3ER8A

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
288
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 89
structure length 288
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3er8A00
5EHGA 5KQSA 4CXMA 3I53A 3WSTA 5CIYA 3O31A 4AUKA 2OB2A 4E30A 2OPBA 4WVLA 5DTMA 3T7TA 3P9IA 4DCGA 1H1DA 1I9GA 2P7IA 3OFKA 4X60A 4XUEA 1G60A 1KPGA 2IPXA 1F38A 3BWCA 4CWAA 1JTEA 3AJDA 1RI2A 2G70A 4PCAA 5HIJA 2CKDA 3LPMA 3PFGA 3FPFA 1NE2A 4ER6A 2XYRA 2PV0A 1JQDA 5D1HA 1VP9A 4ER0A 3LSTA 2GS9A 2NP7A 1XCLA 4FZVA 3P71T 4PONA 2EX4A 3KQTA 3HCDA 2G72A 3HCBA 5IH3A 4OBWA 8MHTA 2LD4A 1F3LA 3FUUA 3KKZA 5CVUA 2JHAA 1ZQ9A 5C1IA 3UJ8A 1KPHA 2PLWA 2YXLA 3SSOA 3EVEA 4B17A 2P41A 5LQAA 1PRYA 5EMMA 1RI4A 3M4XA 4BP3A 3HP7A 3R24A 2H00A 1KHHA 3HVJA 3LBFA 1ZKDA 2O07A 3EMBA 4QVKA 3G7UA 3GGDA 3P2EA 1UWVA 4UOEA 5F2NA 1XDSA 2Z6QA 3UA4A 1XDUA 1YF3A 3GRVA 2G1PA 1JG3A 5EKXA 1FJXA 4E32A 3MERA 2ZSUA 3KQVA 4KVZA 2H1RA 4DMGA 3DOUA 4XUCA 4RTJA 1YB2A 3BGDA 4KWCA 3KR1A 3M6UA 4DF3A 2ZIFA 3JWHA 2FCAA 3HTXA 4GUAA 4PNEA 3GCZA 3MQ2A 3RW9A 2QYOA 5HOQA 3JWJA 2IP2A 2XYVA 2AN5A 4HSGA 3FRIA 5H02A 1EIZA 2NXCA 1RJGA 2NXJA 4FSXA 4QTTB 3ER9A 5EEHA 3C0KA 4RTOA 3EEOA 2I9KA 2FPOA 4MHTA 2YR0A 1KP9A 2UZ4A 2WK1A 5LQRA 2NYUA 2PXCA 5EEGA 2Y1WA 3B89A 2I7CA 5F2KA 5DTRA 2NP6A 3MCZA 1X1CA 1KR5A 4YUWA 3OE5A 1YZ3A 3M33A 1U2ZA 1HNNA 1KXZA 4OA5A 4P7FA 4PCLA 5EG5A 3SR4A 4C06A 4RTPA 1TPYA 1B42A 2ZBPA 2HMYB 1NBHA 2ORED 2K4MA 1QAQA 4OX9Y 2P35A 4RV9A 2BM9A 2PXXA 4X61A 3P97A 1G55A 5JUWA 1P1BA 2I6GA 4QPNA 5DXAA 2IH4A 4V0QA 3FZGA 2FRXA 4X41A 1VLMA 3A25A 1G8AA 3LECA 4QQNA 3SX0A 5DLYA 3NJRA 5HIMA 3SSNA 5F2OA 2VZ9A 1VQ1A 4LWOA 4CKCA 3CBGA 3KPJA 3EVBA 3BWBA 5E1OA 4EMSA 5C9ZA 5EGSA 9MHTA 4DM3A 2OKCA 2KW5A 2PX8A 3GXOA 1P1CA 3S68A 3C6MA 3EVAA 5CCBA 4YUXA 3KPYA 3FYDA 3LBYA 2XBMA 3T7RA 3MAGA 2QM3A 3GRZA 1NT2A 2PWYA 3R0QA 4R8RA 3UJCA 1NW5A 3DTNA 4KIGA 3P2KA 1JTFA 4R05A 3UJ9A 4RTQA 4IWNA 4X63A 1WS6A 3KR0A 4NECA 4ISCA 3KQQA 3L8DA 3C3YA 4AZWA 2V7EA 2ZIEA 2ZTHA 4DCMA 5FADA 4LWPA 4RTNA 2EG5A 3UWPA 2AOVA 3I64A 3VC2A 2UYHA 3EVCA 3C6KA 1P39A 4GOOD 4HTFB 1SQFA 4CKEA 1XDZA 1N7JA 2QRVA 4IKPA 1TW3A 4X1OA 5DX1A 3MCTA 5EKUA 5GP1A 4KDCA 5ERGB 3KQWA 1YZHA 5HILA 2PWPA 3OZRA 2VP3A 3FTCA 3FPGA 4E2ZA 4RWZA 1ORIA 5ICEA 2NXNA 4RVGA 5FTWA 2FK8A 3R6TA 4HRAA 1IY9A 4M7RA 5FULA 4PIMA 2OXTA 5K01A 3FTDA 4QPPA 1QAMA 2P1DA 2QY6A 3PX2A 4MWZA 5DSXA 2UYCA 4HGZA 3I58A 5ICCA 1JG2A 1XCJA 2EJTA 3CVOA 3GRUA 1V39A 4PGHA 5EMKA 5E1MA 4DQ0A 3UJ6A 5JR3A 5GINE 4P58A 3PB3A 1L1EA 4EKIA 3UJDA 5KQRA 1JSXA 1UFKA 2JHPA 3IHTA 2G8NA 4GBED 4RVDA 1XTPA 5LR6A 3FUWA 5CCXA 5M5BA 1AF7A 2PX2A 4JXJA 1FBNA 2ZBRA 3EGIA 1AQJA 3UJBA 3DXZA 3P8ZA 1KIAA 3G8BA 5ICGA 5HIIA 2IFTA 2VDUE 2CMGA 2EFJA 2ESRA 2O0LA 3G2QA 3NW9A 3OE4A 4G56A 4P7KA 4R8SA 4C03A 2ZULA 4ER7A 2OZVA 5GM2A 3NVMB 5FHQA 2XYQA 5T6BA 3G2OA 2B9EA 2OY0A 2PSSA 5DX8A 2JH8A 3EVGA 1BKYA 3A27A 2GH1A 3T7SA 3O4FA 5T64A 4Z2YA 5GOZA 1ZGAA 3KQYA 5DX0A 3T0IA 2P7HA 3BGIA 1NKVA 5LQKA 4RVFA 4OQDA 4GF5A 4AX8A 2OYRA 2ERCA 4PYJA 4KIFA 4DKJA 4OQEA 4EK9A 3B3FA 3GWZA 4QQKA 5MHTA 3G89A 3RIEA 5KYGA 3MGGA 3EVZA 4MQ4A 4MIKA 5EVJA 4H0NA 1NV8A 3OU2A 3NVKI 5C0OE 4PIPA 4E70A 2IBTA 2ZW9A 3B3JA 3PX3A 1Q0SA 3EMDA 3DP7A 3HVKA 4K6MA 1D2HA 4U7PB 1RI3A 5CM2Z 5HEKA 5BW4A 1NBIA 4GOLD 1X1BA 1N7IA 2ZFUA 1M6YA 3A26A 3LHDA 5DWQA 4C4AA 3M70A 3M6XA 5E1BA 3VSEA 3AXTA 4OBXA 5LQCA 3SM3A 2JG3A 2AOUB 1G38A 4YMHA 3TKAA 1NW3A 3PTAA 1ORHA 5K05A 2IH2A 3KQMA 3CKKA 4QTUB 2C7RA 1SVUA 2P3QA 3NDJA 4P7GA 2EJUA 4AZTA 1NV9A 4HGYA 5FQNA 3LKZA 3DMGA 3GNLA 1QZZA 1WZNA 3NWBA 4C04A 3ELDA 4BP1A 5BW5A 2AN4A 2ZVJA 3CCFA 3LDUA 3SXJA 1R6AA 4AZSA 2VDVE 1X1AA 3P9KA 2BH2A 1EG2A 4GQBA 1KYWA 1R74A 3IYLW 4RSRA 5BXYA 1JQEA 1R00A 3SMQA 3A7EA 2JH9A 4ZTBA 2IBSA 3FPHA 3FTEA 1NW7A 3A4TA 3DMHA 2O57A 3IEIA 3OPNA 3PS9A 3GDHA 1EAMA 4GC9A 5CD1A 2FK7A 1HMYA 4P7JA 4YV0A 4FSDA 5DPMA 3CJQA 2DULA 3EPPA 2P3OA 4LG1A 1DUSA 4RTLA 1R18A 3DMFA 4ER3A 2BR4A 3Q7EA 4YUZA 5LQUA 3B7PA 2C7OA 1RJEA 5EIWA 4RTMA 1Q0TA 1RJFA 1L3CA 3PT9A 4YUYA 1IXKA 2UYQA 4CKBA 3G88A 4PWYA 5GIOE 2PXAA 5FQOA 3OU7A 3TMAA 5DTQA 2GPYA 2ADMA 5DRYA 3GU3A 3KPWA 3ANXA 4RTSA 4IV0A 5B1SA 2NXEA 5HZMA 4E33A 3OFJA 4FS8A 4M37A 3OZTA 4M38A 5CUQA 2WA2A 5K0CA 3EGEA 3GRRA 3LCVB 4F84A 2B2CA 2CL5A 2P3LA 3EEYA 5CVVA 3TLJA 5K0JA 3LCUA 1BC5A 2AOTB 3ELWA 5P8WA 2Z6UA 2PT9A 4PYIA 5U4XA 2O05A 5LSAA 5EMJA 2AOXA 2YX1A 5E9JA 3TFWA 3MHTA 4A6DA 3C3PA 2BR5A 3KPUA 2B3TA 5FCDA 5KVAA 3PFHA 2UYOA 2ZBQA 5ICFA 1EQAA 3HCEA 2PKWA 4ER5A 5E8RA 5FWAA 3DXXA 3ELYA 3TOSA 4PYLA 1G6Q1 3HVIA 2BM8A 1YFLA 5DM4A 3KU1A 1WXWA 3CJRA 1BHJA 2PY6A 3M6VA 3OU6A 3R3HA 2ZCJA 5CVEA 3BGVA 5E2AA 5EOVA 5EZSA 3TM4A 3THRA 1NW8A 2Q41A 3TQSA 3FUXA 