3DLLJ

The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect trna positioning
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
136
structure length
136
Chain Sequence
KRTKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYIRIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLPIQTKMVKREVYDEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
pubmed doi rcsb
molecule keywords rRNA-23S ribosomal RNA
molecule tags Ribosome
total genus 15
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00252 Ribosomal_L16 Ribosomal protein L16p/L10e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1170.10 Alpha Beta Alpha-Beta Complex Aldehyde Oxidoreductase; domain 3 Ribosomal protein L10e/L16 3dllJ01
4WFAJ 2PA2A 1M1KJ 3CXCH 3CCJH 1M90J 2OTJH 2QA4H 3G4SH 1Y69K 1VQ9H 4WF9J 5JVHJ 1Q82J 1WKIA 1YJNH 1Q86J 1NJIJ 5DM7J 5HL7J 1K8AJ 1S72H 4WCEJ 1N8RJ 3CPWH 5JVGJ 4UY8M 3CCUH 3CCLH 1VQ6H 3PIOJ 1QVGH 2QEXH 4WFNJ 1K9MJ 1QVFH 1KC8J 5GAGN 1YI2H 3G71H 5GAHN 2ZJRJ 1KQSH 1VQNH 1VQOH 3CCEH 3J7ZM 4IOCJ 2OTLH 5AN9F 3I56H 4U67J 1VQMH 3CF5J 1K73J 3OW2H 1JJ2H 1VQ7H 3CCSH 1VQ8H 3CCVH 5GADN 1YJWH 1Q81J 5GAEN 1YITH 1VQLH 3I55H 3CCRH 3DLLJ 3CMAH 3CC4H 1W2BH 1YIJH 3G6EH 1VQ5H 3CMEH 3CD6H 3PIPJ 4IO9J 1YJ9H 3CCMH 3CCQH 5MLCO 1VQPH 1YHQH 2ZJPJ 5H1SO 5DM6J 3CC7H 1KD1J 1VQKH 3CC2H 1Q7YJ 2ZJQJ 1VQ4H 4IOAJ 4WFBJ
chains in the Genus database with same CATH superfamily
1QPOA 3VMMA 4WFAJ 2PA2A 4GA4A 3CXCH 1M1KJ 3CCJH 1BRWA 1M90J 2OTJH 4X46A 3NVWC 2QA4H 5HUOA 1OTPA 3G4SH 3NVVC 4C7YA 1Y69K 1V97A 1FIQC 4XR5A 1VQ9H 4WF9J 5JVHJ 1VDVA 1FMAE 5HUPA 1Q82J 1WKIA 2I14A 1YJNH 1Q86J 5DM7J 1NJIJ 4LHMA 3C2FA 4GA5A 5HL7J 3NS1C 1K8AJ 3C2RA 3GNNA 5AYZA 1S72H 2DSJA 3AMZA 1YTDA 4WCEJ 1N8RJ 4KWVA 5JVGJ 3CPWH 4UY8M 3L0GA 1ZXIB 3CCUH 1YTKA 1DGJA 4US9A 3CCLH 1QPQA 1VQ6H 3PIOJ 1QVGH 2QEXH 4WFNJ 1AZYA 1QPNA 1K9MJ 1QVFH 1KC8J 2W3SB 1JRPB 1N5WB 3PAJA 4GA6A 5GAGN 1YI2H 3G71H 5GAHN 2I1OA 2WK6A 2ZJRJ 1FFUB 4C80A 3L4PA 4I9AA 3TQVA 1KQSH 1VQNH 5MPOC 3NRZC 3C2EA 1VQOH 3CCEH 3J7ZM 1FFVB 5AYYA 4IOCJ 2OTLH 3AN1A 4C7ZA 5AN9F 3I56H 4U67J 1VQMH 4AP8A 2B7PA 3CF5J 1K73J 3OW2H 3EUB4 1JJ2H 1VQ7H 3NVZC 3CCSH 1WYGA 1VQ8H 1UOUA 3WNZA 1FO4A 4ZOHA 2E3TA 3SR6C 1FM0E 3WO1A 5GADN 3CCVH 1SB3A 1YJWH 1VLBA 3FAHA 4EAFA 2J0FA 5GAEN 1Q81J 3H5QA 1YITH 1VQLH 1N5XA 2OMDA 2B7QA 3I55H 2JBMA 3CCRH 3DLLJ 3CMAH 3C2OA 3CC4H 5HULA 1YTEA 1N61B 2Q5WE 4US8A 5AYXA 1W2BH 3ETRC 3WO0A 1YIJH 3G6EH 2W3RB 3AM9A 3NVYC 1VQ5H 3CMEH 3CD6H 3B9JC 3PIPJ 3RPFA 2QIEA 4EADA 3CCMH 4IO9J 3BIIE 1YJ9H 2W54B 1QPRA 4YYYA 1O4UA 5MLCO 3CCQH 1VQPH 1X1OA 1YHQH 5EY3A 1QAPA 4YEKA 2ZJPJ 1JROB 5H1SO 5DM6J 3CC7H 1KD1J 1VQKH 4KWWA 3CC2H 1N63B 1NVIE 5EP8A 1Q7YJ 1N62B 2ZJQJ 3FC4A 1VQ4H 1SIJA 1NVJA 2B7NA 1N60B 2W55B 2TPTA 1RM6A 4IOAJ 2WK5A 2WP4A 4WFBJ 3C2VA 4USAA
