3DCSA

Use of carbonic anhydrase ii, ix active-site mimic, for the purpose of screening inhibitors for possible anti-cancer properties
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a carbonic anhydrase IX active-site mimic to screen inhibitors for possible anticancer properties
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
total genus 76
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2008-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3dcsA00
3RZ7A 1CNJA 5FNHA 1YDCA 3NB5A 5JGTB 4KUWA 3CYUA 1DMXA 4Q7SA 2QP6A 1OQ5A 4K1QA 4YXIA 4QSBA 4WUPA 4DZ9A 3K34A 5FNKA 1CVHA 3DAZA 1DMYA 3B4FA 1CVFA 3SBHA 4FRCA 3MNHA 5E2NA 3HKUA 5E5RA 3P5LA 2POUA 2HFWA 1ZSBA 4UOVA 4QSIA 5LMDA 3MNKA 1I9OA 1BNWA 4CACA 1MUAA 1AM6A 3M96A 4YX4A 4QK1A 4E5QA 3P44A 1CNXA 4WW6A 1LUGA 3ML2A 4ILXA 4YWPA 5A6HA 5FL5A 1HEAA 4JSWA 4ZWXA 1YDAA 4PYXA 1OKMA 4G7AA 1CAJA 1H9NA 3HKTA 7CA2A 4XZ5A 1IF4A 3KLDB 4WW8A 1TEUX 3P3HA 4RUXA 3F7BA 3RYYA 5FLQA 5SZ6A 1AZMA 1KEQA 2NNGA 5DSJA 4Z1KA 4YXUA 3M2XA 3M5SA 3W6HA 3NI5A 1DCAA 1THKA 1G0EA 3MHCA 3MDZA 4K0SA 4LHIA 3LXEA 1TTMA 5SZ2A 5EH5A 3U47A 3S97A 3U45X 3MHIA 3OKUA 2HOCA 5EOIA 1ZNCA 4KUYA 3MNAA 3SAPA 4QEFA 4ZWZA 2NWOA 2Q38A 1CNYA 1BN4A 1RZCA 1CAHA 3KS3A 3D8WA 1XPZA 4L5WA 3U3AX 4PXXA 4ETQC 12CAA 1OKNA 4RUZA 4Q08A 1IF7A 4RIVA 5EZTX 3K2FA 1CA2A 2CA2A 4ZWIA 1BICA 1HEBA 3JXFA 5E2RA 3MHLA 5EKJA 1FR4A 3RG3A 1OKLA 4LU3A 5IPZA 5EHWA 1HECA 4ZAOA 3MWOA 4XE1A 3HS4A 3N0NA 3RYJB 3F7UA 3V3IB 3MNUA 1RZDA 3FW3A 1YO2A 1RJ5A 4FIKA 1CA3A 4E9OX 2CBBA 3P58A 4RIUA 5DSKA 5JEPB 2Q1QA 3M5TA 5EKMA 4CQ0A 3V2MA 5FNMA 3M1WA 1DCBA 4Q9YA 1HVAA 2X7TA 4HT0A 3V3FA 1KWRA 4PYYA 5L3OA 5DSOA 4G0CA 5DSRA 4RN4A 1CAYA 2GD8A 3RYXB 3IBIA 3N4BA 5BRWA 1CNIA 4ZX0A 1CRMA 4HT2A 3D9ZA 4KAPA 5DSQA 3S72B 2ABEA 1XEVA 5FDCA 3S77B 1G4JA 4RFDA 5EH8A 1CANA 3S73B 4QK2A 5E2SA 2FOSA 1HEDA 3GZ0A 4PZHA 3UYQA 4Q7WA 4FPTA 3S8XA 2EU3A 3S75B 3T5ZA 3MNJA 5FL6A 1ZGFA 1G46A 1CINA 4K13A 1LZVA 1G54A 1HUHA 3V3JA 2WD2A 4GL1X 3M40A 1CRAA 1IF5A 2HD6A 4Q6DA 5E28A 3V7XA 5CA2A 4IDRX 1JCZA 3KONA 3OY0A 5E2KA 4LP6A 1FSNA 2H15A 4KP8A 1V9EA 1CCSA 3M04A 1I9QA 2FOVA 4Q7VA 1IF8A 1TB0X 6CA2A 4QJXA 1I9PA 1FQNA 4E3GA 1HCAA 3IBUA 3EFIA 1T9NA 3B1BA 3KOKA 4E3FA 2NN7A 3JXGA 3M3XA 4M2UA 3DCWA 2WEOA 1CNCA 5FNLA 4RUYA 3RZ5A 1XEGA 3KIGA 5E5UA 4FU5A 4QJWA 4Q09A 2POWA 1UGDA 3OYSA 1G53A 2GEHA 1KWQA 1AVNA 5SZ0A 1CAIA 3ML5A 4Z1NA 1CVDA 3SBIA 3MHOA 2QO8A 5DOHA 3BL0A 3N2PA 1JV0A 3OIMA 4K0TA 3C7PA 4WL4A 1RJ6A 3JXHC 1BNUA 4MLTA 5SZ3A 5CJFA 4ZX1A 1G52A 4N16A 3V5GA 3MYQA 3D93A 5BRVA 2ZNCA 2FOUA 4Q78A 3KWAA 5DSPA 4N0XB 5BRUA 3DVBA 1ZFKA 3M2YA 4QJOA 4CNWA 4CNXA 3V3HB 3BETA 1RZAA 1UGFA 3T82A 1G1DA 3BL1A 3HFPA 1Y7WA 5G01A 5DSIA 3P4VA 3FE4A 1ZSAA 4QK3A 5DVXA 3V2JA 9CA2A 1I90A 4YYTA 4XIXA 3R17B 4YXOA 3DD0A 5DSMA 1V9IC 2NMXA 5SZ1A 3RZ8A 1RZEA 2AW1A 4Q8ZA 3V3GB 3S9TA 1KOQA 3HKNA 4YGJA 3DCSA 3S78B 3CA2A 4ITOA 1G45A 3KNEA 1IF9A 3M67A 4M2WA 2VVAX 1CVCA 2NNVA 1FSQA 2FNNA 3OIKA 1BNVA 2OSMA 3RGEA 3M98A 5BNLA 3OYQA 3CZVA 1BN1A 1ZE8A 2OSFA 4IWZA 4XIWA 5FNGA 4BF6A 2NXTA 4Q87A 1ZH9A 2NXSA 3ZNCA 4E3DA 5L6KA 3RG4A 4QSAA 3VBDA 3RLDA 1BZMA 4HU1A 4Q99A 5G0CA 5CACA 4QY3A 2NWZA 4YHAA 3DC9A 1HCBA 4L5VA 3IGPA 5A25A 5BYIA 2X7SA 3MHMA 5JEGB 3MNIA 1FR7A 1TBTX 3MZCA 4KP5A 5JDVB 2FNMA 4Q6EA 4YGKA 1LG6A 5JQTA 4K0ZA 4RH2A 4HEYA 5J8ZA 2POVA 3DBUA 3M2ZA 2WD3A 4MDLA 4QJ0A 2F14A 1LGDA 3TMJA 3ZP9A 2HKKA 4Q0LA 3IAIA 3M1JA 4TWLA 1G6VA 1ZSCA 1UGCA 2CBCA 1HUGA 2HL4A 5FNIA 1TH9A 3DD8A 3M1KA 1Z9YA 1RAYA 4KNNA 1TG9A 3HLJA 1I91A 8CA2A 1UGGA 4E3HA 1CNKA 3RYZA 1CIMA 3DCCA 2WEHA 4QSJA 2NN1A 3D92A 1CCTA 4CNRA 1CZMA 3KOIA 5JQ0A 3T85A 2HNCA 1BNMA 3DA2A 3OILA 5EKHA 4TWMA 3IBLA 3PO6A 3P5AA 4CA2A 1UGEA 3TVOX 2QOAA 5JG5B 4Q8YA 1BV3A 3DVCA 4R59A 5HPJA 4HEZA 5C8IA 1CAKA 3U7CA 4YGLA 1BNTA 2AX2A 3M14A 4MTYA 5FL4A 1CAMA 1EOUA 5EIJA 5CLUA 1G48A 4JSZA 3N3JA 5FLRA 1FSRA 1G3ZA 5DSNA 1I9LA 1CCUA 5AMLA 4DZ7A 3PJJA 4JSAA 5AMGA 3S76A 1UGBA 3PYKA 1YO0A 1CNWA 4HF3A 5FLPA 2NWPA 4Q06A 1RAZA 4QJPA 5FLOA 1BN3A 4ZWYA 3EFTA 1Z97A 3T5UA 3TVNX 2NNOA 4MDGA 1FQMA 3R16A 2CBEA 5FLSA 1CNHA 4X5SA 4Q83A 3Q31A 5SZ4A 4WUQA 1CNBA 4Z1EA 3W6IA 5SZ5A 4MLXA 4QJMA 4R5BA 3DV7A 4PQ7A 1UGAA 4RFCA 4BF1A 4XFWA 3DVDA 4KUVA 3S71B 4QTLA 2VVBX 3F4XA 4BCWA 5JGSB 2X7UA 3CAJA 2NWYA 5FDIA 1G4OA 2FNKA 3RYVB 4QIYA 4M2RA 3S74B 1Z93A 3L14A 4Q07A 4C3TA 1ZFQA 1YDDA 3RJ7A 1KOPA 3D0NA 1IF6A 2FMZA 1YDBA 4Q81A 1BCDA 5EHVA 4COQA 5JEHB 2FOQA 1F2WA 1BNNA 2WEJA 4FVOA 5G0BA 4Z0QA 3M2NA 2EZ7A 5FNJA 1A42A 3MMFA 