1VE3A 3NMUF 2AOTA 4GOMD 2NNWB 4MTLA 2AR0A 3KQSA 1G8SA 4YV2A 2C7PA 2C7QA 2HNKA 5E1DA 1O9GA 4F85A 1IM8A 4PYMA 3HA7A 3DH0A 5FWDA 2E5WA 2IDJA 5EC8A 1SKMA 3EGVA 4RYLA 5DT2A 5K0EA 1KYZA 2PJDA 2ZWVA 3A7DA 3QOXA 4Y30A 3U81A 4L7VA 4M36A 3E05A 3NDIA 1ZHFA 3KQPA 4C08A 3DUWA 3FUTA 2YVLA 3P9NA 5FA8A 3ERCA 3JWGA 1SUIA 4FR0A 1JSZA 4HTFA 3EVFA 2PGXA 3G2PA 4BLVA 5CVJA 3FPEA 2FHPA 2IGTA 2IIPA 2ZZNA 3HCFA 5EQJB 2QE6A 3LCCA 3UJAA 1M0EA 1QAOA 1L3IA 5FA5A 3I5UA 1WG8A 1OR8A 4E31A 3BUSA 2ONYA 4QDJA 4E2WA 10MHA 1YUBA 1MHTA 4HG2A 4EQZA 4Y2HA 3G2MA 1JQ3A 4C07A 1JG1A 5BP7A 5K8VA 5HFJA 3IV6A 2ONZA 1L9KA 3AWIA 3HM2A 3MTIA 2Y1XA 1KPIA 3LKDA 2G71A 4GEKA 2ZIGA 1L3BA 4BLUA 5HIKA 3R9XB 5D1NA 4BLWA 3K0BA 2JHCA 2OO3A 5GM1A 2YUIA 3GJYA 3UJ7A 4C05A 2R3SA 3B3GA 3VYWA 4HC4A 5E2BA 5K0LA 1N2XA 2AS0A 3LX6A 3HNRA 4POOA 3AY0A 2Z6AA 3P2IA 5GIPE 4BY9E 4RTRA 2AVDA 2HV9A 3ME5A 1DL5A 4V0RA 3BXOA 5G02A 3TR6A 2DPMA 1NW6A 3THSA 5E9WA 1QYRA 2OB1A 2AZTA 5DM0A 5K03A 3LDFA 3VC1A 3BWYA 5FHRA 3CJTA 3DLIA 4KW7A 3HA3A 3ID6C 1AV6A 1D2CA 1WXXA 4LECA 4PYQA 4DA4A 3CC8A 2O06A 1YFJA 1EJ0A 1FP2A 3PVCA 4OA8A 4XCXA 3MTEA 1I4WA 3JWIA 1O54A 1MJFA 2R6ZA 1INLA 2HTEA 4RVHA 2AOWA 1QANA 3GRYA 3RODA 1ZG3A 2CMHA 3HA5A 3KHKA 1D2GA 3E8SA 1I1NA 1T43A 3HVHA 1M6EX 1RI5A 3CGGA 4FGZA 4R6XA 1AQIA 1Y8CA 5K0NA 3V97A 3GIWA 5LQJA 2BZGA 2VS1A 4A6EA 4QVGA 4GOND 2FYTA 1FP1D 2IH5A 3KPVA 3KR9A 3TPZA 1PJZA 2PT6A 5EIFA 2A14A 1ZGJA 3PLAE 3FUVA 3D2LA 3EVDA 2YQZA 3ELUA 3F4KA 3M6WA 1XJ5A 3NWEA 5KS2A 4RTKA 5DXJA 3X0DA 4DZRA 3KR2A 2WA1A 1VPTA 1BOOA 2OBFA 5DM1A 3KQOA 2YTZA 2AN3A 3BKXA 4PGGA 4PYOA 5DSTA 3ORHA 1VL5A 2PVCA 4HH4A 1VP3A 1JG4A 1RI1A 5K0GA 3LL7A 4EKGA 3MB5A 2GA9A 4EVIA 3K6RA 5K0BA 1VIDA 4AZVA 3HEMA 3TRKA 3P9CA 5GWXA 2ZLBA 3LDGA 2B78A 3BKWA 3G5LA 3G8AA 4ATNA 3FTFA 1TW2A 2PX4A 4RX1A 3REOA 3Q87B 4O29A 1VBFA 3G5TA 1P91A 4E2XA 3NTVA 3FRHA 3HCCA 3SGLA 5LQNA 2HWKA 2JJQA 3UA3A 2VDWA 5EHIA 5IKMA 1XXLA 3GO4A 5EZQA 1UIRA 3TKYA 4FT4A 1RJDA 2P40A 3B5IA 7MHTA 3BT7A 2B25A 1O9HA 5DM2A 3OZSA 2PBFA 2BR3A 3DLCA 3SSMA 1X1DA 1R8YA 2ZZMA 1EJ6A 3DR5A 3FPJA 5E8JA 4F86A 2QRVB 2AVNA 2HR1A 5DRTA 5E9QA 5K09A 3QV2A 2ZZKA 3BZBA 3I9FA 2GAFA 1WY7A 1DCTA 2H11A 2V74B 1R8XA 1X19A 4FT2A 2I62A 1XVAA 5T67A 2YXEA 2GB4A 4XUDA 4CTJA 2AOUA 3DULA 3AXSA 3E23A 3QOWA 2PX5A 4YUVA 1Z3CA 2ZWAA 3TM5A 2F8LA 4PYKA 3LGAA 2CWWA 4WXHA 1SUSA 3E7PA 3V8VA 1SQGA 3OCJA 3UZUA 3UFBA 4E2YA 1JR4A 2XVMA 2P8JA 4YV1A 4U7TB 2XVAA 3ER8A 5EMLA 2IDKA 3BWMA 4QDKA 3O7WA 4YMGA 1SG9A 5FUBA 4KRGA 4R6WA 1FPQA 3SVZA 3DXYA 2N47A 4IV8A 4CTKA 3FYCA 4FP9A 4GC5A 2GLUA 3HCAA 4PINA 4PYNA 4KDRA 5K0FA 2YXDA 5EPEA 3UBTA 5CVDA 3H2BA
chains in the Genus database with same CATH superfamily
5FLXA 2CMDA 1ONNA 4PPYA 5KQSA 2Z95A 1E9CA 3QW2A 4AX4A 1XNGA 1C3XA 1O4WA 1XMQB 1U99A 3ZDRA 4TLEA 4BZQA 2V4ZA 3PJRA 2FKNA 1SZPA 2ZUUA 1G7TA 5B7PA 3GG2A 1UT6A 2CW5A 3DHVA 4JL8A 5LQDA 2HX1A 1Y5RA 3HO1A 1YE3A 2GZ3A 1E4OA 4WGFA 3H5OA 2NACA 4RLFA 2NPOA 2PV0A 3HB7A 3NTQA 2FLVA 2OFWA 4O33A 2YWXA 3A6PC 1AY0A 1G21E 1T2EA 1CRWG 1HLGA 2OENG 2FG7C 3UCEA 2NP7A 3QLTA 4Q1EA 3OSUA 4MGIR 3P71T 2XVXA 2UUOA 1XMXA 4RD1A 5B6PA 1HE8B 1KI8A 3VAZA 3QE9Y 3E1SA 4YRGA 2IIQA 3VH4A 3E84A 3SKVA 2ZT5A 2ZJFA 3A1UA 3EVEA 3ADKA 4E21A 2P41A 4ILKA 2DHCA 1H6AA 3LWNA 1H1LB 5FJJA 2PRZA 1EBFA 1QMGA 1T5TA 2AHRA 2ZJOA 2HA0A 1NF9A 5ALFA 2IOHA 5G3ZA 3UMYA 1T8SA 4D9BA 4REQA 3CPJB 3LRPA 1BDIA 3C6QA 3AC0A 1FS4A 4GEGA 1LBQA 1T34A 4N4AA 1CQPA 2XLCA 4YDRA 4OL0A 2YV2A 1RRGA 3KEFA 4H35A 2C29D 5IF3A 3G0BA 1D4ZA 3JQRA 2ZAMA 2GYWA 5FNVB 4HN9A 1WOYA 3THOA 4WK2B 4O4IB 2XUDA 3DKKA 3L82B 4KO3S 3C7DB 2I6SA 2CUTA 3LUGA 4FX2A 4XASA 3GP8A 2Q2NA 1SKYB 1TCAA 3O2SB 3TR0A 3D3WA 3TG8A 4NOKA 2AF3C 2AN5A 3M5DA 3DOHA 3DBLA 1PFYA 2EJWA 2OMEA 4XX0B 1J0DA 4DNXA 1BMQA 2FLWA 1B8VA 1ND5A 2WU4A 3DAPA 1J7KA 3KS9A 1TVKB 1PG5A 2GPWA 1F4VA 3LP6A 2VA9A 2JANA 1F1JA 4LHWA 4D9EA 5J1TB 4W5NA 2Y1GA 2HBZA 1X1CA 2JVJA 4Y1EA 1ZC3A 1OZFA 3U80A 2OC9A 3WRXC 3IJ5A 1NBHA 1X1TA 1Y8QA 2D1QA 1GL7A 2J6CA 2YC4C 1KKMA 4G1CA 1ZC4A 3PKZA 3UC5A 5LD2B 3KHTA 5H4GA 3CZRA 5DN6D 2B8JA 3K35A 3F1KA 2XCSB 1J07A 1H9CA 1GGFA 5EGNA 3FZGA 4BCDA 3TD6A 1N6NA 1ESEA 1QYCA 3A6LA 3EOAI 4NWIA 4B2LA 4LRSB 1Z4IA 4W4TA 4DNOA 5DLYA 4HNGA 1PW7A 4O6VA 1T1GA 4RNDB 5BN4A 2A0YA 3L1JA 3L02A 5CYPA 1W25A 5G2OA 3UXMA 3KJNA 4CM8B 3KPJA 5H81A 3GX1A 2GJ9A 2RHRA 4M7OA 3ZZNA 4EMSA 2DBQA 4FMDB 5H9WA 4NP6A 5KOHA 3HNPA 1R0LA 3H5IA 4PTZA 3ZH2A 4KHZA 4OM7A 1PJCA 2ERXA 1PGPA 2NSDA 3B3AA 1MGPA 2VN8A 3EWAA 3OIVA 4NE2A 3S68A 5CLJA 5KJFA 4CGZA 2JLAA 5F3RA 5FWYB 2QAGC 3GLFB 3UNXA 3ZU2A 2QM3A 1OFHA 3BH0A 3F46A 1TK9A 4LVOA 3UAVA 2B36A 3FSJX 1OTYA 2B4RO 3ZCVA 5CXXA 4EF4A 3SLGA 1WBBA 2GO1A 5TIIA 3FSGD 1MFZA 