chains in the Genus database with same CATH topology
4WFAJ 2PA2A 1M1KJ 3CXCH 3CCJH 1M90J 2OTJH 2QA4H 3G4SH 1Y69K 1VQ9H 4WF9J 5JVHJ 1Q82J 1WKIA 1YJNH 1Q86J 1NJIJ 5DM7J 5HL7J 1K8AJ 1S72H 4WCEJ 1N8RJ 3CPWH 5JVGJ 4UY8M 3CCUH 3CCLH 1VQ6H 3PIOJ 1QVGH 2QEXH 4WFNJ 1K9MJ 1QVFH 1KC8J 5GAGN 1YI2H 3G71H 5GAHN 2ZJRJ 1KQSH 1VQNH 1VQOH 3CCEH 3J7ZM 4IOCJ 2OTLH 5AN9F 3I56H 4U67J 1VQMH 3CF5J 1K73J 3OW2H 1JJ2H 1VQ7H 3CCSH 1VQ8H 3CCVH 5GADN 1YJWH 1Q81J 5GAEN 1YITH 1VQLH 3I55H 3CCRH 3DLLJ 3CMAH 3CC4H 1W2BH 1YIJH 3G6EH 1VQ5H 3CMEH 3CD6H 3PIPJ 4IO9J 1YJ9H 3CCMH 3CCQH 5MLCO 1VQPH 1YHQH 2ZJPJ 5H1SO 5DM6J 3CC7H 1KD1J 1VQKH 3CC2H 1Q7YJ 2ZJQJ 1VQ4H 4IOAJ 4WFBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFA J;  2PA2 A;  1M1K J;  3CXC H;  3CCJ H;  1M90 J;  2OTJ H;  2QA4 H;  3G4S H;  1Y69 K;  1VQ9 H;  4WF9 J;  5JVH J;  1Q82 J;  1WKI A;  1YJN H;  1Q86 J;  1NJI J;  5DM7 J;  5HL7 J;  1K8A J;  1S72 H;  4WCE J;  1N8R J;  3CPW H;  5JVG J;  4UY8 M;  3CCU H;  3CCL H;  1VQ6 H;  3PIO J;  1QVG H;  2QEX H;  4WFN J;  1K9M J;  1QVF H;  1KC8 J;  5GAG N;  1YI2 H;  3G71 H;  5GAH N;  2ZJR J;  1KQS H;  1VQN H;  1VQO H;  3CCE H;  3J7Z M;  4IOC J;  2OTL H;  5AN9 F;  3I56 H;  4U67 J;  1VQM H;  3CF5 J;  1K73 J;  3OW2 H;  1JJ2 H;  1VQ7 H;  3CCS H;  1VQ8 H;  3CCV H;  5GAD N;  1YJW H;  1Q81 J;  5GAE N;  1YIT H;  1VQL H;  3I55 H;  3CCR H;  3DLL J;  3CMA H;  3CC4 H;  1W2B H;  1YIJ H;  3G6E H;  1VQ5 H;  3CME H;  3CD6 H;  3PIP J;  4IO9 J;  1YJ9 H;  3CCM H;  3CCQ H;  5MLC O;  1VQP H;  1YHQ H;  2ZJP J;  5H1S O;  5DM6 J;  3CC7 H;  1KD1 J;  1VQK H;  3CC2 H;  1Q7Y J;  2ZJQ J;  1VQ4 H;  4IOA J;  4WFB J; 
#chains in the Genus database with same CATH topology
 1QPO A;  3VMM A;  4WFA J;  2PA2 A;  4GA4 A;  3CXC H;  1M1K J;  3CCJ H;  1BRW A;  1M90 J;  2OTJ H;  4X46 A;  3NVW C;  2QA4 H;  5HUO A;  1OTP A;  3G4S H;  3NVV C;  4C7Y A;  1Y69 K;  1V97 A;  1FIQ C;  4XR5 A;  1VQ9 H;  4WF9 J;  5JVH J;  1VDV A;  1FMA E;  5HUP A;  1Q82 J;  1WKI A;  2I14 A;  1YJN H;  1Q86 J;  5DM7 J;  1NJI J;  4LHM A;  3C2F A;  4GA5 A;  5HL7 J;  3NS1 C;  1K8A J;  3C2R A;  3GNN A;  5AYZ A;  1S72 H;  2DSJ A;  3AMZ A;  1YTD A;  4WCE J;  1N8R J;  4KWV A;  5JVG J;  3CPW H;  4UY8 M;  3L0G A;  1ZXI B;  3CCU H;  1YTK A;  1DGJ A;  