1FQLA 3QYKA 4ITPA 1FLJA 3T83A 4JS6A 5DOGA 5JG3B 5EH7A 3K7KA 1H4NA 3M5EA 5EHEA 4L5UA 3FFPX 3NJ9A 3DC3A 3UYNA 2CBDA 4HEWA 4JSSA 3F8EA 4YGNA 1CALA 3P3JA 2WEGA 4YGFA 1CVBA 1CILA 4Y0JA 5SZ7A 4KNMA 4QIZA 2IT4A 1I9MA 5FLTA 2FW4A 5DSLA 2O4ZA 2H4NA 4YVYA 5G03A 1CVAA 4MO8A 5JESB 1JD0A 3HKQA 1CAOA 2CABA 3KKXA 4FL7A 3OKVA 4MDMA 4Q7PA 2Q1BA 3P55A 2EU2A 3RZ1B 5E2MA 1LG5A 3IBNA 2NNSA 1TEQX 2ILIA 4KNJA 1RZBA 4KNIA 4Q8XA 1H9QA 1I9NA 1CAZA 2FOYA 4Q90A 1J9WA 1YO1A 5AMDA 4FVNA 2CBAA 1CVEA 3T84A 4HBAA 1TE3X 1FQRA 1I8ZA 4WR7A 1CNGA 4E49A 5DRSA 2W2JA 4KV0A 1MOOA 1ZGEA 4E4AA 3RZ0B 1TG3A 4Z1JA 1BNQA 1URTA 1XQ0A 2FMGA 3IEOA 4M2VA 4Q49A 4R5AA 1G0FA 2NXRA 3SAXA 3M1QA 4CNVA
chains in the Genus database with same CATH superfamily
3RZ7A 1CNJA 5FNHA 1YDCA 3NB5A 5JGTB 4KUWA 3CYUA 1DMXA 4Q7SA 2QP6A 1OQ5A 4K1QA 4YXIA 4QSBA 4WUPA 4DZ9A 3K34A 5FNKA 1CVHA 3DAZA 1DMYA 3B4FA 1CVFA 3SBHA 4FRCA 3MNHA 5E2NA 3HKUA 5E5RA 3P5LA 2POUA 2HFWA 1ZSBA 4UOVA 4QSIA 5LMDA 3MNKA 1I9OA 1BNWA 4CACA 1MUAA 1AM6A 3M96A 4YX4A 4QK1A 4E5QA 3P44A 1CNXA 4WW6A 1LUGA 3ML2A 4ILXA 4YWPA 5A6HA 5FL5A 1HEAA 4JSWA 4ZWXA 1YDAA 4PYXA 1OKMA 4G7AA 1CAJA 1H9NA 3HKTA 7CA2A 4XZ5A 1IF4A 3KLDB 4WW8A 1TEUX 3P3HA 4RUXA 3F7BA 3RYYA 5FLQA 5SZ6A 1AZMA 1KEQA 2NNGA 5DSJA 4Z1KA 4YXUA 3M2XA 3M5SA 3W6HA 3NI5A 1DCAA 1THKA 1G0EA 3MHCA 3MDZA 4K0SA 4LHIA 3LXEA 1TTMA 5SZ2A 5EH5A 3U47A 3S97A 3U45X 3MHIA 3OKUA 2HOCA 5EOIA 1ZNCA 4KUYA 3MNAA 3SAPA 4QEFA 4ZWZA 2NWOA 2Q38A 1CNYA 1BN4A 1RZCA 1CAHA 3KS3A 3D8WA 1XPZA 4L5WA 3U3AX 4PXXA 4ETQC 12CAA 1OKNA 4RUZA 4Q08A 1IF7A 4RIVA 5EZTX 3K2FA 1CA2A 2CA2A 4ZWIA 1BICA 1HEBA 3JXFA 5E2RA 3MHLA 5EKJA 1FR4A 3RG3A 1OKLA 4LU3A 5IPZA 5EHWA 1HECA 4ZAOA 3MWOA 4XE1A 3HS4A 3N0NA 3RYJB 3F7UA 3V3IB 3MNUA 1RZDA 3FW3A 1YO2A 1RJ5A 4FIKA 1CA3A 4E9OX 2CBBA 3P58A 4RIUA 5DSKA 5JEPB 2Q1QA 3M5TA 5EKMA 4CQ0A 3V2MA 5FNMA 3M1WA 1DCBA 4Q9YA 1HVAA 2X7TA 4HT0A 3V3FA 1KWRA 4PYYA 5L3OA 5DSOA 4G0CA 5DSRA 4RN4A 1CAYA 2GD8A 3RYXB 3IBIA 3N4BA 5BRWA 1CNIA 4ZX0A 1CRMA 4HT2A 3D9ZA 4KAPA 5DSQA 3S72B 2ABEA 1XEVA 5FDCA 3S77B 1G4JA 4RFDA 5EH8A 1CANA 3S73B 4QK2A 5E2SA 2FOSA 1HEDA 3GZ0A 4PZHA 3UYQA 4Q7WA 4FPTA 3S8XA 2EU3A 3S75B 3T5ZA 3MNJA 5FL6A 1ZGFA 1G46A 1CINA 4K13A 1LZVA 1G54A 1HUHA 3V3JA 2WD2A 4GL1X 3M40A 1CRAA 1IF5A 2HD6A 4Q6DA 5E28A 3V7XA 5CA2A 4IDRX 1JCZA 3KONA 3OY0A 5E2KA 4LP6A 1FSNA 2H15A 4KP8A 1V9EA 1CCSA 3M04A 1I9QA 2FOVA 4Q7VA 1IF8A 1TB0X 6CA2A 4QJXA 1I9PA 1FQNA 4E3GA 1HCAA 3IBUA 3EFIA 1T9NA 3B1BA 3KOKA 4E3FA 2NN7A 3JXGA 3M3XA 4M2UA 3DCWA 2WEOA 1CNCA 5FNLA 4RUYA 3RZ5A 1XEGA 3KIGA 5E5UA 4FU5A 4QJWA 4Q09A 2POWA 1UGDA 3OYSA 1G53A 2GEHA 1KWQA 1AVNA 5SZ0A 1CAIA 3ML5A 4Z1NA 1CVDA 3SBIA 3MHOA 2QO8A 5DOHA 3BL0A 3N2PA 1JV0A 3OIMA 4K0TA 3C7PA 4WL4A 1RJ6A 3JXHC 1BNUA 4MLTA 5SZ3A 5CJFA 4ZX1A 1G52A 4N16A 3V5GA 3MYQA 3D93A 5BRVA 2ZNCA 2FOUA 4Q78A 3KWAA 5DSPA 4N0XB 5BRUA 3DVBA 1ZFKA 3M2YA 4QJOA 4CNWA 4CNXA 3V3HB 3BETA 1RZAA 1UGFA 3T82A 1G1DA 3BL1A 3HFPA 1Y7WA 5G01A 5DSIA 3P4VA 3FE4A 1ZSAA 4QK3A 5DVXA 3V2JA 9CA2A 1I90A 4YYTA 4XIXA 3R17B 4YXOA 3DD0A 5DSMA 1V9IC 2NMXA 5SZ1A 3RZ8A 1RZEA 2AW1A 4Q8ZA 3V3GB 3S9TA 1KOQA 3HKNA 4YGJA 3DCSA 3S78B 3CA2A 4ITOA 1G45A 3KNEA 1IF9A 3M67A 4M2WA 2VVAX 1CVCA 2NNVA 1FSQA 2FNNA 3OIKA 1BNVA 2OSMA 3RGEA 3M98A 5BNLA 3OYQA 3CZVA 1BN1A 1ZE8A 2OSFA 4IWZA 4XIWA 5FNGA 4BF6A 2NXTA 4Q87A 1ZH9A 2NXSA 3ZNCA 4E3DA 5L6KA 3RG4A 4QSAA 3VBDA 3RLDA 1BZMA 4HU1A 4Q99A 5G0CA 5CACA 4QY3A 2NWZA 4YHAA 3DC9A 1HCBA 4L5VA 3IGPA 5A25A 5BYIA 2X7SA 3MHMA 5JEGB 3MNIA 1FR7A 1TBTX 3MZCA 4KP5A 5JDVB 2FNMA 4Q6EA 4YGKA 1LG6A 5JQTA 4K0ZA 4RH2A 4HEYA 5J8ZA 2POVA 3DBUA 3M2ZA 2WD3A 4MDLA 4QJ0A 2F14A 1LGDA 3TMJA 3ZP9A 2HKKA 4Q0LA 3IAIA 3M1JA 4TWLA 1G6VA 1ZSCA 1UGCA 2CBCA 1HUGA 2HL4A 5FNIA 1TH9A 3DD8A 3M1KA 1Z9YA 1RAYA 4KNNA 1TG9A 3HLJA 1I91A 8CA2A 1UGGA 4E3HA 1CNKA 3RYZA 1CIMA 3DCCA 2WEHA 4QSJA 2NN1A 3D92A 1CCTA 4CNRA 1CZMA 3KOIA 5JQ0A 3T85A 2HNCA 1BNMA 3DA2A 3OILA 5EKHA 4TWMA 3IBLA 3PO6A 3P5AA 4CA2A 1UGEA 3TVOX 2QOAA 5JG5B 4Q8YA 1BV3A 3DVCA 4R59A 5HPJA 4HEZA 5C8IA 1CAKA 3U7CA 4YGLA 1BNTA 2AX2A 3M14A 4MTYA 5FL4A 1CAMA 1EOUA 5EIJA 5CLUA 1G48A 4JSZA 3N3JA 5FLRA 1FSRA 1G3ZA 5DSNA 1I9LA 1CCUA 5AMLA 4DZ7A 3PJJA 4JSAA 5AMGA 3S76A 1UGBA 3PYKA 1YO0A 1CNWA 4HF3A 5FLPA 2NWPA 4Q06A 1RAZA 4QJPA 5FLOA 1BN3A 4ZWYA 3EFTA 1Z97A 3T5UA 3TVNX 2NNOA 4MDGA 1FQMA 3R16A 2CBEA 5FLSA 1CNHA 4X5SA 4Q83A 3Q31A 5SZ4A 4WUQA 1CNBA 4Z1EA 3W6IA 5SZ5A 4MLXA 4QJMA 4R5BA 3DV7A 4PQ7A 1UGAA 4RFCA 4BF1A 4XFWA 3DVDA 4KUVA 3S71B 4QTLA 2VVBX 3F4XA 4BCWA 5JGSB 