3HKEA 1N0IA 4CHTA 2JIPA 5EP2A 1UAGA 3DB2A 3R3UA 3UWPA 1YQQA 1NJGA 4LV8B 4CMIB 1QR6A 3IVAA 3MGBA 1H42A 3NHUA 4IF6A 3HB0A 4HAUA 4IKPA 4AC9A 1RM5A 4QU9A 4GWGA 1YKGA 2J4DA 4DUPA 4GPAA 4E2ZA 2YJ3A 1T8PA 1XZBA 4Q7QA 3OQPA 4K40A 5PNTA 2W42A 4V03A 1K2VN 4IIEA 4P3YA 4R9UC 1OB2A 1NY5A 4OMFG 4K3VA 3ENWA 4JT2A 1CUEA 1SBYA 1QAMA 3UT5A 1CZLA 1NVTA 1BWPA 2J59A 2C3UA 1GAXA 4CU5A 3JYPA 3THWB 2EJTA 1G0NA 2JDIA 3E22B 4IIHA 4M1SA 3WLQA 2OILA 2PSJA 1L1EA 3PB3A 1UOPA 2NU7A 3A4LA 3MFYA 3JVIA 5BVGA 2GXUA 3V2HA 2X0JA 1JSXA 1NQWA 1OZ0A 2I66A 4KMOA 2EZ8A 3MMZA 3MUEA 4ZDKA 1QONA 2FMXA 4ROSA 1J2UA 3KWLA 4ZOQI 2Q2WA 1AQJA 3AUFA 5KDOA 3P8ZA 5TMDA 5I7SA 3RFCA 2ZYDA 3G2QA 1WB9A 3WHLA 1BRTA 3MIZA 2ZULA 2OZVA 3IA7A 4QGSA 5JYCA 4PNPA 1ZIYA 4L9SA 1TQHA 4G4IA 1U2QA 2Q3DA 3OPVA 2GZAA 5A5DA 3SQWA 4YVFA 4HWGA 5H3HA 3CEPB 5EMHA 5GGYA 5JI2E 4MYDA 3CVXA 4ZPXA 3V7UA 3OWHA 3RUPA 2ZJZA 3PA8A 1DRJA 5I3CA 3ZC3A 2V1UA 1NKVA 1WVGA 4PC1A 4GF5A 5FH9A 4MIYA 1Z73A 4JSTA 4C2BA 4PY2A 1MAHA 4OQEA 4I2VA 1E1DA 3QVSA 4NBVA 4R8MA 4RSMA 1FFEA 4BB9A 1FFXA 1G2QA 2E1PA 3R3ZA 3FDIA 2LP4Y 3LA8A 1SG0A 2FQXA 3AF6A 1USUA 1ZOOA 4B4DA 4HAVA 5LNK6 2YZ7A 3MUFA 1QFMA 4G97A 1T9GR 1A7KA 4DDHA 4U3JB 1D2HA 1EK6A 3FPLA 1M2GA 2ZFUA 1LV7A 4RY9A 3VRHA 4F2PA 4C4AA 4CQLB 5E1BA 1S2OA 3AXTA 3SM3A 2ZR9A 1U0RA 1BZYA 3HN7A 4O25A 3A1CA 3W6ZA 4G0QA 2B8WA 2XQFA 4Z4CA 2IH2A 2E89A 1NC3A 2JFQA 1B0UA 2O7VA 2ZKLA 3PNSA 1C4OA 3M4NA 4DB2A 3CH7A 1VI5A 1FZTA 3G8DA 4CLRA 4YXWA 3WV4A 5I9LA 3D8UA 4UTPA 2A7QA 5IM4F 4FI3F 3GEPA 4K1LA 1WZIA 4NEGA 4GPD1 1E4VA 3HG7A 2J41A 2C0CA 2I2WA 3UUFA 3ZS8A 2CJWB 1P72A 2VJCA 2FSVC 3DE2X 4NZOA 1E2BA 1E1LA 2VHEA 3EXFA 3FPHA 4Q66C 2QVGA 3CMCO 4PX9A 3R76A 5IJ0A 2WKWA 4DQVA 5K9ZA 1H2AS 3I6YA 4D45A 2FK7A 1I2CA 2JJ8A 5CLLA 3KALA 4BXOB 1BU8A 5DPMA 4B3FX 2H57A 4GBGA 3HEAA 3EE6A 2WYOA 3ED1A 4C3OB 3A9RA 1RJEA 2B1IA 4PQRA 3G9UA 4DCPA 3FIUA 1RJFA 4M8IA 1XRQA 2JI7A 2UYQA 4X20B 4WN9A 4J16C 2M1XA 3R8FA 1LDNA 4DZTA 2YV1A 3MTQA 1K9SA 3L8EA 4C01A 1U0HC 1HF3A 4HLUA 2A30A 4DBVO 3ANXA 5EJIA 5DXFA 1GA4A 4RPGA 3HU5A 4E33A 1KI9A 3OFJA 5BQXA 3CX7A 2VP5A 1PJQA 3BMOB 4FILA 3L5KA 2NUPB 5H3CA 5HKOA 2K2QB 2YJNA 4D3YA 2ZB7A 5DGXA 5JDCA 3CEAA 4QXOA 4KITB 2J9ZB 3DSRA 4BMYA 4RCYA 2BR5A 1N8TA 2PZ8A 1UBGA 3P26A 4RKFA 5FCDA 5JLJA 3CLSC 4FFMA 5K6TA 2JARA 2QYHA 5IH7A 3NNSA 3P7MA 4R4JA 1IMOA 1OXUA 3KCNA 3QI2A 3SXUA 3WAKA 1F9AA 4BQFA 1JSRA 3RWMB 4K6HA 2QTFA 5DM4A 2ECQA 3M6VA 3BB1A 2EKZA 1ZMRA 3T1TA 1I3KA 2SKDA 4L6IA 5E2AA 3TQSA 2Q41A 5JNTA 4IDCA 3U3MA 1GV0A 2QD2A 4PG4A 4JQCA 1L1QA 4H6PA 2GLTA 1ZNWA 3FOEC 2V0CA 2OHOA 1SKMA 2QT1A 4R7GA 1Y5LA 3OQ1A 1UBFA 2BEWB 3B8EA 3EGVA 4RYLA 4I9HA 4HGRA 3AILA 1ZJJA 4BGIA 2ICAA 1OBHA 4M6WB 4DJDC 1QIHA 1UKYA 2FJ0A 4KLZA 1ONSA 1FDTA 4ND2A 2CCJA 1OUMA 1XL1A 3D7LA 4RM3A 4P3KA 1E2EA 1QG6A 1GR1A 1JH9A 1OYWA 2XEXA 4NHEA 1BHSA 5BNIA 3X1JA 4H7DA 4FR0A 2H4YA 1JSZA 2IZ0A 4B1FA 1JPVA 1PK8A 2QU7A 4QUJA 1GNPA 2NVUB 2PDAA 3T4PA 5IZCC 5AW9A 4D92A 3PYMA 3UJAA 1L3IA 2ZOSA 3A8TA 3G2JA 5DYGA 1Y7IA 3WGHA 2Z2ZA 1UDAA 1QQTA 2QORA 2NZJA 4ETIA 3R6DA 1CX9B 3RV3A 2D2IA 4IJVA 1XEFA 2P0AA 2Y4NA 3D5QA 2HM7A 1U3TA 4QUDA 1A9RA 4N9WA 2OXIA 2RHBA 2WFAA 1E6UA 1I3NA 1P0CA 2OXEA 1MLDA 4IUCS 3VI4B 4YXWD 2G0TA 3OUTA 4LJSA 4J0HA 1L5SA 1P2TA 4GGMX 4UM9B 2AB0A 2H48A 1KZGB 4GLFA 2OO3A 5GM1A 5AVYA 3UJ7A 3AHCA 5JEDA 3CZAA 3EVNA 3LUPA 3VDNB 5KEIA 4QJ3A 1XJWA 3RHTA 3V34A 2W48A 2QTWB 5FL7A 1THZA 2NO4A 5A5VA 3WYGA 2Z9BA 4FIZA 4YMWA 1IJKA 2FMTA 3AHGA 4MQUA 3BXOA 3KTAB 3VVBA 2OB1A 4YPFA 2AZTA 3GUUA 2HI0A 3FNRA 3IBSA 2H2FA 2D3TA 3SJAA 3O8RA 3FWKA 5FHRA 2IS4A 4ALNA 2YC2C 2FP3A 1SOMA 3UM9A 3K15A 5J2TF 1DJQA 4C43A 4UM9D 2Q99A 5COAA 3QLVC 2CHEA 4C6TA 1ZK1A 3KFLA 3P45A 4JLJA 3RRYA 3JWIA 1O54A 1NYRA 4AYTA 1INLA 2WFLB 2QUHA 1Y1KE 1QANA 4RVHA 1EHYA 2IGBA 2RJ3A 3TLYA 2D8MA 3T5AA 3E8SA 1I1NA 2ADFA 1L5MA 3EG9B 3WDSA 5I7UA 1ECCA 2NZWA 2W83A 3TW8A 4YEDA 2IXGA 1ULZA 2ZIZA 3EEFA 4PQFA 3ZDXB 3CZ5A 4OHOA 4N5DA 2BEJA 1A4UA 1THTA 3GL9A 3N6VA 4DANA 5JZOA 3RUCA 5CDFA 4F4UA 1K8YB 2NU7B 4LJ8A 2HXGA 2PZLA 3EFHA 4L3WA 4DBLE 4H7FA 4R68A 4RD3A 3WGYA 3PLAE 3ZLTA 3THWA 1JSLA 4GYWA 1PJBA 1RXSA 1BW9A 1OGJA 3KR2A 4PPQA 2WA1A 3IPRA 3N75A 4R1PA 3ZUPA 4BVFA 3AVYA 4R0MA 2AN3A 4QEDA 1ID8A 1CP3A 1VL5A 2PVCA 1YWGO 1QHHB 4IGKA 3SHQA 5K0GA 4DMRA 2CLOB 4TLCA 1JN0A 2ECPA 3MB5A 5FBWB 3OTQA 3SF8A 3FLMA 3HO6A 1VIDA 1ZRNA 3MS4A 3NPMA 4PHCA 1B1CA 3DFKA 1EB9A 3BKWA 3G5LA 3OO1A 3Q7QA 3LVRE 4P3XA 5B7QA 1CRZA 5EIEA 1XSEA 2VUHB 4UDOA 2B5OA 5AI5A 5F23A 1J22A 1B3RA 2FMIA 1A88A 1QGUA 1M74A 3UA3A 2EQAA 4FB4A 4E15A 1Q19A 4FBLA 4KQGA 2GSWA 3B1ZA 1KRWA 2A5YB 5H16A 3ZE1B 3KB6A 2W5UA 2IU0A 3RK4A 1W1WA 2DTXA 2P1ZA 5DM2A 4J3NA 3KSMA 1ZUHA 4L2IA 