4US9 A;  3CCL H;  1QPQ A;  1VQ6 H;  3PIO J;  1QVG H;  2QEX H;  4WFN J;  1AZY A;  1QPN A;  1K9M J;  1QVF H;  1KC8 J;  2W3S B;  1JRP B;  1N5W B;  3PAJ A;  4GA6 A;  5GAG N;  1YI2 H;  3G71 H;  5GAH N;  2I1O A;  2WK6 A;  2ZJR J;  1FFU B;  4C80 A;  3L4P A;  4I9A A;  3TQV A;  1KQS H;  1VQN H;  5MPO C;  3NRZ C;  3C2E A;  1VQO H;  3CCE H;  3J7Z M;  1FFV B;  5AYY A;  4IOC J;  2OTL H;  3AN1 A;  4C7Z A;  5AN9 F;  3I56 H;  4U67 J;  1VQM H;  4AP8 A;  2B7P A;  3CF5 J;  1K73 J;  3OW2 H;  3EUB 4;  1JJ2 H;  1VQ7 H;  3NVZ C;  3CCS H;  1WYG A;  1VQ8 H;  1UOU A;  3WNZ A;  1FO4 A;  4ZOH A;  2E3T A;  3SR6 C;  1FM0 E;  3WO1 A;  5GAD N;  3CCV H;  1SB3 A;  1YJW H;  1VLB A;  3FAH A;  4EAF A;  2J0F A;  5GAE N;  1Q81 J;  3H5Q A;  1YIT H;  1VQL H;  1N5X A;  2OMD A;  2B7Q A;  3I55 H;  2JBM A;  3CCR H;  3DLL J;  3CMA H;  3C2O A;  3CC4 H;  5HUL A;  1YTE A;  1N61 B;  2Q5W E;  4US8 A;  5AYX A;  1W2B H;  3ETR C;  3WO0 A;  1YIJ H;  3G6E H;  2W3R B;  3AM9 A;  3NVY C;  1VQ5 H;  3CME H;  3CD6 H;  3B9J C;  3PIP J;  3RPF A;  2QIE A;  4EAD A;  3CCM H;  4IO9 J;  3BII E;  1YJ9 H;  2W54 B;  1QPR A;  4YYY A;  1O4U A;  5MLC O;  3CCQ H;  1VQP H;  1X1O A;  1YHQ H;  5EY3 A;  1QAP A;  4YEK A;  2ZJP J;  1JRO B;  5H1S O;  5DM6 J;  3CC7 H;  1KD1 J;  1VQK H;  4KWW A;  3CC2 H;  1N63 B;  1NVI E;  5EP8 A;  1Q7Y J;  1N62 B;  2ZJQ J;  3FC4 A;  1VQ4 H;  1SIJ A;  1NVJ A;  2B7N A;  1N60 B;  2W55 B;  2TPT A;  1RM6 A;  4IOA J;  2WK5 A;  2WP4 A;  4WFB J;  3C2V A;  4USA A; 
#chains in the Genus database with same CATH homology
 4WFA J;  2PA2 A;  1M1K J;  3CXC H;  3CCJ H;  1M90 J;  2OTJ H;  2QA4 H;  3G4S H;  1Y69 K;  1VQ9 H;  4WF9 J;  5JVH J;  1Q82 J;  1WKI A;  1YJN H;  1Q86 J;  1NJI J;  5DM7 J;  5HL7 J;  1K8A J;  1S72 H;  4WCE J;  1N8R J;  3CPW H;  5JVG J;  4UY8 M;  3CCU H;  3CCL H;  1VQ6 H;  3PIO J;  1QVG H;  2QEX H;  4WFN J;  1K9M J;  1QVF H;  1KC8 J;  5GAG N;  1YI2 H;  3G71 H;  5GAH N;  2ZJR J;  1KQS H;  1VQN H;  1VQO H;  3CCE H;  3J7Z M;  4IOC J;  2OTL H;  5AN9 F;  3I56 H;  4U67 J;  1VQM H;  3CF5 J;  1K73 J;  3OW2 H;  1JJ2 H;  1VQ7 H;  3CCS H;  1VQ8 H;  3CCV H;  5GAD N;  1YJW H;  1Q81 J;  5GAE N;  1YIT H;  1VQL H;  3I55 H;  3CCR H;  3DLL J;  3CMA H;  3CC4 H;  1W2B H;  1YIJ H;  3G6E H;  1VQ5 H;  3CME H;  3CD6 H;  3PIP J;  4IO9 J;  1YJ9 H;  3CCM H;  3CCQ H;  5MLC O;  1VQP H;  1YHQ H;  2ZJP J;  5H1S O;  5DM6 J;  3CC7 H;  1KD1 J;  1VQK H;  3CC2 H;  1Q7Y J;  2ZJQ J;  1VQ4 H;  4IOA J;  4WFB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...