2X7UA 3CAJA 2NWYA 5FDIA 1G4OA 2FNKA 3RYVB 4QIYA 4M2RA 3S74B 1Z93A 3L14A 4Q07A 4C3TA 1ZFQA 1YDDA 3RJ7A 1KOPA 3D0NA 1IF6A 2FMZA 1YDBA 4Q81A 1BCDA 5EHVA 4COQA 5JEHB 2FOQA 1F2WA 1BNNA 2WEJA 4FVOA 5G0BA 4Z0QA 3M2NA 2EZ7A 5FNJA 1A42A 3MMFA 1FQLA 3QYKA 4ITPA 1FLJA 3T83A 4JS6A 5DOGA 5JG3B 5EH7A 3K7KA 1H4NA 3M5EA 5EHEA 4L5UA 3FFPX 3NJ9A 3DC3A 3UYNA 2CBDA 4HEWA 4JSSA 3F8EA 4YGNA 1CALA 3P3JA 2WEGA 4YGFA 1CVBA 1CILA 4Y0JA 5SZ7A 4KNMA 4QIZA 2IT4A 1I9MA 5FLTA 2FW4A 5DSLA 2O4ZA 2H4NA 4YVYA 5G03A 1CVAA 4MO8A 5JESB 1JD0A 3HKQA 1CAOA 2CABA 3KKXA 4FL7A 3OKVA 4MDMA 4Q7PA 2Q1BA 3P55A 2EU2A 3RZ1B 5E2MA 1LG5A 3IBNA 2NNSA 1TEQX 2ILIA 4KNJA 1RZBA 4KNIA 4Q8XA 1H9QA 1I9NA 1CAZA 2FOYA 4Q90A 1J9WA 1YO1A 5AMDA 4FVNA 2CBAA 1CVEA 3T84A 4HBAA 1TE3X 1FQRA 1I8ZA 4WR7A 1CNGA 4E49A 5DRSA 2W2JA 4KV0A 1MOOA 1ZGEA 4E4AA 3RZ0B 1TG3A 4Z1JA 1BNQA 1URTA 1XQ0A 2FMGA 3IEOA 4M2VA 4Q49A 4R5AA 1G0FA 2NXRA 3SAXA 3M1QA 4CNVA
chains in the Genus database with same CATH topology
3RZ7A 1CNJA 5FNHA 1YDCA 3NB5A 5JGTB 4KUWA 3CYUA 1DMXA 4Q7SA 2QP6A 1OQ5A 4K1QA 4YXIA 4QSBA 4WUPA 4DZ9A 3K34A 5FNKA 1CVHA 3DAZA 1DMYA 3B4FA 1CVFA 3SBHA 4FRCA 3MNHA 5E2NA 3HKUA 5E5RA 3P5LA 2POUA 2HFWA 1ZSBA 4UOVA 4QSIA 5LMDA 3MNKA 1I9OA 1BNWA 4CACA 1MUAA 1AM6A 3M96A 4YX4A 4QK1A 4E5QA 3P44A 1CNXA 4WW6A 1LUGA 3ML2A 4ILXA 4YWPA 5A6HA 5FL5A 1HEAA 4JSWA 4ZWXA 1YDAA 4PYXA 1OKMA 4G7AA 1CAJA 1H9NA 3HKTA 7CA2A 4XZ5A 1IF4A 3KLDB 4WW8A 1TEUX 3P3HA 4RUXA 3F7BA 3RYYA 5FLQA 5SZ6A 1AZMA 1KEQA 2NNGA 5DSJA 4Z1KA 4YXUA 3M2XA 3M5SA 3W6HA 3NI5A 1DCAA 1THKA 1G0EA 3MHCA 3MDZA 4K0SA 4LHIA 3LXEA 1TTMA 5SZ2A 5EH5A 3U47A 3S97A 3U45X 3MHIA 3OKUA 2HOCA 5EOIA 1ZNCA 4KUYA 3MNAA 3SAPA 4QEFA 4ZWZA 2NWOA 2Q38A 1CNYA 1BN4A 1RZCA 1CAHA 3KS3A 3D8WA 1XPZA 4L5WA 3U3AX 4PXXA 4ETQC 12CAA 1OKNA 4RUZA 4Q08A 1IF7A 4RIVA 5EZTX 3K2FA 1CA2A 2CA2A 4ZWIA 1BICA 1HEBA 3JXFA 5E2RA 3MHLA 5EKJA 1FR4A 3RG3A 1OKLA 4LU3A 5IPZA 5EHWA 1HECA 4ZAOA 3MWOA 4XE1A 3HS4A 3N0NA 3RYJB 3F7UA 3V3IB 3MNUA 1RZDA 3FW3A 1YO2A 1RJ5A 4FIKA 1CA3A 4E9OX 2CBBA 3P58A 4RIUA 5DSKA 5JEPB 2Q1QA 3M5TA 5EKMA 4CQ0A 3V2MA 5FNMA 3M1WA 1DCBA 4Q9YA 1HVAA 2X7TA 4HT0A 3V3FA 1KWRA 4PYYA 5L3OA 5DSOA 4G0CA 5DSRA 4RN4A 1CAYA 2GD8A 3RYXB 3IBIA 3N4BA 5BRWA 1CNIA 4ZX0A 1CRMA 4HT2A 3D9ZA 4KAPA 5DSQA 3S72B 2ABEA 1XEVA 5FDCA 3S77B 1G4JA 4RFDA 5EH8A 1CANA 3S73B 4QK2A 5E2SA 2FOSA 1HEDA 3GZ0A 4PZHA 3UYQA 4Q7WA 4FPTA 3S8XA 2EU3A 3S75B 3T5ZA 3MNJA 5FL6A 1ZGFA 1G46A 1CINA 4K13A 1LZVA 1G54A 1HUHA 3V3JA 2WD2A 4GL1X 3M40A 1CRAA 1IF5A 2HD6A 4Q6DA 5E28A 3V7XA 5CA2A 4IDRX 1JCZA 3KONA 3OY0A 5E2KA 4LP6A 1FSNA 2H15A 4KP8A 1V9EA 1CCSA 3M04A 1I9QA 2FOVA 4Q7VA 1IF8A 1TB0X 6CA2A 4QJXA 1I9PA 1FQNA 4E3GA 1HCAA 3IBUA 3EFIA 1T9NA 3B1BA 3KOKA 4E3FA 2NN7A 3JXGA 3M3XA 4M2UA 3DCWA 2WEOA 1CNCA 5FNLA 4RUYA 3RZ5A 1XEGA 3KIGA 5E5UA 4FU5A 4QJWA 4Q09A 2POWA 1UGDA 3OYSA 1G53A 2GEHA 1KWQA 1AVNA 5SZ0A 1CAIA 3ML5A 4Z1NA 1CVDA 3SBIA 3MHOA 2QO8A 5DOHA 3BL0A 3N2PA 1JV0A 3OIMA 4K0TA 3C7PA 4WL4A 1RJ6A 3JXHC 1BNUA 4MLTA 5SZ3A 5CJFA 4ZX1A 1G52A 4N16A 3V5GA 3MYQA 3D93A 5BRVA 2ZNCA 2FOUA 4Q78A 3KWAA 5DSPA 4N0XB 5BRUA 3DVBA 1ZFKA 3M2YA 4QJOA 4CNWA 4CNXA 3V3HB 3BETA 1RZAA 1UGFA 3T82A 1G1DA 3BL1A 3HFPA 1Y7WA 5G01A 5DSIA 3P4VA 3FE4A 1ZSAA 4QK3A 5DVXA 3V2JA 9CA2A 1I90A 4YYTA 4XIXA 3R17B 4YXOA 3DD0A 5DSMA 1V9IC 2NMXA 5SZ1A 3RZ8A 1RZEA 2AW1A 4Q8ZA 3V3GB 3S9TA 1KOQA 3HKNA 4YGJA 3DCSA 3S78B 3CA2A 4ITOA 1G45A 3KNEA 1IF9A 3M67A 4M2WA 2VVAX 1CVCA 2NNVA 1FSQA 2FNNA 3OIKA 1BNVA 2OSMA 3RGEA 3M98A 5BNLA 3OYQA 3CZVA 1BN1A 1ZE8A 2OSFA 4IWZA 4XIWA 5FNGA 4BF6A 2NXTA 4Q87A 1ZH9A 2NXSA 3ZNCA 4E3DA 5L6KA 3RG4A 4QSAA 3VBDA 3RLDA 1BZMA 4HU1A 4Q99A 5G0CA 5CACA 4QY3A 2NWZA 4YHAA 3DC9A 1HCBA 4L5VA 3IGPA 5A25A 5BYIA 2X7SA 3MHMA 5JEGB 3MNIA 1FR7A 1TBTX 3MZCA 4KP5A 5JDVB 2FNMA 4Q6EA 4YGKA 1LG6A 5JQTA 4K0ZA 4RH2A 4HEYA 5J8ZA 2POVA 3DBUA 3M2ZA 2WD3A 4MDLA 4QJ0A 2F14A 1LGDA 3TMJA 3ZP9A 2HKKA 4Q0LA 3IAIA 3M1JA 4TWLA 1G6VA 1ZSCA 1UGCA 2CBCA 1HUGA 2HL4A 5FNIA 1TH9A 3DD8A 3M1KA 1Z9YA 1RAYA 4KNNA 1TG9A 3HLJA 1I91A 8CA2A 1UGGA 4E3HA 1CNKA 3RYZA 1CIMA 3DCCA 2WEHA 4QSJA 2NN1A 3D92A 1CCTA 4CNRA 1CZMA 3KOIA 5JQ0A 3T85A 2HNCA 1BNMA 3DA2A 3OILA 5EKHA 4TWMA 3IBLA 3PO6A 3P5AA 4CA2A 1UGEA 3TVOX 2QOAA 5JG5B 4Q8YA 1BV3A 3DVCA 4R59A 5HPJA 4HEZA 5C8IA 1CAKA 3U7CA 4YGLA 1BNTA 2AX2A 3M14A 4MTYA 5FL4A 1CAMA 1EOUA 5EIJA 5CLUA 1G48A 4JSZA 3N3JA 5FLRA 1FSRA 1G3ZA 5DSNA 1I9LA 1CCUA 5AMLA 4DZ7A 3PJJA 4JSAA 5AMGA 3S76A 1UGBA 3PYKA 1YO0A 1CNWA 4HF3A 5FLPA 2NWPA 4Q06A 1RAZA 4QJPA 5FLOA 