3DLCA 1KGSA 1EDBA 2UDPA 1ODJA 4GLLA 1HXHA 1G20E 3BJIC 2F55A 4UMEA 1W93A 1XTSA 2BRUC 2HA3A 2YASA 2G07A 3NUZA 1KFKB 4TSKA 2ATCA 5ED0A 4B6EA 4BRWA 2C7GA 3WNZA 4CLOA 2CEAA 2OV3A 4BRZA 1XD9A 4M1KA 4YI5A 1RACA 1W46A 3DVAB 4YJ3B 5IEJA 3I12A 4GT1A 5J9FA 5DM60 4NI5A 3LGAA 4X3CA 1G19A 3QEKA 4KX3A 4CLDA 1A2OA 3EW9A 4XDZA 2FZKA 1YSCA 3LYLA 5AHRA 4ZODA 1TEZA 4N3GA 2FZ4A 2Z30A 3E5MA 1J9GA 2BEVB 1AKVA 4FGSA 5ERXA 4WFIA 2W2MA 1ZL0A 2BTQB 2N47A 3R23A 4YHHB 4JI2B 3WA7A 5DTJA 2F1KA 3WSWA 2GXSA 3LFUA 3FHLA 5DH9A 2A3NA 2NT3A 4V3CA 4GR5A 4MLDA 5CVDA 3WAGA 3F73A 2VUUA 2X2OA 4HH1A 1ZSYA 2ZSJA 3WSTA 3QUSA 2BV3A 3NXKA 3P0EA 4L8YA 3RC1A 2YHBA 2DUNA 4BMDA 5CIYA 3BN3A 3LV8A 2OV8A 3ZWPA 5D86A 1QX4A 1Z6GA 2FSIA 2X76A 4QU8A 4XUEA 4WECA 1SCDA 1W8DA 3RABA 3G82C 4KN5A 4G0XA 3H2HA 4PPNA 5ELXA 3M1IA 5HX7A 1GNSA 2EEZA 5AJZA 2GKGA 1OXXK 4AKHA 5K4AA 4G89A 3DG9A 4TV8F 4U2EA 3O3OB 1R9MA 3KYCB 3RVDA 5D3ZA 2PUCA 3ZQ4A 3OJOA 5FOWA 2CNBA 4PONA 4WGGA 2FPGB 1YB1A 3ZVRA 3ABOB 1TQDA 1F3LA 4MKHA 1Y4UA 4D26A 3F5QA 2N46A 3B2NA 2RHWA 4NKRA 1E2KA 3LE8A 4ZI7F 4BP3A 1I2MA 3IUEA 1D2RA 5CYOA 5IHPA 2AXEA 2BBTA 1EFTA 3K0CC 1X13A 4P7BA 2Z2IA 1HLPA 5GOTA 1NI3A 1CUAA 2ZVDA 3K70D 1GPWB 4U5XA 4AZ0A 3BXEA 3P2EA 3TL3A 2OYCA 1FFSA 2NGRA 4W1QA 1ZVVA 2PUEA 2Z6QA 2BGNA 3EEBA 2BUCA 4G26A 2FNAA 4P4SB 1SZDA 1QG4A 5TMEA 5D84A 5INTA 3B82A 2WQ6A 3CPSA 2EIXA 2RAFA 3QJYA 3KR1A 4H27A 1XTTA 3EXHA 2W2NA 4BNVA 1E99A 3MC1A 4AN4A 2GYYA 1MAAA 5JSKA 1OU4A 1JX6A 3O95A 1KAEA 4J94A 1KYTA 3RYIA 3WSVA 1OASA 3KKQA 5GVSA 1RJGA 4ZYTA 2QJTA 2WIDA 4X71A 2C4NA 3P9QA 5AW5A 3N87A 2NPIA 2FPGA 1TE2A 4JJ8A 2FEAA 5K3BA 5MFZA 1Z47A 4DADA 3N53A 2ODAA 2AJBA 1K06A 2HLHA 2DUWA 4OSPA 2ZUDA 3KUCA 4R2XA 2DPGA 3JWEA 4IQGA 4WAUA 4K2AA 4O1HA 4TV8B 3F67A 3DTVA 1SKAA 3U40A 4C0KA 4JNCA 2OQVA 2ORED 2WG2A 2YY7A 5KSOA 3FMIA 3VGJA 1GG2A 2HBYA 2AKYA 1DG9A 3P97A 2C9MA 5EXSA 3CZ4A 4Q34A 5EHNA 1PIWA 2GN9A 5KTOA 4YT5A 1D8TA 4S05A 4XEHA 1B16A 4NEQA 3R5JA 5CBKA 3U5ZB 2ATXA 3DDOA 2R97A 3T9AA 4TZTA 4IZIA 4CT4B 4PFSA 5DI3A 5SY9A 3AUKA 3ADDA 5E1OA 1CY8A 3F6PA 1CQIB 1P7CA 2MYTA 1DIHA 1RAEA 1YQEA 3AL2A 1DRKA 3C6MA 1EM6A 4F12A 2PMKA 3B13B 4YO8A 5HDQA 3UB2A 2C00A 3IPAA 3MAGA 4FFOA 4ZRNA 1I9CA 3L46A 5JAUA 3RRBA 2DAPA 4XM2A 2VEDA 2NMVA 2GFIA 4IWNA 1OFUA 3MOSA 4FFPA 3RJMA 3RYIB 2ILTA 3D4BA 1PNRA 2ZIEA 3RIHA 1UKZA 3Q4GA 1GL3A 2AOVA 3EXHB 4WNCA 1A2BA 2AUNA 4L78A 4YJFB 3R4CA 2QTTA 5CJ2A 2P2YA 4HX9A 5SZJA 3UYLA 4E31A 4A27A 4F56A 4FE4A 4A7PA 1SUEA 4DWOA 3RVLA 1XD2A 1IY1A 1W85B 1N0HA 1G17A 3KSRA 2JFYA 2K87A 2Q8NA 4HJXA 4M0KA 3DNFA 3CR3C 1PTJA 2C4HA 3EGXA 3FTCA 3OZRA 2DT8A 3Q3CA 4QQRA 4INZA 3CG4A 4RWZA 3R0JA 2A1TR 3A1WA 5F77A 4PTYA 3E5HA 2OHGA 4FOTA 1NSFA 1E1RD 1P0MA 2V59A 4MWZA 5CLFA 3QEBZ 1XCJA 2WD9A 3G7NA 2HLDA 4URFA 2CLLB 3D2AA 5C8YA 3H9GA 5CK5A 1SU6A 3GGSA 2QXTA 1BE8A 4OHKA 5DWVA 2FWAA 2QAIA 4C7BA 5M5BA 1G6OA 4JXJA 3E9NA 2ONCA 1JAIA 2CB9A 1YR6A 4Q37A 3GUHA 1HFJA 3KAQA 4FDMA 4ARUA 1D0VA 1JQ5A 5EHZA 1XPOA 3VO9A 2EW8A 2FPLA 5AOVA 2XIJA 3GLTA 4QGBA 3BXGA 4C03A 4UBKA 4ZC1A 1Y3FE 1R2QA 2H65A 3OEWA 3W6PA 2YYAA 1EFRA 2OUIA 3LPDA 3PTLA 2QTZA 5T4EA 1I7PA 3GT0A 4OF4A 3UJNA 3L07A 3KL2A 3L04A 2YCBA 1Z17A 4R5HA 1ZQ1A 1EUCB 2VA8A 3RG8A 3HWRA 3TQQA 1NMSA 2C3MA 2YJ6A 3VR6A 3ZWWA 2Z1DA 5JS1A 3HGMA 4OQDA 3FLBA 4C7MA 4FOOA 3F7TA 1JLSA 2PL5A 4DKJA 1TUBB 1UBSB 3D5TA 2QD1A 4X3PA 3M5PA 2NPFA 2X8WA 2NSHA 1E1MA 3U56A 3AI3A 3TUIC 4XD7A 1H2ZA 3LUBA 3JQ7B 3AVPA 4PIPA 1YA6A 3KCQA 1IJFA 4W5HA 5TT1A 4QTZA 3ZXSA 1XXHA 3HVKA 1D1PA 2X9VA 4X1IB 2Y1KA 4OUDB 3RANA 5KZMB 2KHZA 1N7IA 3S2FA 4CN8A 4EPWA 2X1MA 4UXHA 2AKEA 2AT1A 2Y0BA 1JHZA 4W1PA 2YKGA 1Q3KA 5CGQB 1G38A 1XTVA 4QGFA 4DVJA 3G6KA 4Q93A 8AT1A 2XA1A 3C3DA 4MJ3A 1IZYA 1NW4A 3QVJA 5AMXA 4KJXA 5BY2A 3NYWA 4K9NA 2P3QA 3A1FA 1Y1QA 2NUBA 3ONFA 1RFGE 2LCQA 2GERA 2I6FA 1YE8A 4L8WB 4WKCA 1UBEA 2AN4A 4G8JA 4QL3A 4RIHA 1MAUA 3DLHA 4DA9A 2XTNA 2A0WA 3IIJA 3ODPA 4ZQBA 4ZANA 5JU6A 4OU4A 4Y18A 3HVUA 3IYLW 4K9PA 3PT5A 5CA1F 4GL2A 3GEMA 2ZANA 3IB3A 2ZB8A 4M0FA 4N0QA 3CRRA 1GAEO 2M2IA 3OPNA 2WM9B 2ZI3A 4H0CA 4PC2A 4B3MB 5LJLA 1CR6A 2GOYA 3O4HA 1IH8A 3RSLA 2FMUA 1IK4A 1S01A 3AY3A 1C0EA 3K9QO 2SICE 4P4LA 4UTNA 2HF2A 3N2NA 1XQYA 4B4KA 4F5EA 3V2IA 3Q7IA 1MA0A 1ZCAA 2NVOA 1EX1A 2VI5A 2WHEA 4EG5A 4OHYA 2ZAOA 4S24A 3URKA 4UU8A 3JPWA 4C0BA 2GFHA 1BVRA 4S12A 5JXGA 1YVDA 1Q95A 4FJ1A 4LPSA 1JLKA 2Z04A 4FN4A 5FQOA 2OCLA 4FE3A 1B6RA 3PUKA 1J2RA 3KOZA 1VTKA 2IW1A 2XTZA 2RC6A 3JQCA 3KPWA 3NM4A 2SKEA 3PVZA 4IIJB 1IJBA 1HT0A 3HFSA 5BN3B 3EUAA 3C15C 3FWNA 1XQ1A 1XZEA 4YDQA 5CUQA 2XAAA 3CU5A 3F9CA 3GRRA 3JQ8B 3K8OE 3LCVB 3T1VA 2P3LA 2W00A 4OK5A 5K0JA 1V2HE 3H3FA 1BC5A 1NT4A 2RAPA 2AX3A 2B2NA 3K05A 4Z0HO 3TKLA 4A2QA 