC A;  1WEI A;  1QN9 A;  2QRD A;  4OFH A;  1QNB A;  4PII A;  4QG5 A;  3OSE A;  3OS0 A;  4EW0 A;  2OOX A;  1P5D X;  1C4G A;  1QN5 A;  2FGT A;  4IL8 A;  3OYI A;  1K2Y X;  3CWS A;  2NOI A;  1FN7 A;  2NOE A;  3OH9 A;  2IV8 A;  2PWW A;  5KN9 A;  1MUD A;  1WQA A;  1LWW A;  1QNC A;  4AI4 A;  5IYC P;  2QRE A;  3DPU A;  3HS9 A;  1TBA B;  1YQL A;  1M3H A;  3N5N X;  3NNQ A;  1T6A A;  3I0X A;  1QN3 A;  1JFI C;  4E7I A;  3S3O A;  3OSM A;  4YOQ A;  3OYH A;  3S3N A;  2QR1 A;  3D4V A;  1KEA A;  1WEG A;  3L2R A;  2HKP A;  3FSP A;  4ROE B;  5JN5 A;  1KG6 A;  3SNS A;  2OFI A;  1TUO A;  3I0W A;  3OS1 A;  3HS8 A;  3N0U A;  3CWU A;  1P5G X;  4ZTF A;  3IH7 A;  1QNA A;  1NH2 A;  2Z8U A;  1U84 A;  5HSH A;  3OST A;  1UL7 A;  4WX8 A;  1WJW A;  5FRO A;  3LCN A;  3OYG A;  3OCI A;  5BMP A;  2NOH A;  1EUV A;  1QTP A;  1M3Q A;  2FKM X;  3L2V A;  4EAJ A;  2H4L X;  1TGH A;  2MJ7 A;  1MP9 A;  2HZS A;  1PU8 A;  1TBP A;  3L2Q A;  4PY5 A;  3CWT A;  1YQM A;  1KG7 A;  3OY9 A;  3KNT A;  5FRN A;  5CHZ A;  3OYK A;  4E7H A;  4MRQ A;  1J3M A;  5DPK A;  1V5S A;  4YPH A;  2JHJ A;  3F0Z A;  2YG8 A;  3N89 A;  2O3O A;  2NLV A;  2QLV A;  4EJZ A;  3IHO A;  2JHN A;  2NOZ A;  1P59 A;  1MUN A;  4HJH A;  3CVS A;  2QRC A;  2F7L A;  3OYM A;  1PZD A;  2H56 A;  4C7P A;  1EBM A;  4WXA A;  1C47 A;  1KG4 A;  1PCJ X;  4E7J A;  4E7L A;  1PU6 A;  3T4N A;  1QNE A;  1JDY A;  5EPC A;  3TDH A;  2V92 A;  4BDZ A;  1XSZ A;  1KYU A;  3CVT A;  4BE2 A;  2V9J A;  3UW2 A;  1LWV A;  3OYB A;  1VTL E;  1XQO A;  2JOI A;  2V8Q A;  2OFK A;  2JPS A;  1PCZ A;  1VKL A;  1RM1 A;  3OYD A;  1B9K A;  4YPR A;  2NVM A;  2R5X A;  1YQR A;  5JMV D;  4EAL A;  1VRL A;  1NKU A;  1NGM A;  5BMN A;  2Z0F A;  4OFE A;  3ULX A;  2LAE A;  1KFQ A;  1N39 A;  3OH6 A;  4IKF A;  5FRM A;  4EW4 A;  4DK9 A;  4HSB A;  4E9F A;  3L2U A;  4E7K A;  2JPI A;  4BE1 A;  1WEF A;  2D0A A;  3NA5 A;  4B24 A;  1AIS A;  1KY7 A;  2OOY A;  1YTF A;  1QTS A;  2XHI A;  3OYN A;  1N3A A;  4Q11 A;  4BDY A;  1KYD A;  2YG9 A;  3FHG A;  3S3M A;  4EA5 A;  1XG7 A;  1MUY A;  1KG3 A;  1UT7 A;  3OYA A;  4UOB A;  1YQK A;  3OYE A;  4B22 A;  2VJ0 A;  1QN8 A;  4AI5 A;  4ZTJ A;  4EA4 A;  4D7Q A;  2ZFD B;  3ENO C;  1UT4 A;  1CDW A;  4D7R A;  4I8O A;  3OS2 A;  3L2W A;  1KQJ A;  2DKA A;  4ROD B;  1VTO A;  2D0C A;  1ORP A;  2JG6 A;  3H1Z A; 
#chains in the Genus database with same CATH homology
 1KG6 A;  2OFI A;  4B21 A;  3I0W A;  3F10 A;  4E9G A;  3N0U A;  3CWU A;  2ABK A;  3CWA A;  3S6I A;  3IH7 A;  2NOL A;  1NGN A;  3FHF A;  4YPR A;  3OGD A;  1KO9 A;  4EVV A;  1YQR A;  1N3C A;  2NOB A;  4EJY A;  3G0Q A;  1KG5 A;  1DIZ A;  1VRL A;  1NKU A;  2NOH A;  4OFE A;  1M3Q A;  5KN8 A;  3OH6 A;  1N39 A;  1RRS A;  4EW4 A;  4DK9 A;  4HSB A;  1LWY A;  4E9F A;  1KG2 A;  1PU8 A;  2NOF A;  1XQP A;  5AN4 A;  1WEF A;  3CWT A;  1YQM A;  4B24 A;  1KG7 A;  1WEI A;  3KNT A;  2XHI A;  5CHZ A;  4OFH A;  4PII A;  1RRQ A;  4OFA A;  1N3A A;  1P7M A;  5DPK A;  4EW0 A;  4YPH A;  2JHJ A;  2YG9 A;  3FHG A;  1HU0 A;  4EA5 A;  3F0Z A;  2YG8 A;  1XG7 A;  4EJZ A;  3CWS A;  1MUY A;  3IHO A;  1KG3 A;  2JHN A;  2NOZ A;  2NOI A;  4E9E A;  1P59 A;  1FN7 A;  2NOE A;  1MUN A;  3OH9 A;  2OFK A;  4UOB A;  3CVS A;  4AIA A;  5KN9 A;  4E9H A;  1MUD A;  2H56 A;  1EBM A;  1YQK A;  1KG4 A;  1LMZ A;  4UNF A;  1ORN A;  1LWW A;  1PU6 A;  4AI4 A;  4B22 A;  1MPG A;  4AI5 A;  4EA4 A;  1PU7 A;  1YQL A;  4B23 A;  1M3H A;  3N5N X;  3CW7 A;  3I0X A;  3CVT A;  1KQJ A;  1LWV A;  4YOQ A;  3D4V A;  1KEA A;  1XQO A;  1WEG A;  3KTU A;  2I5W A;  1ORP A;  2JG6 A;  3FSP A;  1PVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...