1BN3A 4ZWYA 3EFTA 1Z97A 3T5UA 3TVNX 2NNOA 4MDGA 1FQMA 3R16A 2CBEA 5FLSA 1CNHA 4X5SA 4Q83A 3Q31A 5SZ4A 4WUQA 1CNBA 4Z1EA 3W6IA 5SZ5A 4MLXA 4QJMA 4R5BA 3DV7A 4PQ7A 1UGAA 4RFCA 4BF1A 4XFWA 3DVDA 4KUVA 3S71B 4QTLA 2VVBX 3F4XA 4BCWA 5JGSB 2X7UA 3CAJA 2NWYA 5FDIA 1G4OA 2FNKA 3RYVB 4QIYA 4M2RA 3S74B 1Z93A 3L14A 4Q07A 4C3TA 1ZFQA 1YDDA 3RJ7A 1KOPA 3D0NA 1IF6A 2FMZA 1YDBA 4Q81A 1BCDA 5EHVA 4COQA 5JEHB 2FOQA 1F2WA 1BNNA 2WEJA 4FVOA 5G0BA 4Z0QA 3M2NA 2EZ7A 5FNJA 1A42A 3MMFA 1FQLA 3QYKA 4ITPA 1FLJA 3T83A 4JS6A 5DOGA 5JG3B 5EH7A 3K7KA 1H4NA 3M5EA 5EHEA 4L5UA 3FFPX 3NJ9A 3DC3A 3UYNA 2CBDA 4HEWA 4JSSA 3F8EA 4YGNA 1CALA 3P3JA 2WEGA 4YGFA 1CVBA 1CILA 4Y0JA 5SZ7A 4KNMA 4QIZA 2IT4A 1I9MA 5FLTA 2FW4A 5DSLA 2O4ZA 2H4NA 4YVYA 5G03A 1CVAA 4MO8A 5JESB 1JD0A 3HKQA 1CAOA 2CABA 3KKXA 4FL7A 3OKVA 4MDMA 4Q7PA 2Q1BA 3P55A 2EU2A 3RZ1B 5E2MA 1LG5A 3IBNA 2NNSA 1TEQX 2ILIA 4KNJA 1RZBA 4KNIA 4Q8XA 1H9QA 1I9NA 1CAZA 2FOYA 4Q90A 1J9WA 1YO1A 5AMDA 4FVNA 2CBAA 1CVEA 3T84A 4HBAA 1TE3X 1FQRA 1I8ZA 4WR7A 1CNGA 4E49A 5DRSA 2W2JA 4KV0A 1MOOA 1ZGEA 4E4AA 3RZ0B 1TG3A 4Z1JA 1BNQA 1URTA 1XQ0A 2FMGA 3IEOA 4M2VA 4Q49A 4R5AA 1G0FA 2NXRA 3SAXA 3M1QA 4CNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZ7 A;  1CNJ A;  5FNH A;  1YDC A;  3NB5 A;  5JGT B;  4KUW A;  3CYU A;  1DMX A;  4Q7S A;  2QP6 A;  1OQ5 A;  4K1Q A;  4YXI A;  4QSB A;  4WUP A;  4DZ9 A;  3K34 A;  5FNK A;  1CVH A;  3DAZ A;  1DMY A;  3B4F A;  1CVF A;  3SBH A;  4FRC A;  3MNH A;  5E2N A;  3HKU A;  5E5R A;  3P5L A;  2POU A;  2HFW A;  1ZSB A;  4UOV A;  4QSI A;  5LMD A;  3MNK A;  1I9O A;  1BNW A;  4CAC A;  1MUA A;  1AM6 A;  3M96 A;  4YX4 A;  4QK1 A;  4E5Q A;  3P44 A;  1CNX A;  4WW6 A;  1LUG A;  3ML2 A;  4ILX A;  4YWP A;  5A6H A;  5FL5 A;  1HEA A;  4JSW A;  4ZWX A;  1YDA A;  4PYX A;  1OKM A;  4G7A A;  1CAJ A;  1H9N A;  3HKT A;  7CA2 A;  4XZ5 A;  1IF4 A;  3KLD B;  4WW8 A;  1TEU X;  3P3H A;  4RUX A;  3F7B A;  3RYY A;  5FLQ A;  5SZ6 A;  1AZM A;  1KEQ A;  2NNG A;  5DSJ A;  4Z1K A;  4YXU A;  3M2X A;  3M5S A;  3W6H A;  3NI5 A;  1DCA A;  1THK A;  1G0E A;  3MHC A;  3MDZ A;  4K0S A;  4LHI A;  3LXE A;  1TTM A;  5SZ2 A;  5EH5 A;  3U47 A;  3S97 A;  3U45 X;  3MHI A;  3OKU A;  2HOC A;  5EOI A;  1ZNC A;  4KUY A;  3MNA A;  3SAP A;  4QEF A;  4ZWZ A;  2NWO A;  2Q38 A;  1CNY A;  1BN4 A;  1RZC A;  1CAH A;  3KS3 A;  3D8W A;  1XPZ A;  4L5W A;  3U3A X;  4PXX A;  4ETQ C;  12CA A;  1OKN A;  4RUZ A;  4Q08 A;  1IF7 A;  4RIV A;  5EZT X;  3K2F A;  1CA2 A;  2CA2 A;  4ZWI A;  1BIC A;  1HEB A;  3JXF A;  5E2R A;  3MHL A;  5EKJ A;  1FR4 A;  3RG3 A;  1OKL A;  4LU3 A;  5IPZ A;  5EHW A;  1HEC A;  4ZAO A;  3MWO A;  4XE1 A;  3HS4 A;  3N0N A;  3RYJ B;  3F7U A;  3V3I B;  3MNU A;  1RZD A;  3FW3 A;  1YO2 A;  1RJ5 A;  4FIK A;  1CA3 A;  4E9O X;  2CBB A;  3P58 A;  4RIU A;  5DSK A;  5JEP B;  2Q1Q A;  3M5T A;  5EKM A;  4CQ0 A;  3V2M A;  5FNM A;  3M1W A;  1DCB A;  4Q9Y A;  1HVA A;  2X7T A;  4HT0 A;  3V3F A;  1KWR A;  4PYY A;  5L3O A;  5DSO A;  4G0C A;  5DSR A;  4RN4 A;  1CAY A;  2GD8 A;  3RYX B;  3IBI A;  3N4B A;  5BRW A;  1CNI A;  4ZX0 A;  1CRM A;  4HT2 A;  3D9Z A;  4KAP A;  5DSQ A;  3S72 B;  2ABE A;  1XEV A;  5FDC A;  3S77 B;  1G4J A;  4RFD A;  5EH8 A;  1CAN A;  3S73 B;  4QK2 A;  5E2S A;  2FOS A;  1HED A;  3GZ0 A;  4PZH A;  3UYQ A;  4Q7W A;  4FPT A;  3S8X A;  2EU3 A;  3S75 B;  3T5Z A;  3MNJ A;  5FL6 A;  1ZGF A;  1G46 A;  1CIN A;  4K13 A;  1LZV A;  1G54 A;  1HUH A;  3V3J A;  2WD2 A;  4GL1 X;  3M40 A;  1CRA A;  1IF5 A;  2HD6 A;  4Q6D A;  5E28 A;  3V7X A;  5CA2 A;  4IDR X;  1JCZ A;  3KON A;  3OY0 A;  5E2K A;  4LP6 A;  1FSN A;  2H15 A;  4KP8 A;  1V9E A;  1CCS A;  3M04 A;  1I9Q A;  2FOV A;  4Q7V A;  1IF8 A;  1TB0 X;  6CA2 A;  4QJX A;  1I9P A;  1FQN A;  4E3G A;  1HCA A;  3IBU A;  3EFI A;  1T9N A;  3B1B A;  3KOK A;  4E3F A;  2NN7 A;  3JXG A;  3M3X A;  4M2U A;  3DCW A;  2WEO A;  1CNC A;  5FNL A;  4RUY A;  3RZ5 A;  1XEG A;  3KIG A;  5E5U A;  4FU5 A;  4QJW A;  4Q09 A;  2POW A;  1UGD A;  3OYS A;  1G53 A;  2GEH A;  1KWQ A;  1AVN A;  5SZ0 A;  1CAI A;  3ML5 A;  4Z1N A;  1CVD A;  3SBI A;  3MHO A;  2QO8 A;  5DOH A;  3BL0 A;  3N2P A;  1JV0 A;  3OIM A;  4K0T A;  3C7P A;  4WL4 A;  1RJ6 A;  3JXH C;  1BNU A;  4MLT A;  5SZ3 A;  5CJF A;  4ZX1 A;  1G52 A;  4N16 A;  3V5G A;  3MYQ A;  3D93 A;  5BRV A;  2ZNC A;  2FOU A;  4Q78 A;  3KWA A;  5DSP A;  4N0X B;  5BRU A;  3DVB A;  1ZFK A;  3M2Y A;  4QJO A;  4CNW A;  4CNX A;  3V3H B;  3BET A;  1RZA A;  1UGF A;  3T82 A;  1G1D