3HVRA 1LF5A 1HT2E 1YASA 5I4CA 4ESVA 2A84A 2ZSKA 2WZDA 4G0OA 1G8JA 2PRYA 4JY7A 1NN1A 3DR3A 2HQSA 5LZ5A 1FX0B 3BBLA 4DDUA 1EUQA 2DR2A 4CMCA 3HCEA 1PLJA 5CTJA 4ER5A 2XMDA 2ZRCA 5FWAA 2JH3A 2JAXA 1NPDA 1JA0A 3RTBA 2G4VA 3KZMA 3ZGNA 3AU8A 5HGXA 1WABA 3FUXA 1P5HA 1VE3A 3AP3A 2ID8A 4GOMD 3SFZA 4DDWA 3FCEA 4KH0A 2FG6C 2X77A 4OXNA 3K8YA 1GN9A 3CVWA 4AKSA 2QXUA 2VL7A 3OP1A 4CYMA 4PR3A 5TGTA 3W5CA 3AVOA 2ZYGA 2LDXA 2HK8A 2OZLA 3OT1A 4C4ZA 2AX4A 4QO7A 4AKEA 1MG5A 5FTKA 1XQ9A 3ET4A 5JSZB 2HF8A 1X9HA 3KB2A 3ZDAA 3QVKA 1X2BA 5SYNA 1HQYE 3PC8C 2IV3A 3GFOA 1OAKA 3ZE6A 2IT1A 3G2KA 1PHPA 4QLBA 1TD1A 4YCLA 2OCKA 3VYUB 4S1TA 1U1GA 1ENOA 2IHJA 4GLBA 4MZXA 3P0IA 3P9NA 4GLOA 4JVOA 1TDJA 4BFWA 1A8PA 1A04A 4CDRA 1CQJB 1CR1A 5ADHA 3KBOA 5LUBA 1C0LA 4BKPA 4L15A 2UZ1A 4IMJB 2IIPA 4JVLA 5IP5A 1QK4A 2H2DA 2PL1A 3K0FB 2CYBA 3NONA 5AVTA 1E2HA 4EG3A 2O8FA 4QDJA 3ZHZA 5YASA 1BDMA 1SGWA 5BP7A 1MGOA 1NUSA 1Y1LA 3TBFA 3HP1A 1YVUA 4DRYA 4I3HA 3FDZB 3RU9A 2XNDD 1B1AA 2G7MC 1L8QA 3HM9A 3MJVA 4AY6A 3ZKWB 2P11A 1VHQA 4HCJA 1PNOA 1A0OA 1I33A 5C81A 2BDTA 3GEEA 4WA7A 2ZRKA 1OX4A 2JLWA 2ODQA 1QLWA 1CD5A 4HC4A 4YT2A 1P2GA 3ND7A 3QV1A 3JQ9C 3OZAA 2GX6A 4TUYF 2C3YA 2C77A 4A0HA 4JUCA 2E2WA 4RFVA 4N5HX 4CT5A 4HLQB 4ENWA 4DDVA 1QH1B 2AWOA 5TB5A 3VC1A 4BRUA 5HUQA 1MEJA 4G4SP 2IHNA 1KOJA 4JI8B 1AV6A 4AF7A 5A6SA 2QPTA 2Z58A 2FZVA 2W90A 4HQLA 3IOMA 2HEGA 4QDOA 2PUBA 1YQGA 2WAAA 3EA0A 3OIWA 1OYOA 1X15A 4NPAA 1XTKA 4NPHA 2G0NA 2PZAA 2UXCB 4D9KA 5BR7A 4GGPA 1K6EA 2FE1A 3BSFA 4PBSA 4X94A 4YBZA 2D0OB 4HDKA 3DE3X 3PHCA 4HBGA 5B1DA 3WO0A 1VXOA 2O7SA 3CUTA 3REQB 4GP9A 4FC7A 4B0PA 1SKYE 1D04A 4PZLA 2RSLA 4ND5A 3W3AH 2V4MA 3IAM6 1YBAA 2J5QA 4HI0E 3WB1A 1DRUA 4LVUA 3MD9A 1BEZA 4C7VA 3EIFA 2JF0A 4QSMA 1PS0A 2Q6VA 3W2GA 1FP1D 2Q5IA 4DIMA 3PQ6A 2MHCA 4E11A 1NG9A 2GO7A 4NENB 1YJQA 1AK2A 1ZGJA 3Q2IA 4MAMA 3UQZA 3JSXA 4WINA 5BN1A 3F4KA 2ZU0C 3D4PA 4F7WA 2YHAA 1KE1A 1U2GA 4M21A 1KQGA 4RTKA 3HMKA 1KS2A 2JD2A 2VHQA 3PC7A 1IIRA 2B4AA 3FCXA 3KQOA 3U9LA 1P1FA 3TXXA 1HE2A 1ULTA 2A9JA 5K51A 1Z0SA 1YI0A 3FH0A 3RC3A 4BBAA 3W5AA 1A7JA 3GGPA 1DAEA 3PTZA 4IW3B 1KK3A 1C8LA 1MU0A 5IJXA 3M4YA 1CF2O 1AUOA 3EUEA 3QHAA 4BJHB 2F48A 1V1MA 2TRSB 2FDCA 1XZJA 3E48A 4RH0A 2E3JA 1Z6QA 5A4IS 1P4GA 1ZINA 2J08A 2R1UA 4HDMB 4HZUB 4LXGA 2W58A 4TQAA 5J5CA 4UOZA 4C2UA 3LXXA 1PEKE 2AQIA 3SGLA 2BKVA 3SHTA 1Q1BA 2RG7A 3DDUA 2C2WA 2PN1A 4IIUA 4ZPJA 5BV1A 1W4AA 4FFNA 1Q0RA 4FT4A 3U31A 4CNBA 1UC9A 3B51X 1EP3B 3T61A 2YWBA 4NG5A 3MD0A 4F8EA 1KNQA 4ZZ1A 4CN9A 1ZH4A 4CQMD 2B30A 4GMKA 3NDPA 3U3JA 4OHCA 2W6CX 2ZZMA 3L7NA 4GKAA 3DR5A 4RA9A 1DHTA 1GU1A 1MJGA 1V37A 3FPJA 3OE1A 1YA8A 3P32A 2QRVB 4X91A 1L5FA 1I7NA 2OZPA 4FFVA 4ZICA 4CMIA 2BTEA 3DKRA 3A1TA 1QCZA 1NQ5A 4HYYA 4NBTA 2VF8A 2QX9A 4XD7D 4DV3B 4ZO7A 2JLQA 1DIRA 3B38A 1CDOA 1PX0A 1N0UA 2YNMA 1QV7A 3F3YA 4XGIA 3MA0A 5ALHA 1HC7A 3X2EA 1DZ3A 3HDTA 4A2CA 1TO6A 5CFMA 2CDBA 5K3AA 3QUCA 4OV6B 2XZPA 2QN1A 1II8A 1LGYA 3EDQA 4EB3A 1CC1S 4IFBA 4EM6A 1SUSA 3RJ5A 3NAZA 3OCJA 4IFIA 4E5MA 2GBGA 5JJIA 3QE4A 4ID3A 1CVLA 1UCFA 4TTJA 3CVVA 2CC2A 4MWTA 2IEAA 5B7NA 2RJNA 3GLGB 3LVBA 4FEYA 3SX4A 1CNFA 1KIMA 1Q5PA 1X1SA 3AUSA 1VSTA 4G09A 1RM3A 4HDSB 1J8QA 1NQVA 3PUYA 4R0VA 2GLUA 3RIXA 3A4IA 1YL7A 4QG7A 6GPBA 1CJUC 2YXDA 3AINA 5KYWA 3OEYA 1FMTA 1HEUA 3PCRB 2WIFA 3ZDZB 4EI2A 3SLRA 4YBRA 5C8XA 1GUDA 2BE7A 3ABIA 1SBCA 3W9BA 4AMGA 2IE8A 1KRXA 1F38A 1JTEA 3ZWMA 5F4ZA 5K5EA 2BMVA 3HFJA 3QFFA 3OI7A 2CSUA 4NVRA 1R7RA 1SCQA 4B2YA 4M22A 3EFOB 1T25A 5TMBA 4R1SA 2L2QA 1QIMA 3OQVA 2Z2JA 4Y9TA 4GRAA 5JISA 3GY0A 1TCVA 5I8PA 4IFEA 2HU7A 3LSTA 1B6GA 4I4NA 1M6NA 1X77A 2VDJA 2XV1A 4FZVA 1OFVA 4URHA 3B1YA 3S7ZA 2Q0QA 1CUYA 1HSZA 4HNHA 2ZYAA 3C45A 1JNYA 3FUUA 3K2EA 5BVGB 1U7TA 2WIBA 1WSAA 3VKFA 1H8ED 1G2PA 4IOLA 4DY6A 1TVCA 4I1PA 1UDWA 4YIKA 4BZZA 4HAYA 4DBLC 3KYDA 3WMXA 1CWUA 3KAJA 3Q8KA 3G23A 1U1FA 3K7EA 4G5XA 4IDEA 4L95C 3GR6A 1ST3A 5CB6A 2QT0A 4DN6A 2JGMA 4B83A 2QWXA 3ICWA 2E55A 4LOLA 3A2KA 3PYLA 1WXDA 1CIVA 3SS9X 1VFPA 2QZ4A 2W8BB 4JLUA 4KEAA 5HCNA 2JFZA 1VKJA 1XDUA 3D6FA 4HQRA 3E18A 2PZKA 3IMKA 1KKLA 3IPLA 2EWMA 1FTQA 3PHIA 5ARCA 2QV7A 3SE0A 1EK1A 1CUHA 2PZFA 1D1TA 2HB6A 1Z33A 4S35A 3G02A 4C2AA 2HU2A 5EUMA 5IAOA 2CF5A 2H08A 4QBKA 5HOQA 1U28C 3W05A 1BEEA 1PYOA 2WWTA 1HG0A 2IYPA 2P5UA 4H4CA 1DAFA 1F4PA 2OK7A 3RDPA 2C83A 4MUYA 1E1NA 3C0KA 2X0FA 3VPAA 3EEOA 1FFHA 3CUEF 4AO8A 1KQPA 1KA9H 2BKAA 3GH3A 3EG5A 2NYUA 2Y0DA 4WOBA 1JYEA 2EBFX 1RXYA 2CXSA 2QUZA 3WMWA 1TYBE 2ZRBA 5EWJA 2MSEB 3GFBA 3W5BA 3Q2KA 3PWZA 1E3EA 3FF1A 3S6JA 1X38A 5HWSA 1MH9A 3KVNA 2V6FA 2J3JA 3TZKA 3WRYA 4BQOA 3GN2A 1ZM7A 2BI7A 2A5LA 1KXZA 1PS9A 2HJRA 3M33A 3NT2A 4PCLA 4C06A 4IDNA 4EENA 3TLAA 4O4JA 