A;  3BL1 A;  3HFP A;  1Y7W A;  5G01 A;  5DSI A;  3P4V A;  3FE4 A;  1ZSA A;  4QK3 A;  5DVX A;  3V2J A;  9CA2 A;  1I90 A;  4YYT A;  4XIX A;  3R17 B;  4YXO A;  3DD0 A;  5DSM A;  1V9I C;  2NMX A;  5SZ1 A;  3RZ8 A;  1RZE A;  2AW1 A;  4Q8Z A;  3V3G B;  3S9T A;  1KOQ A;  3HKN A;  4YGJ A;  3DCS A;  3S78 B;  3CA2 A;  4ITO A;  1G45 A;  3KNE A;  1IF9 A;  3M67 A;  4M2W A;  2VVA X;  1CVC A;  2NNV A;  1FSQ A;  2FNN A;  3OIK A;  1BNV A;  2OSM A;  3RGE A;  3M98 A;  5BNL A;  3OYQ A;  3CZV A;  1BN1 A;  1ZE8 A;  2OSF A;  4IWZ A;  4XIW A;  5FNG A;  4BF6 A;  2NXT A;  4Q87 A;  1ZH9 A;  2NXS A;  3ZNC A;  4E3D A;  5L6K A;  3RG4 A;  4QSA A;  3VBD A;  3RLD A;  1BZM A;  4HU1 A;  4Q99 A;  5G0C A;  5CAC A;  4QY3 A;  2NWZ A;  4YHA A;  3DC9 A;  1HCB A;  4L5V A;  3IGP A;  5A25 A;  5BYI A;  2X7S A;  3MHM A;  5JEG B;  3MNI A;  1FR7 A;  1TBT X;  3MZC A;  4KP5 A;  5JDV B;  2FNM A;  4Q6E A;  4YGK A;  1LG6 A;  5JQT A;  4K0Z A;  4RH2 A;  4HEY A;  5J8Z A;  2POV A;  3DBU A;  3M2Z A;  2WD3 A;  4MDL A;  4QJ0 A;  2F14 A;  1LGD A;  3TMJ A;  3ZP9 A;  2HKK A;  4Q0L A;  3IAI A;  3M1J A;  4TWL A;  1G6V A;  1ZSC A;  1UGC A;  2CBC A;  1HUG A;  2HL4 A;  5FNI A;  1TH9 A;  3DD8 A;  3M1K A;  1Z9Y A;  1RAY A;  4KNN A;  1TG9 A;  3HLJ A;  1I91 A;  8CA2 A;  1UGG A;  4E3H A;  1CNK A;  3RYZ A;  1CIM A;  3DCC A;  2WEH A;  4QSJ A;  2NN1 A;  3D92 A;  1CCT A;  4CNR A;  1CZM A;  3KOI A;  5JQ0 A;  3T85 A;  2HNC A;  1BNM A;  3DA2 A;  3OIL A;  5EKH A;  4TWM A;  3IBL A;  3PO6 A;  3P5A A;  4CA2 A;  1UGE A;  3TVO X;  2QOA A;  5JG5 B;  4Q8Y A;  1BV3 A;  3DVC A;  4R59 A;  5HPJ A;  4HEZ A;  5C8I A;  1CAK A;  3U7C A;  4YGL A;  1BNT A;  2AX2 A;  3M14 A;  4MTY A;  5FL4 A;  1CAM A;  1EOU A;  5EIJ A;  5CLU A;  1G48 A;  4JSZ A;  3N3J A;  5FLR A;  1FSR A;  1G3Z A;  5DSN A;  1I9L A;  1CCU A;  5AML A;  4DZ7 A;  3PJJ A;  4JSA A;  5AMG A;  3S76 A;  1UGB A;  3PYK A;  1YO0 A;  1CNW A;  4HF3 A;  5FLP A;  2NWP A;  4Q06 A;  1RAZ A;  4QJP A;  5FLO A;  1BN3 A;  4ZWY A;  3EFT A;  1Z97 A;  3T5U A;  3TVN X;  2NNO A;  4MDG A;  1FQM A;  3R16 A;  2CBE A;  5FLS A;  1CNH A;  4X5S A;  4Q83 A;  3Q31 A;  5SZ4 A;  4WUQ A;  1CNB A;  4Z1E A;  3W6I A;  5SZ5 A;  4MLX A;  4QJM A;  4R5B A;  3DV7 A;  4PQ7 A;  1UGA A;  4RFC A;  4BF1 A;  4XFW A;  3DVD A;  4KUV A;  3S71 B;  4QTL A;  2VVB X;  3F4X A;  4BCW A;  5JGS B;  2X7U A;  3CAJ A;  2NWY A;  5FDI A;  1G4O A;  2FNK A;  3RYV B;  4QIY A;  4M2R A;  3S74 B;  1Z93 A;  3L14 A;  4Q07 A;  4C3T A;  1ZFQ A;  1YDD A;  3RJ7 A;  1KOP A;  3D0N A;  1IF6 A;  2FMZ A;  1YDB A;  4Q81 A;  1BCD A;  5EHV A;  4COQ A;  5JEH B;  2FOQ A;  1F2W A;  1BNN A;  2WEJ A;  4FVO A;  5G0B A;  4Z0Q A;  3M2N A;  2EZ7 A;  5FNJ A;  1A42 A;  3MMF A;  1FQL A;  3QYK A;  4ITP A;  1FLJ A;  3T83 A;  4JS6 A;  5DOG A;  5JG3 B;  5EH7 A;  3K7K A;  1H4N A;  3M5E A;  5EHE A;  4L5U A;  3FFP X;  3NJ9 A;  3DC3 A;  3UYN A;  2CBD A;  4HEW A;  4JSS A;  3F8E A;  4YGN A;  1CAL A;  3P3J A;  2WEG A;  4YGF A;  1CVB A;  1CIL A;  4Y0J A;  5SZ7 A;  4KNM A;  4QIZ A;  2IT4 A;  1I9M A;  5FLT A;  2FW4 A;  5DSL A;  2O4Z A;  2H4N A;  4YVY A;  5G03 A;  1CVA A;  4MO8 A;  5JES B;  1JD0 A;  3HKQ A;  1CAO A;  2CAB A;  3KKX A;  4FL7 A;  3OKV A;  4MDM A;  4Q7P A;  2Q1B A;  3P55 A;  2EU2 A;  3RZ1 B;  5E2M A;  1LG5 A;  3IBN A;  2NNS A;  1TEQ X;  2ILI A;  4KNJ A;  1RZB A;  4KNI A;  4Q8X A;  1H9Q A;  1I9N A;  1CAZ A;  2FOY A;  4Q90 A;  1J9W A;  1YO1 A;  5AMD A;  4FVN A;  2CBA A;  1CVE A;  3T84 A;  4HBA A;  1TE3 X;  1FQR A;  1I8Z A;  4WR7 A;  1CNG A;  4E49 A;  5DRS A;  2W2J A;  4KV0 A;  1MOO A;  1ZGE A;  4E4A A;  3RZ0 B;  1TG3 A;  4Z1J A;  1BNQ A;  1URT A;  1XQ0 A;  2FMG A;  3IEO A;  4M2V A;  4Q49 A;  4R5A A;  1G0F A;  2NXR A;  3SAX A;  3M1Q A;  4CNV A; 
#chains in the Genus database with same CATH topology
 3RZ7 A;  1CNJ A;  5FNH A;  1YDC A;  3NB5 A;  5JGT B;  4KUW A;  3CYU A;  1DMX A;  4Q7S A;  2QP6 A;  1OQ5 A;  4K1Q A;  4YXI A;  4QSB A;  4WUP A;  4DZ9 A;  3K34 A;  5FNK A;  1CVH A;  3DAZ A;  1DMY A;  3B4F A;  1CVF A;  3SBH A;  4FRC A;  3MNH A;  5E2N A;  3HKU A;  5E5R A;  3P5L A;  2POU A;  2HFW A;  1ZSB A;  4UOV A;  4QSI A;  5LMD A;  3MNK A;  1I9O A;  1BNW A;  4CAC A;  1MUA A;  1AM6 A;  3M96 A;  4YX4 A;  4QK1 A;  4E5Q A;  3P44 A;  1CNX A;  4WW6 A;  1LUG A;  3ML2 A;  4ILX A;  4YWP A;  5A6H A;  5FL5 A;  1HEA A;  4JSW A;  4ZWX A;  1YDA A;  4PYX A;  1OKM A;  4G7A A;  1CAJ A;  1H9N A;  3HKT A;  7CA2 A;  4XZ5 A;  1IF4 A;  3KLD B;  4WW8 A;  1TEU X;  3P3H A;  4RUX A;  3F7B A;  3RYY A;  5FLQ A;  5SZ6 A;  1AZM A;  1KEQ A;  2NNG A;  5DSJ A;  4Z1K A;  4YXU A;  3M2X A;  3M5S A;  3W6H A;  3NI5 A;  1DCA A;  1THK A;  1G0E A;  3MHC A;  3MDZ A;  4K0S A;  4LHI A;  3LXE A;  1TTM A;  5SZ2 A;  5EH5 A;  3U47 A;  3S97 A;  3U45 X;  3MHI A;  3OKU A;  2HOC A;  5EOI A;  1ZNC A;  4KUY A;  3MNA A;  3SAP A;  4QEF A;  4ZWZ A;  2NWO A;  2Q38 A;  1CNY A;  1BN4 A;  1RZC A;  1CAH A;  3KS3 A;  3D8W A;  1XPZ A;  4L5W A;  3U3A X;  4PXX A;  4ETQ C;  12CA A;  1OKN A;  4RUZ A;  4Q08 A;  1IF7 A;  4RIV A;  5EZT X;  3K2F A;  1CA2 A;  2CA2 A;  4ZWI A;  1BIC A;  1HEB A;  3JXF A;  5E2R A;  3MHL A;  5EKJ A;  1FR4 A;  3RG3 A;  1OKL A;  4LU3 A;  5IPZ A;  5EHW A;  1HEC A;  4ZAO A;  3MWO A;  4XE1 A;  3HS4 A;  3N0N A;  3RYJ B;  3F7U A;  3V3I B;  3MNU A;  1RZD A;  3FW3 A;  1YO2 A;  1RJ5 A;  4FIK A;  1CA3 A;  4E9O X;  2CBB A;  3P58 A;  4RIU A;  5DSK A;  5JEP B;  2Q1Q A;  3M5T A;  5EKM A;  4CQ0 A;  3V2M A;  5FNM A;  3M1W A;  1DCB A;  4Q9Y A;  1HVA A;  2X7T A;  4HT0 A;  3V3F A;  1KWR A;  4PYY A;  5L3O A;  5DSO A;  4G0C A;  5DSR A;  4RN4 A;  1CAY A;  2GD8 A;  3RYX B;  3IBI A;  3N4B A;  5BRW A;  1CNI A;  4ZX0 A;  1CRM A;  4HT2 A;  3D9Z A;  4KAP A;  5DSQ A;  3S72 B;  2ABE A;  1XEV A;  5FDC A;  3S77 B;  1G4J A;  4RFD A;  5EH8 A;  1CAN A;  3S73 B;  4QK2 A;  5E2S A;  2FOS A;  1HED A;  3GZ0 A;  4PZH A;  3UYQ A;  4Q7W A;  4FPT A;  3S8X A;  2EU3 A;  3S75 B;  3T5Z A;  3MNJ A;  5FL6 A;  1ZGF A;  1G46 A;  1CIN A;  4K13 A;  1LZV A;  1G54 A;  1HUH A;  3V3J A;  2WD2 A;  4GL1 X;  3M40 A;  1CRA A;  1IF5 A;  2HD6 A;  4Q6D A;  5E28 A;  3V7X A;  5CA2 A;  4IDR X;  1JCZ A;  3KON A;  3OY0 A;  5E2K A;  4LP6 A;  1FSN A;  2H15 A;  4KP8 A;  1V9E A;  1CCS A;  3M04 A;  1I9Q A;  2FOV A;  4Q7V A;  1IF8 A;  1TB0 X;  6CA2 A;  4QJX A;  1I9P A;  1FQN A;  4E3G A;  1HCA A;  3IBU A;  3EFI A;  1T9N A;  3B1B A;  3KOK A;  4E3F A;  2NN7 A;  3JXG A;  3M3X A;  4M2U A;  3DCW A;  2WEO A;  1CNC A;  5FNL A;  4RUY A;  3RZ5 A;  1XEG A;  3KIG A;  5E5U A;  4FU5 A;  4QJW A;  4Q09 A;  2POW A;  1UGD A;  3OYS A;  1G53 A;  2GEH A;  1KWQ A;  1AVN A;  5SZ0 A;  1CAI A;  3ML5 A;  4Z1N A;  1CVD A;  3SBI A;  3MHO A;  2QO8 A;  5DOH A;  3BL0 A;  3N2P A;  1JV0 A;  3OIM A;  4K0T A;  3C7P A;  4WL4 A;  1RJ6 A;  3JXH C;  1BNU A;  4MLT A;  5SZ3 A;  5CJF A;  4ZX1 A;  1G52 A;  4N16 A;  3V5G A;  3MYQ A;  3D93 A;  5BRV A;  2ZNC A;  2FOU A;  4Q78 A;  3KWA A;  5DSP A;  4N0X B;  5BRU A;  3DVB A;  1ZFK A;  3M2Y A;  4QJO A;  4CNW A;  4CNX A;  3V3H B;  3BET A;  1RZA A;  1UGF A;  3T82 A;  1G1D A;  3BL1 A;  3HFP A;  1Y7W A;  5G01 A;  5DSI A;  3P4V A;  3FE4 A;  1ZSA A;  4QK3 A;  5DVX A;  3V2J A;  9CA2 A;  1I90 A;  4YYT A;  4XIX A;  3R17 B;  4YXO A;  3DD0 A;  5DSM A;  1V9I C;  2NMX A;  5SZ1 A;  3RZ8 A;  1RZE A;  2AW1 A;  4Q8Z A;  3V3G B;  3S9T A;  1KOQ A;  3HKN A;  4YGJ A;  3DCS A;  3S78 B;  3CA2 A;  4ITO A;  1G45 A;  3KNE A;  1IF9 A;  3M67 A;  4M2W A;  2VVA X;  1CVC A;  2NNV A;  1FSQ A;  2FNN A;  3OIK A;  1BNV A;  2OSM A;  3RGE A;  3M98 A;  5BNL A;  3OYQ A;  3CZV A;  1BN1 A;  1ZE8 A;  2OSF A;  4IWZ A;  4XIW A;  5FNG A;  4BF6 A;  2NXT A;  4Q87 A;  1ZH9 A;  2NXS A;  3ZNC A;  4E3D A;  5L6K A;  3RG4 A;  4QSA A;  3VBD A;  3RLD A;  1BZM A;  4HU1 A;  4Q99 A;  5G0C A;  5CAC A;  4QY3 A;  2NWZ A;  4YHA A;  3DC9 A;  1HCB A;  4L5V A;  3IGP A;  5A25 A;  5BYI A;  2X7S A;  3MHM A;  5JEG B;  3MNI A;  1FR7 A;  1TBT X;  3MZC A;  4KP5 A;  5JDV B;  2FNM A;  4Q6E A;  4YGK A;  1LG6 A;  5JQT A;  4K0Z A;  4RH2 A;  4HEY A;  5J8Z A;  2POV A;  3DBU A;  3M2Z A;  2WD3 A;  4MDL A;  4QJ0 A;  2F14 A;  1LGD A;  3TMJ A;  3ZP9 A;  2HKK A;  4Q0L A;  3IAI A;  3M1J A;  4TWL A;  1G6V A;  1ZSC A;  1UGC A;  2CBC A;  1HUG A;  2HL4 A;  5FNI A;  1TH9 A;  3DD8 A;  3M1K A;  1Z9Y A;  1RAY A;  4KNN A;  1TG9 A;  3HLJ A;  1I91 A;  8CA2 A;  1UGG A;  4E3H A;  1CNK A;  3RYZ A;  1CIM A;  3DCC A;  2WEH A;  4QSJ A;  2NN1 A;  3D92 A;  1CCT A;  4CNR A;  1CZM A;  3KOI A;  5JQ0 A;  3T85 A;  2HNC A;  1BNM A;  3DA2 A;  3OIL A;  5EKH A;  4TWM A;  3IBL A;  3PO6 A;  3P5A A;  4CA2 A;  1UGE A;  3TVO X;  2QOA A;  5JG5 B;  4Q8Y A;  1BV3 A;  3DVC A;  4R59 A;  5HPJ A;  4HEZ A;  5C8I A;  1CAK A;  3U7C A;  4YGL A;  1BNT A;  2AX2 A;  3M14 A;  4MTY A;  5FL4 A;  1CAM A;  1EOU A;  5EIJ A;  5CLU A;  1G48 A;  4JSZ A;  3N3J A;  5FLR A;  1FSR A;  1G3Z A;  5DSN A;  1I9L A;  1CCU A;  5AML A;  4DZ7 A;  3PJJ A;  4JSA A;  5AMG A;  3S76 A;  1UGB A;  3PYK A;  