1E8NA 2I03A 3ZGYA 4CIAA 1FQJA 5HCUA 4X62B 3C5HA 4RHTA 2GBIA 4RV9A 3MTBA 3O47A 4FNAA 2IUUA 3SBOA 5JCOC 3IR7A 3WR5A 3ZV6A 2IYSA 1RNLA 2OEPA 2V4UA 1IWOA 4JGGA 2KSQA 2IEIA 2BFEA 2GM3A 2B82A 1C3JA 4MIEA 3KQHA 3B1FA 3OZ7A 2V7TA 4JXKA 5C9ZA 5EGSA 1ZK4A 2B1RA 1YAJA 3BZWA 3IKLA 5ENDA 4MYCA 1ZU5A 4K9MA 3ZIAA 2IYNA 4X6XA 1ZOLA 3EVAA 4AMVA 2G36A 4EYEA 3KPYA 1BXRB 1PL0A 1EKXA 1NOIA 1Z34A 2EF1A 3AEQA 3GN1A 4RCVA 3GRZA 3VKUA 5ALOA 3BCSA 2J9RA 5BRAA 3LY9A 5F7XA 4XOIA 3STYA 5JXWA 3PGVA 4O1MA 4R05A 5J47A 4OYHA 3RVPA 4NCAA 1GSIA 1ORVA 4D1YA 1R6XA 4ZVRA 3B60A 4ZVQA 2VJOA 3ZJUA 2FPXA 4G8DA 3VOAA 2C99A 2JS7A 2OCGA 1Y6QA 3KVVA 1OXKB 4HWOA 1KBZA 3EVCA 3V4SA 5FNVA 1QG2A 1FP6A 1HDXA 2P2LA 3T7DA 1N0WA 3LXMA 1U8UA 2GFQA 3WWCA 4QDUA 2I4IA 3LPLA 3NI2A 4LY3A 4AMBA 4KR6A 3HY6A 2JFOA 2RMKA 1QZTA 1VGQA 2QL9A 1RHUA 3LM8A 4S1VA 3H5NA 3RSGA 3E70C 3W5SA 4E4TA 4DR1B 1MVOA 3N39C 3P2MA 1X7WA 3SHFA 4MQMA 1QZXA 1OU0A 2G80A 3WE7A 1O87A 5BWNA 3FWHA 3CVOA 3AOEA 1ORWA 5FR1A 1V39A 1BKDR 4UM8B 1JEDA 4NZNA 4MR9A 4XXHA 4EKNB 4FDVA 4WZBE 3ESXA 2P9HA 2QTRA 4BKQA 3LT2A 5DNUA 1U2GC 3SU8A 1V6AA 1D5CA 2Z09A 3AUAA 4G1EB 3E03A 3QE2A 3EUFA 4RGQA 1QCYA 1YJ5A 4BTVA 2I65A 3JAWA 2EFJA 2EBHX 2PFGA 3CTMA 3ZNNA 4CNQA 1NUPA 5U4QA 3JZAA 4Q6BA 5F7ZA 1T8WA 3NHJA 4ITRC 1Q7TA 1VL0A 2GF2A 3EVGA 4ITUA 1G1AA 4LXQA 2GH1A 2IUTA 3O4FA 1GYQA 4XIJA 5CA0F 3JPYA 1PCXA 1Y6RA 3L4SO 1GGEA 4E07A 1FQWA 1K98A 1L8XA 2PLNA 3I52A 3IEPA 3JQFA 3P2JA 4NV3A 2VK4A 3IAFA 5A1TA 3LT5A 4Y1RB 3U16A 3H1EA 4J9UE 4FQ8A 3RC7A 2BBWA 1I14A 1ZNXA 3DZJA 5EZYA 2Q6OA 4AJ2A 4BB6A 3JY6A 5KNCA 2OSVA 4F9TA 5KTTA 1FBTA 3WNBA 1ISGA 3KUKA 1PR1A 4QLAA 1YFKA 3PXAA 1FDUA 2GZ1A 1ULAA 3QPWA 5G4KB 3ZLBA 3T3NA 2RGAA 3G5UA 4OQMA 2EZ4A 4PHHA 3VV3A 4MQEB 3DAOA 3DZCA 4ZT4A 1T5IA 2DJIA 1BJRE 2ZB3A 4OYRA 2HRRA 4XR4A 4Z7NB 1A98A 3MW8A 3AB8A 5IABA 3MUOA 4A10A 1Q7CA 1Q44A 2C3PA 4X85A 4KKXB 5CM2Z 1NQUA 1U0EA 4CG2A 4D7AA 4CRWB 1AS0A 4TKVA 4BMPB 3A26A 4JB0A 2WOJA 1V6SA 1YS4A 1Z06A 2CFRA 1RPTA 2P9ZA 3DL4A 3EPRA 3JQQA 3LAWA 3LC1O 3WQBA 3WDLA 2IJGX 5I4BA 1ADFA 2VBFA 3DE0X 5H83A 2W4QA 2IXTA 3WQRA 4D6YA 4TTSA 5BSHA 1YOVA 2YS7A 3SI7A 4F3KA 1YHZA 3FOFC 1Z7YA 1FLAA 4BP9A 2XKKA 5B6JA 2GPAA 3N6XA 2FFQA 4BNDA 3PNVA 3NHLA 4LOAA 3LPNA 4KFRA 2QLLA 1ZICA 3PDHA 1JR3D 1NNI1 2O8CA 2E87A 3L7YA 4C7OB 1X9GA 2FW6A 2ZWOA 1AJEA 1N6KA 4MDYA 2QVCA 4X54A 1NI4A 3FSEA 2IBSA 3GLHB 3VX4A 3O73A 1AUQA 5KAMA 4DSUA 2JLCA 2CXQA 2DECA 4HYTA 2EGHA 5HM6A 2O1EA 2WHQA 4EGQA 2X7HA 1XQVA 2HFKA 3FYTA 5JBQA 2Q3FA 3IDOA 3OY7A 4MS3A 4MUGA 4NESA 1M6WA 3IAAA 4R40A 1IB6A 3SLKA 1KEKA 4NZ9A 5D51S 4TKVB 4HVTA 2C0PA 1ADGA 5FBHA 3IQWA 5HGJA 4Y1FA 1QHFA 2HWWA 1XN1A 3NBAA 3W5JA 3IFSA 4CPDA 3MAJA 1QGED 3DC2A 2YWFA 2UYYA 3G88A 3SP1A 5KNCD 3MINA 1RYZA 2A6PA 4RADA 1JHMA 1P7PA 4OJMX 3ZVNA 2G7ZA 1PFKA 1Q7EA 2J3HA 4IDGA 2YXPX 3IRVA 3TRFA 1PJ2A 5EZYB 2Q3LA 1DJNA 1P4HA 4AT1A 4M37A 3RYFB 3IHKA 3Q0IA 4LJ9A 1L5KA 2WA2A 4H7PA 2KM1A 2FZLA 1E3DA 1EH5A 1F1BA 2P6OA 4DYVA 5JMTA 2Y1OA 3IERA 4Y8VA 5U4XA 4F7DA 2DHQA 4EY4A 4UNIA 1UXGA 5GONA 2C31A 1F2TB 3NRCA 1OF1A 4JEIA 4Y1GA 3ZQJA 4BFYA 3ZD7A 3HU2A 4PQYA 2BONA 3SYTA 3L7CA 2FJPA 3L1HA 5E8RA 2DFNA 1V95A 1XELA 3JAWB 4R54A 5C7YA 2JHFA 1YVRA 4NBSA 2DFDA 1HNXB 1DCMA 3T9BA 4S2UA 4ZJZA 3HB1A 5KNDD 2F1OA 3Q3HA 2BDUA 2CDNA 4CETA 2IYZA 3OQJA 3DOOA 2NNWB 4ZOLF 2GXAA 3JQAD 2Z2XA 2JGDA 3CVJA 3E6AA 3RTAA 2ZBEA 1W44A 5JAOA 3O21A 4DZZA 1ZN8A 5JS6A 3VNSA 5KJCA 2RGRA 1TQ8A 3O8OA 1K7XB 5FI3A 5F4BA 4WH0A 1N5LA 3V7YA 3ZCSA 5CX1B 3T6KA 1KSGA 5A7HA 3OCVA 4KP7A 1RJ9A 3PDWA 2H4WA 4J03A 1SB9A 4DE5A 4Z0NA 1AC5A 1AO3A 4LK3A 4C08A 3LVFO 1PVVA 4CF4A 1SCAA 4F5ZA 2AR7A 2JLSA 1SUIA 3R0ZA 3R5SA 4HDQB 4KSBA 5ECYA 3RFVA 4BNLA 4P81A 1QWSA 3PEYA 3A9CA 2FHPA 4BFXA 2QLMA 3V8PA 1UPAA 4QREA 4F3CA 4Q82A 2BUBA 3R7BA 1WG8A 4IGIA 3SPXA 3C6YA 3HR7A 5TF4A 1YR9A 3V7WA 3VC3A 1O95D 3U4AA 4DSNA 3IVGA 2REXB 4B81A 1TQ4A 3IOYA 3G2MA 5E6SA 5IK2D 1P2VA 5K3FB 3O03A 3EXEA 4FIDA 2BZSA 2CLHB 2ONZA 2PKXA 4L51A 1YGYA 4UAJA 2WHPA 3IOEA 4V0LA 5F7OA 2GLXA 1C7QA 1K7SN 2Q3JA 4Z8YA 5T4HA 3AH8A 3DQZA 2HUNA 5D5QA 3IJRA 5HVNA 1BFUA 3OOJA 1JEQB 1C7FA 4QUEA 5EFOA 3I01A 1NQTA 5E2BA 4Z9AA 5HNKA 2O3JA 4B2PA 3OPYA 4RL6A 4ESEA 1CT9A 1U4SA 2F43A 1PNTA 3CLKA 4Y2XA 1AO0A 4RTRA 3ICPA 2HC9A 2HV9A 1GQYA 3N2KA 4N5NA 2HCTA 5E9WA 2KBEA 3IL2A 1NE7A 3COZA 2QTVA 3M9WA 4X8MA 2C0QA 3BWYA 4DR3B 3A11A 3OKCA 4V38A 3TQTA 1MQ9A 2WUWE 3ID6C 2Y05A 1D2CA 1EGAA 1MOQA 1N25A 1WPRA 2Q27A 2XMQA 2XTMA 2GZRA 4JEUA 4JT9A 4LVCA 4Z5XA 1T8UA 1P4AA 1EFHA 2ALJA 4NE7A 2BLNA 4RVSA 1QQ5A 2F1RA 2G6TA 3OZDA 3QELA 4V24A 5GPBA 5C34B 2E5LB 3EUWA 4IIXA 4JLWA 1UAYA 2AOWA 4GWLA 4XPZA 1ZG3A 2QM0A 4PU0A 3RFFA 3HZHA 5KJEA 2YFKA 1V1RA 3UVEA 2ECFA 2MU1A 3LS2A 2PFSA 4HRXA 1GZ6A 1M2HA 1YR3A 3D8NA 4C0JA 3V97A 1ZD1A 3HI6A 1Y8AA 2WG0A 2XXBA 4L02A 1HYEA 4I4LA 3RBZA 2BGWA 3WJAA 1DRWA 2NO1A 1RRCA 2V0GA 4Y2SA 4R71A 3EARA 2PHZA 3NTLA 4YTEA 4B40A 5FLYA 1VJ1A 1FQOA 3ZV4A 4EHJA 1JDVA 2A14A 4PSUA 1YZNA 3L8FA 4TS3A 3EVDA 5EYPB 3D1LA 1YVPA 2IYLD 1X7WB 5AVJA 5ABPA 2FXVA 1UEXC 1GLNA 5JYDA 4GXNA 1UP6A 4WY8A 1P8JA 2G1JA 4PLGA 3PE6A 4ZQCB 4ZOLA 2XMSA 2EFYA 1XYVA 3AJ9A 1WW8A 2HRZA 4HLDA 5ALYA 2ZUFA 3HK2A 2IU3A 1BWRA 5IUJC 1JFFA 1Y81A 3G85A 5A5FA 1FDVA 1C5KA 3RWOA 5FPTA 3E7DA 1T5DX 3G8AA 1DIGA 1JJBA 2C4KA 1HH4A 2PAFA 4O29A 2P67A 2X58A 1U8FO 3NTVA 2G04A 3CV3A 3K0HA 2NU9B 2XHEA 4RZIA 4F96A 3B6KA 1H2FA 3TDNA 2PGDA 4L4SA 2CJXA 3FCCA 4LE0A 2IPAB 4O1IA 2DPLA 3VYSB 1N4DA 1YFZA 1ZVJA 2PH3A 1XTRA 3AF4A 3O92A 4YGYA 5HDBB 1P9OA 3C3AA 5I8WA 1OLSA 4FVTA 1RBQA 2PBFA 2VK8A 1J6UA 3F78A 3QFSA 2ZUSA 3TLZA 5HZKA 1L2TA 2I99A 2WT8A 3OT4A 4HPJB 1WW2A 5LP6C 3V8BA 1GD1O 1M76A 4R84A 3ESQA 3RT9A 4A36A 2ILVA 3ZJ4A 2HR1A 4PXAA 3F1LA 3QF7A 2FQYA 3AJRA 4K0RA 1VL1A 3TI9A 4DSOA 3ZHOA 1N3IA 3ASZA 4BDTA 4NFYA 4IFTA 4L5BA 1Z8FA 1C1XB 5HE8A 2YJZA 2ZIAA 2H11A 2QR5A 1R8XA 2V1XA 5LPNA 1XVAA 5MN5A 1JHQA 2XNSA 4XUDA 1U8XX 5JC8A 4RE5A 1EFLA 4CDMA 4M88A 3BD8A 3DXFA 2DWUA 1FVFA 3L1VA 4ZDWA 2UXDB 2W6ID 2EP8A 2CVPA 5TQJA 1M33A 4WKNA 1DAPA 4ZCMA 1LK5A 3UZUA 2J5KA 4QPZA 1SIUA 2UUBB 4RHEA 4AUNA 2XVAA 4BJ5A 1SM4A 1RBMA 5EMLA 1CZRA 2C5HA 3FYUC 2ZJ4A 3LW8A 4GZMA 4XJVA 2RHTA 1SIWA 3MYYA 3MZ0A 3NWJA 3OESA 1QB7A 4HQKA 4DLLA 4Z0PA 1AD2A 1TT5B 3THYB 3W79A 1YCHA 2HWYA 4KDRA 2VPYA 2RB5A 4B48A 2OO5A 4EI9A 2CNWD 2ETVA 1XX6A 1GPYA 2HXSA 4X6LA 3WLFA 5LJIA 4C0LA 2WWHA 1Q2XA 1IEXA 4GXQA 3CZCA 4DUGA 4WVLA 1MENA 4RFLA 1H1DA 5K20A 2JFGA 4KXLA 4K05A 4PCAA 1R3UA 5BN5A 1E9BA 3FPFA 3JRWA 4IG9A 4RIFA 4G5GA 2FUCA 3KP1A 4R1OA 3WISA 4P22A 2QEQA 2XUFA 3OECA 2F62A 3FW1A 4WMLA 2BL4A 3GFPA 4XR9A 5CHEA 4YAOA 4ER0A 2OQ2A 5AKGA 4HWPA 2CNOA 2IP4A 3PJFA 4ONEA 1H4QA 1P9RA 2PR7A 4TT3A 3DW1X 3KKZA 4MHOA 2QT9A 4MGYR 3CZPA 4F5WA 1UJ6A 3NTRA 1P60A 3AEUB 3AFGA 4PANA 3VJRA 2QRJA 1E3WB 5IYZA 1EXWA 2O3RA 1I13A 5ALDA 2GRUA 4C6RA 4LSMA 3JALA 2PMWB 1JE1A 2QXYA 3N2EA 4IX1A 1C14A 3ZDEA 2ET6A 1LDMA 1MB9A 1P9NA 2IYVA 4IEFB 1UP4A 5HJEA 3MFQA 1UWVA 1QSGA 5EP1A 3DMTA 3PE4A 4I7EA 2IPMA 2XCRB 3ZZUA 4TL7A 4ZARA 3SQNA 2ZSUA 3OVMA 3D0OA 1QXSA 2RBEA 3GGJA 1XEXA 4BFUA 4JJZA 1W4LA 4QJIA 1CPYA 4KWCA 4EY8A 4B82A 1WMSA 5BO5A 5DVZA 3OIGA 4OHUA 1FUUA 3A6KA 2H3EA 1HZJA 5JCZA 1VG0B 3W90A 4P92A 3N2ZB 2P5SA 3VKGA 1FX1A 4BO9A 1Y4ZA 1T10A 2XVYA 4RTOA 5J4KA 1EIWA 1OXSC 1NF2A 2ZSIA 3K9BA 2C2XA 3KJIA 4IYRA 1DDIA 1BVUA 4MQLA 3VR2A 1WWKA 3I9NA 3FB4A 1V4VA 5E7MA 2VHYA 3CNOA 4A2WA 3B89A 5C5EA 1GTMA 1XMIA 3LX5A 1JI3A 4JLMA 2YUTA 5AKKA 1MXFA 2OBBA 3JAKA 3L9WA 2NU8A 3WLEA 1CZKA 2XADA 4CFYA 1JPNA 1P5RA 4YI3A 5F5LA 3KU4A 1ODKA 3AVTA 2P9GA 2Y3IA 1PO7A 2RGXA 3OOHA 4WFQA 3SR4A 3TQOA 4X1YA 3FFBA 4TL8A 3C24A 4K03A 2V7PA 1TYZA 2CNNA 3AIKA 2NQTA 2A0UA 4WRRA 5L3QB 2CCGA 2XLBA 1ZP6A 2D4HA 1KYXA 1U7WA 4LKOA 2BZ0A 4RHYA 1J8VA 4V0QA 2FRXA 3A25A 5FAKA 5HJ7A 4V39A 1ITZA 4QQNA 1E58A 1NZJA 4FFSA 3SX0A 3NJRA 4HJRA 4MVJA 3U44A 1GUBA 2JVKA 4F06A 4BE9A 2KQUA 4HDRB 4DV7B 3ROKA 5A4JA 1HO3A 1E6LA 3EXAA 1LTHR 1OB5A 5K6AC 4I46A 1U90A 1VL2A 4WN3A 4G5RA 1RWVA 4OJNA 3KZ1E 2JLZA 2GBPA 4CG3A 1CETA 1GWNA 3AOEC 4HWRA 2WMNB 3DBRA 3ZZ0A 4HKTA 1PN3A 8ATCA 4LTMA 4DGSA 2BGUA 4O4IF 5DZSA 3MAAC 3GPIA 1WBDA 2J67A 3QZUA 3GARA 4FE7A 3NHSA 2NUAA 4KRXA 4TRJA 2EP7A 2UZAA 3BTVA 2X9LA 3L8DA 2RHGB 3RRJA 1JMYA 1STOA 4UCQA 3TK1A 1SKBA 2WVGA 5C1BA 3HJCA 2OV1A 2IVZA 1NMZA 1XAGA 4JJEA 4X7RA 3VO8A 2VCYA 5JAQA 2IX3A 2G1UA 2YIVX 2CLIB 3ZBTA 3ZK7A 1TEVA 3PFKA 5DX1A 4CXMA 4JQOA 1JHYA 4EDHA 2Z4TA 3HKBB 1Z39A 4B47A 4B4UA 4CODB 4UE6A 2QRGA 4MK4A 1SXJD 3T3EA 3UJPA 4D3SA 3UWMA 5LYJF 2QN3A 3D4OA 4KNWA 5FULA 3L0ZA 2RHOA 2BZ1A 2ES4A 3C6BA 3KKEA 3PFNA 4R3WA 4IBOA 4TL6A 3OT1B 1FNDA 4EA9A 3I58A 1H5UA 4NYIQ 4NZZA 2RGGA 2DCUA 5F3DA 5FD8A 5KWIA 4D8TA 3HUTA 1GG9A 3Q40A 4TVKA 2FV8A 2QVYX 3UJDA 1OWNA 2O23A 4UTRA 2WIGA 4I1UA 2XODA 5CXSA 5ER9A 1M0SA 3ZJTA 3IHTA 1LBEA 3C85A 1G59A 4J7UA 2KWIA 4I1YA 5I48A 1MZPA 1VC2A 3IQHX 4MITA 4EPRA 3USZA 2LPMA 2HO5A 4LDNA 1WSWA 1RTTA 4GKVA 3H8VA 1ZXBA 3SIRA 5AXDA 3A2MA 5GJCA 1KI4A 1AZSC 1XLVA 4PZUA 4C0HA 4E6EA 4Y67A 4IDAA 4J29A 4MLCA 5FI0B 2Z08A 4F8YA 2VTKA 1F8GA 1T24A 1GILA 3JQ8A 3O7MA 3QVVA 3IV9A 5I5GA 4LOIA 1S3SA 3EDYA 1PT5A 4LWQA 3QLVA 3RBVA 1Q91A 4J4BA 1KIFA 2ERCA 3IEKA 3OC6A 2H31A 4EK9A 4H2DA 2O8VA 2AHOA 4WL0A 3ABQB 3EVTA 3ISJA 5GTDA 2C4WA 2PQ0A 1R4NB 4UULA 4D8WA 1EFUA 5JWRA 4PLHA 1F6WA 1L8AA 4CKBB 3TXAA 1N9KA 2HD4A 3E81A 3ND9A 2DB3A 2QPLA 4G9GA 3WQHA 3PUVA 3PXGA 3AKDA 2OHVA 4TQUS 1ENZA 