1YO0 A;  1CNW A;  4HF3 A;  5FLP A;  2NWP A;  4Q06 A;  1RAZ A;  4QJP A;  5FLO A;  1BN3 A;  4ZWY A;  3EFT A;  1Z97 A;  3T5U A;  3TVN X;  2NNO A;  4MDG A;  1FQM A;  3R16 A;  2CBE A;  5FLS A;  1CNH A;  4X5S A;  4Q83 A;  3Q31 A;  5SZ4 A;  4WUQ A;  1CNB A;  4Z1E A;  3W6I A;  5SZ5 A;  4MLX A;  4QJM A;  4R5B A;  3DV7 A;  4PQ7 A;  1UGA A;  4RFC A;  4BF1 A;  4XFW A;  3DVD A;  4KUV A;  3S71 B;  4QTL A;  2VVB X;  3F4X A;  4BCW A;  5JGS B;  2X7U A;  3CAJ A;  2NWY A;  5FDI A;  1G4O A;  2FNK A;  3RYV B;  4QIY A;  4M2R A;  3S74 B;  1Z93 A;  3L14 A;  4Q07 A;  4C3T A;  1ZFQ A;  1YDD A;  3RJ7 A;  1KOP A;  3D0N A;  1IF6 A;  2FMZ A;  1YDB A;  4Q81 A;  1BCD A;  5EHV A;  4COQ A;  5JEH B;  2FOQ A;  1F2W A;  1BNN A;  2WEJ A;  4FVO A;  5G0B A;  4Z0Q A;  3M2N A;  2EZ7 A;  5FNJ A;  1A42 A;  3MMF A;  1FQL A;  3QYK A;  4ITP A;  1FLJ A;  3T83 A;  4JS6 A;  5DOG A;  5JG3 B;  5EH7 A;  3K7K A;  1H4N A;  3M5E A;  5EHE A;  4L5U A;  3FFP X;  3NJ9 A;  3DC3 A;  3UYN A;  2CBD A;  4HEW A;  4JSS A;  3F8E A;  4YGN A;  1CAL A;  3P3J A;  2WEG A;  4YGF A;  1CVB A;  1CIL A;  4Y0J A;  5SZ7 A;  4KNM A;  4QIZ A;  2IT4 A;  1I9M A;  5FLT A;  2FW4 A;  5DSL A;  2O4Z A;  2H4N A;  4YVY A;  5G03 A;  1CVA A;  4MO8 A;  5JES B;  1JD0 A;  3HKQ A;  1CAO A;  2CAB A;  3KKX A;  4FL7 A;  3OKV A;  4MDM A;  4Q7P A;  2Q1B A;  3P55 A;  2EU2 A;  3RZ1 B;  5E2M A;  1LG5 A;  3IBN A;  2NNS A;  1TEQ X;  2ILI A;  4KNJ A;  1RZB A;  4KNI A;  4Q8X A;  1H9Q A;  1I9N A;  1CAZ A;  2FOY A;  4Q90 A;  1J9W A;  1YO1 A;  5AMD A;  4FVN A;  2CBA A;  1CVE A;  3T84 A;  4HBA A;  1TE3 X;  1FQR A;  1I8Z A;  4WR7 A;  1CNG A;  4E49 A;  5DRS A;  2W2J A;  4KV0 A;  1MOO A;  1ZGE A;  4E4A A;  3RZ0 B;  1TG3 A;  4Z1J A;  1BNQ A;  1URT A;  1XQ0 A;  2FMG A;  3IEO A;  4M2V A;  4Q49 A;  4R5A A;  1G0F A;  2NXR A;  3SAX A;  3M1Q A;  4CNV A; 
#chains in the Genus database with same CATH homology
 3RZ7 A;  1CNJ A;  5FNH A;  1YDC A;  3NB5 A;  5JGT B;  4KUW A;  3CYU A;  1DMX A;  4Q7S A;  2QP6 A;  1OQ5 A;  4K1Q A;  4YXI A;  4QSB A;  4WUP A;  4DZ9 A;  3K34 A;  5FNK A;  1CVH A;  3DAZ A;  1DMY A;  3B4F A;  1CVF A;  3SBH A;  4FRC A;  3MNH A;  5E2N A;  3HKU A;  5E5R A;  3P5L A;  2POU A;  2HFW A;  1ZSB A;  4UOV A;  4QSI A;  5LMD A;  3MNK A;  1I9O A;  1BNW A;  4CAC A;  1MUA A;  1AM6 A;  3M96 A;  4YX4 A;  4QK1 A;  4E5Q A;  3P44 A;  1CNX A;  4WW6 A;  1LUG A;  3ML2 A;  4ILX A;  4YWP A;  5A6H A;  5FL5 A;  1HEA A;  4JSW A;  4ZWX A;  1YDA A;  4PYX A;  1OKM A;  4G7A A;  1CAJ A;  1H9N A;  3HKT A;  7CA2 A;  4XZ5 A;  1IF4 A;  3KLD B;  4WW8 A;  1TEU X;  3P3H A;  4RUX A;  3F7B A;  3RYY A;  5FLQ A;  5SZ6 A;  1AZM A;  1KEQ A;  2NNG A;  5DSJ A;  4Z1K A;  4YXU A;  3M2X A;  3M5S A;  3W6H A;  3NI5 A;  1DCA A;  1THK A;  1G0E A;  3MHC A;  3MDZ A;  4K0S A;  4LHI A;  3LXE A;  1TTM A;  5SZ2 A;  5EH5 A;  3U47 A;  3S97 A;  3U45 X;  3MHI A;  3OKU A;  2HOC A;  5EOI A;  1ZNC A;  4KUY A;  3MNA A;  3SAP A;  4QEF A;  4ZWZ A;  2NWO A;  2Q38 A;  1CNY A;  1BN4 A;  1RZC A;  1CAH A;  3KS3 A;  3D8W A;  1XPZ A;  4L5W A;  3U3A X;  4PXX A;  4ETQ C;  12CA A;  1OKN A;  4RUZ A;  4Q08 A;  1IF7 A;  4RIV A;  5EZT X;  3K2F A;  1CA2 A;  2CA2 A;  4ZWI A;  1BIC A;  1HEB A;  3JXF A;  5E2R A;  3MHL A;  5EKJ A;  1FR4 A;  3RG3 A;  1OKL A;  4LU3 A;  5IPZ A;  5EHW A;  1HEC A;  4ZAO A;  3MWO A;  4XE1 A;  3HS4 A;  3N0N A;  3RYJ B;  3F7U A;  3V3I B;  3MNU A;  1RZD A;  3FW3 A;  1YO2 A;  1RJ5 A;  4FIK A;  1CA3 A;  4E9O X;  2CBB A;  3P58 A;  4RIU A;  5DSK A;  5JEP B;  2Q1Q A;  3M5T A;  5EKM A;  4CQ0 A;  3V2M A;  5FNM A;  3M1W A;  1DCB A;  4Q9Y A;  1HVA A;  2X7T A;  4HT0 A;  3V3F A;  1KWR A;  4PYY A;  5L3O A;  5DSO A;  4G0C A;  5DSR A;  4RN4 A;  1CAY A;  2GD8 A;  3RYX B;  3IBI A;  3N4B A;  5BRW A;  1CNI A;  4ZX0 A;  1CRM A;  4HT2 A;  3D9Z A;  4KAP A;  5DSQ A;  3S72 B;  2ABE A;  1XEV A;  5FDC A;  3S77 B;  1G4J A;  4RFD A;  5EH8 A;  1CAN A;  3S73 B;  4QK2 A;  5E2S A;  2FOS A;  1HED A;  3GZ0 A;  4PZH A;  3UYQ A;  4Q7W A;  4FPT A;  3S8X A;  2EU3 A;  3S75 B;  3T5Z A;  3MNJ A;  5FL6 A;  1ZGF A;  1G46 A;  1CIN A;  4K13 A;  1LZV A;  1G54 A;  1HUH A;  3V3J A;  2WD2 A;  4GL1 X;  3M40 A;  1CRA A;  1IF5 A;  2HD6 A;  4Q6D A;  5E28 A;  3V7X A;  5CA2 A;  4IDR X;  1JCZ A;  3KON A;  3OY0 A;  5E2K A;  4LP6 A;  1FSN A;  2H15 A;  4KP8 A;  1V9E A;  1CCS A;  3M04 A;  1I9Q A;  2FOV A;  4Q7V A;  1IF8 A;  1TB0 X;  6CA2 A;  4QJX A;  1I9P A;  1FQN A;  4E3G A;  1HCA A;  3IBU A;  3EFI A;  1T9N A;  3B1B A;  3KOK A;  4E3F A;  2NN7 A;  3JXG A;  3M3X A;  4M2U A;  3DCW A;  2WEO A;  1CNC A;  5FNL A;  4RUY A;  3RZ5 A;  1XEG A;  3KIG A;  5E5U A;  4FU5 A;  4QJW A;  4Q09 A;  2POW A;  1UGD A;  3OYS A;  1G53 A;  2GEH A;  1KWQ A;  1AVN A;  5SZ0 A;  1CAI A;  3ML5 A;  4Z1N A;  1CVD A;  3SBI A;  3MHO A;  2QO8 A;  5DOH A;  3BL0 A;  3N2P A;  1JV0 A;  3OIM A;  4K0T A;  3C7P A;  4WL4 A;  1RJ6 A;  3JXH C;  1BNU A;  4MLT A;  5SZ3 A;  5CJF A;  4ZX1 A;  1G52 A;  4N16 A;  3V5G A;  3MYQ A;  3D93 A;  5BRV A;  2ZNC A;  2FOU A;  4Q78 A;  3KWA A;  5DSP A;  4N0X B;  5BRU A;  3DVB A;  1ZFK A;  3M2Y A;  4QJO A;  4CNW A;  4CNX A;  3V3H B;  3BET A;  1RZA A;  1UGF A;  3T82 A;  1G1D A;  3BL1 A;  3HFP A;  1Y7W A;  5G01 A;  5DSI A;  3P4V A;  3FE4 A;  1ZSA A;  4QK3 A;  5DVX A;  3V2J A;  9CA2 A;  1I90 A;  4YYT A;  4XIX A;  3R17 B;  4YXO A;  3DD0 A;  5DSM A;  1V9I C;  2NMX A;  5SZ1 A;  3RZ8 A;  1RZE A;  2AW1 A;  4Q8Z A;  3V3G B;  3S9T A;  1KOQ A;  3HKN A;  4YGJ A;  3DCS A;  3S78 B;  3CA2 A;  4ITO A;  1G45 A;  3KNE A;  1IF9 A;  3M67 A;  4M2W A;  2VVA X;  1CVC A;  2NNV A;  1FSQ A;  2FNN A;  3OIK A;  1BNV A;  2OSM A;  3RGE A;  3M98 A;  5BNL A;  3OYQ A;  3CZV A;  1BN1 A;  1ZE8 A;  2OSF A;  4IWZ A;  4XIW A;  5FNG A;  4BF6 A;  2NXT A;  4Q87 A;  1ZH9 A;  2NXS A;  3ZNC A;  4E3D A;  5L6K A;  3RG4 A;  4QSA A;  3VBD A;  3RLD A;  1BZM A;  4HU1 A;  4Q99 A;  5G0C A;  5CAC A;  4QY3 A;  2NWZ A;  4YHA A;  3DC9 A;  1HCB A;  4L5V A;  3IGP A;  5A25 A;  5BYI A;  2X7S A;  3MHM A;  5JEG B;  3MNI A;  1FR7 A;  1TBT X;  3MZC A;  4KP5 A;  5JDV B;  2FNM A;  4Q6E A;  4YGK A;  1LG6 A;  5JQT A;  4K0Z A;  4RH2 A;  4HEY A;  5J8Z A;  2POV A;  3DBU A;  3M2Z A;  2WD3 A;  4MDL A;  4QJ0 A;  2F14 A;  1LGD A;  3TMJ A;  3ZP9 A;  2HKK A;  4Q0L A;  3IAI A;  3M1J A;  4TWL A;  1G6V A;  1ZSC A;  1UGC A;  2CBC A;  1HUG A;  2HL4 A;  5FNI A;  1TH9 A;  3DD8 A;  3M1K A;  1Z9Y A;  1RAY A;  4KNN A;  1TG9 A;  3HLJ A;  1I91 A;  8CA2 A;  1UGG A;  4E3H A;  1CNK A;  3RYZ A;  1CIM A;  3DCC A;  2WEH A;  4QSJ A;  2NN1 A;  3D92 A;  1CCT A;  4CNR A;  1CZM A;  3KOI A;  5JQ0 A;  3T85 A;  2HNC A;  1BNM A;  3DA2 A;  3OIL A;  5EKH A;  4TWM A;  3IBL A;  3PO6 A;  3P5A A;  4CA2 A;  1UGE A;  3TVO X;  2QOA A;  5JG5 B;  4Q8Y A;  1BV3 A;  3DVC A;  4R59 A;  5HPJ A;  4HEZ A;  5C8I A;  1CAK A;  3U7C A;  4YGL A;  1BNT A;  2AX2 A;  3M14 A;  4MTY A;  5FL4 A;  1CAM A;  1EOU A;  5EIJ A;  5CLU A;  1G48 A;  4JSZ A;  3N3J A;  5FLR A;  1FSR A;  1G3Z A;  5DSN A;  1I9L A;  1CCU A;  5AML A;  4DZ7 A;  3PJJ A;  4JSA A;  5AMG A;  3S76 A;  1UGB A;  3PYK A;  1YO0 A;  1CNW A;  4HF3 A;  5FLP A;  2NWP A;  4Q06 A;  1RAZ A;  4QJP A;  5FLO A;  1BN3 A;  4ZWY A;  3EFT A;  1Z97 A;  3T5U A;  3TVN X;  2NNO A;  4MDG A;  1FQM A;  3R16 A;  2CBE A;  5FLS A;  1CNH A;  4X5S A;  4Q83 A;  3Q31 A;  5SZ4 A;  4WUQ A;  1CNB A;  4Z1E A;  3W6I A;  5SZ5 A;  4MLX A;  4QJM A;  4R5B A;  3DV7 A;  4PQ7 A;  1UGA A;  4RFC A;  4BF1 A;  4XFW A;  3DVD A;  4KUV A;  3S71 B;  4QTL A;  2VVB X;  3F4X A;  4BCW A;  5JGS B;  2X7U A;  3CAJ A;  2NWY A;  5FDI A;  1G4O A;  2FNK A;  3RYV B;  4QIY A;  4M2R A;  3S74 B;  1Z93 A;  3L14 A;  4Q07 A;  4C3T A;  1ZFQ A;  1YDD A;  3RJ7 A;  1KOP A;  3D0N A;  1IF6 A;  2FMZ A;  1YDB A;  4Q81 A;  1BCD A;  5EHV A;  4COQ A;  5JEH B;  2FOQ A;  1F2W A;  1BNN A;  2WEJ A;  4FVO A;  5G0B A;  4Z0Q A;  3M2N A;  2EZ7 A;  5FNJ A;  1A42 A;  3MMF A;  1FQL A;  3QYK A;  4ITP A;  1FLJ A;  3T83 A;  4JS6 A;  5DOG A;  5JG3 B;  5EH7 A;  3K7K A;  1H4N A;  3M5E A;  5EHE A;  4L5U A;  3FFP X;  3NJ9 A;  3DC3 A;  3UYN A;  2CBD A;  4HEW A;  4JSS A;  3F8E A;  4YGN A;  1CAL A;  3P3J A;  2WEG A;  4YGF A;  1CVB A;  1CIL A;  4Y0J A;  5SZ7 A;  4KNM A;  4QIZ A;  2IT4 A;  1I9M A;  5FLT A;  2FW4 A;  5DSL A;  2O4Z A;  2H4N A;  4YVY A;  5G03 A;  1CVA A;  4MO8 A;  5JES B;  1JD0 A;  3HKQ A;  1CAO A;  2CAB A;  3KKX A;  4FL7 A;  3OKV A;  4MDM A;  4Q7P A;  2Q1B A;  3P55 A;  2EU2 A;  3RZ1 B;  5E2M A;  1LG5 A;  3IBN A;  2NNS A;  1TEQ X;  2ILI A;  4KNJ A;  1RZB A;  4KNI A;  4Q8X A;  1H9Q A;  1I9N A;  1CAZ A;  2FOY A;  4Q90 A;  1J9W A;  1YO1 A;  5AMD A;  4FVN A;  2CBA A;  1CVE A;  3T84 A;  4HBA A;  1TE3 X;  1FQR A;  1I8Z A;  4WR7 A;  1CNG A;  4E49 A;  5DRS A;  2W2J A;  4KV0 A;  1MOO A;  1ZGE A;  4E4A A;  3RZ0 B;  1TG3 A;  4Z1J A;  1BNQ A;  1URT A;  1XQ0 A;  2FMG A;  3IEO A;  4M2V A;  4Q49 A;  4R5A A;  1G0F A;  2NXR A;  3SAX A;  3M1Q A;  4CNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...