5JO9A 2JGIA 3ZI7A 4DQXA 721PA 2AFIB 4G5FA 3D59A 2GCOB 1ZONA 3WLLA 4RD2A 3GMDA 2HMTA 1ECPA 1RLJA 3I45A 1GKUB 3K9NA 1CUGA 1N1EA 1GRNA 1FXSA 3AR3A 3FIJA 1SU4A 3M6XA 4NFLA 3WXMA 4ZI7A 1XTBA 2G9NA 4P1ZA 1NW3A 5DHQA 4H59A 3S29A 3U09A 3OF3A 3U3XA 3LNTA 1L4BA 5IRCD 4JR0A 1O95A 3R4VA 1ESZA 2ODTX 2I67A 1LD3A 2R6HA 2MYPA 3DTYA 4U9IS 1EWKA 4BZWA 2BY4A 5K3OA 4ZCQA 4X6UA 4XD2A 4HAOA 1JR3A 5ILGA 1U3FA 1WV0A 5K7SA 2QE7A 1RPZA 4H08A 3ZXYA 1Y1RA 4JMLA 4Q05A 4X66B 4EX7A 3G7SA 1PZGA 3PI7A 2XMCA 2GPTA 4LA4A 3RGWS 1EG2A 3NQ41 1P3Y1 1SKUA 1R00A 5K3FA 3SNHA 3CVYA 3KDAA 1KFCB 3MOIA 2GGSA 1SWWA 4R7ZA 2OGSA 4FFRA 5AWFC 4DIKA 2R0QC 2ONKA 3PQ2A 4QX6A 1PFWA 3GDHA 2BM0A 1MV8A 3LLSA 4H77A 1F0PA 4OD0A 2I1VB 1HMYA 4EWLA 1ZX1A 3S2GA 2XB6A 5JXHA 3KE8A 4FJ2A 4RY0A 2FUKA 3EPPA 3L5OA 4ZD6A 1W0JA 3QX7A 4ZU3A 2YH2A 3KYJB 1M1NB 4KJZA 1GQSA 2Z1NA 4QM6A 5A3QA 1NDQA 1YIDA 2Z8ZA 1UJMA 4I55F 1AV7A 4HMQA 4JL6A 3U62A 3Q11A 1SO8A 2Q9BA 2OCXA 1EA7A 3H9JA 2C5LA 2OBNA 4B79A 3CNEA 5HK8A 1FS5A 5K0TA 5JAMA 2XHZA 4A15A 3TMAA 3DEKA 6REQA 3DJYA 2AZ4A 3W9YA 4CMHA 2R1VB 3HMQA 4XVQA 4H0FA 1FL9A 1SBNE 4BX2A 4RKQA 2R1ZA 3M6LA 1NXWA 1RADA 3ANLA 3MNFA 3NG1A 3WLMA 5JSFA 1C50A 5J2UB 3V3TA 4RK0A 1TYCA 2DHRA 4ID9A 3DDSA 4N5IX 3I4CA 4AO6A 4BFSA 3L7JA 5J2TB 1W9HA 1CYDA 4TYQA 4I9GA 5KVAA 4R31A 5DP1A 2VWGA 3FETA 4P84A 3UMRA 2WOOA 2H2AA 4KE8A 2BKEA 3C3JA 4XZ3A 1U8TA 4GYYA 1W4ZA 4GM0A 1WDTA 3CH4B 3HVIA 4FYJA 4IUDS 4PYLA 5JPIA 4ZJPA 2O50A 4YDSA 3S81A 1OY1A 1R8SA 4MOWA 5GONB 1I4TD 1GAJA 4MW9A 1GITA 2NO7A 3N59A 3PZBA 2WUDA 3GGGA 2DFTA 2FVXA 4WNAA 5GADl 3VOTA 2X22A 3KQSA 3KT8A 5CPFA 2ZYRA 1AXGA 5HS6A 1JBQA 3BTOA 1IM8A 4KSYA 4LZAA 4F85A 4IQ8A 5M2QA 3EAFA 1I7QB 4JYBA 1NASA 3M4JA 4MMXB 1YB7A 5CYGA 3CEMA 3KYBA 3NBMA 2J9GA 1KYZA 3IALA 2R8OA 2IHUA 4URYR 4Y30A 3W06A 1G6KA 4R16A 5D6NA 5LU8A 3A9UA 3B6JA 1M7BA 3O82A 5SYAA 4X0EA 4BO7A 3TUZC 1NATA 4MDHA 4MKFA 1R5BA 4CKEB 4RULA 2IW3A 4CFSA 2Q0XA 4KXFB 5C5CA 1C2YA 3C8HA 3TQHA 4GVXA 4YJFA 3FPEA 1V4NA 3LUDA 4MS3B 5H9VA 3QLUC 1HFWA 1T4CA 1IN8A 4K6OA 3JD4A 3VTFA 3HPRA 4PG7A 5J40A 1LDYA 3TINA 1KYYA 4F3NA 4F6RB 1YZVA 2QUIA 3BFKA 4XEUA 2QRKA 3V4FA 4CGYA 2DFKB 3RSCA 3KOOA 1RWWA 3EY4A 3RNOA 3SBXA 2C9ZA 1GSOA 4HQ6A 1D2AA 2A5FA 4YB8A 2UZ4A 1T4DA 2AJDA 2VR1A 3GOQA 3HCOA 3NH9A 3JQ7A 4GEKA 1EP2B 2JHCA 2JGLA 3ENQA 2BIFA 2B0CA 2V9ZA 3QG5A 3D0RA 3A31A 1IAQA 4DNQA 4KQMA 1MX1A 3FF4A 3I2KA 4EMTA 1U02A 3L8GA 4R2LA 1QRDA 3KJQA 1XTZA 4ZGGA 2I80A 4KRFA 4XWYA 3A3KA 3AKZA 3ME5A 2VWQA 3R3WA 4IIGA 1UZAA 3ZPXA 4RESA 3I62A 1ZK0A 4A2PA 1CLUA 1Q57A 2V8BA 2WVAA 1IHDA 5JVDB 1SA0A 1KZ1A 5BOVA 1Y1PA 2D6FA 2EYQA 3H97A 2ZJ5A 3REGA 2QKYA 4XW2A 4KH1A 3IH5A 2VYVA 1GFSA 2X4IA 2EZ9A 3A6FA 3N5KA 4R1UA 2QL7A 4UTZA 2LDBA 4XCXA 2P6MA 1RC8A 2FSGA 2Y1LA 1RABA 4N8DA 5BMVB 1T1JA 3NHFA 3T5TA 2W6MA 2R6ZA 4AY3A 4E4YA 1UBJS 2F4NA 2PSEA 2RDMA 3GRYA 4M76B 4URUR 5AHKA 1YRYE 1C81A 1D4AA 1C8KA 1NTOA 1WMEA 3CLRC 1T6NA 4OXIA 4R81A 4UEQA 4TTRA 1RI5A 3ZZTA 5K0NA 1GPJA 5KQMA 4JCOA 4QASA 3GEIA 1XJCA 3NS7A 4HNAB 5EVCA 3AERA 4D9JA 5F2NA 1SHJA 1W2HA 2CFCA 4LDQA 1AHHA 1PQPA 4Y1RA 1NXOA 1XD8A 3ZDCA 5FUQA 2EF0A 2BGIA 2JGNA 3IDQA 1VYTA 3ELUA 3K9LA 2VNIA 1YZQA 4LE2A 2XE4A 2HHAA 3IT1A 2P4EA 5DXJA 2QE7D 4JJ4A 4G65A 2JCSA 3RBXA 5HCIA 3WKCA 4WXMA 4D9MA 2FMKA 5KJ1A 1G41A 3K2QA 3UUWA 4EQ6A 2HLPA 2XUOA 3IVXA 1C7RA 3N8IA 2RC5A 4J4TA 2LKCA 1X1EA 3AIOA 1FVOA 2XRZA 2ZRHA 1Q6ZA 3C3XA 3HEMA 4FBGA 4QWWA 5EAIA 1J0EA 4LCEA 3E0XA 5F1OA 4DMLA 7AT1A 3NTOA 1C80A 3G5TA 3FRHA 4GBJA 1DWPA 5JO0A 1IM5A 1VI6A 4OL9A 4DEYA 3ZYZA 1Y7LA 2O2JA 1WULS 1GGNA 4QAJA 2C5SA 3PDIB 2A9RA 4JI5B 5IBCA 3B5IA 1QPBA 2V7QA 1GJRA 3VZSA 1YDGA 3GPCA 2YW9A 2WMOB 2DRIA 4Q24A 4HEQA 3ROMA 1G7SA 5AM2A 2R4TA 3WWOA 3KXKA 1CEQA 4BUJA 3E2PA 5B12A 2ZXEA 1JILA 3OFSA 4JGBA 4TXNA 1S9DA 1VGVA 3EXG2 4IICA 1HYQA 1ZVKA 1Z4NA 4D96A 2TMDA 3ETHA 2AD5A 5G0WA 2IYFA 4GOKA 2R86A 2CL0X 2ZJ2A 2R7LA 4AROA 4CR7A 2DSTA 1YGPA 2YXEA 1MQAA 4JP3A 4ZALA 4D3ZA 4BNHA 5FL3A 4MWEA 2FPIB 1D1SA 1X8XA 1ZK2A 3FXAA 4WBNB 2IY7A 3LFHA 3GP3A 3K2IA 4HDNA 3OQHA 3DCJA 4RZQA 5KSZA 1GZUA 1SQGA 1UEJA 2D7JA 1OT3A 3HS3A 3L4EA 2JIDA 1UMBB 3G13A 3SEFA 3WO1A 4D3XA 1TK3A 1B2RA 2Y1FA 3EXG1 3VHRA 2P4UA 5KTRA 4MUBA 4IG4A 3PL5A 3PWKA 4TZ0A 2AZXA 4U7JA 4FB5A 3V4RA 5M34A 4M86A 5HM8A 3NDRA 4YRJA 4A91A 2JIZA 2D2XA 1XDWA 5D7NA 3VGPA 5IKXA 3S8EA 2BFEB 3L0CA 4YP0A 1PE0A 3MCVA 4MEJA 3AT1A 1MT0A 1M2OA 1P5JA 2ATEA 2QVXX 3D64A 4RLSA 3WGQA 4BE7B 5EJ5A 4YMVA 4KR0A 1TZ2A 3W8RA 1P19A 4IIBA 1LQTA 3E27A 2P7IA 3ECSA 4PXYA 4F97A 4L3VA 2P9JA 1HL7A 3NCTA 4ABTA 1NXVA 5LP6F 3GZJA 5HIJA 1P0QA 5JAZA 4BKMA 2FTKE 4XDGA 1N2ZA 2IP1A 2NO5A 3AONB 1B8OA 2Q1TA 4G25A 4JVNA 3FJOA 4R9SA 3V42A 1E5VA 5EWJB 1YDEA 1E1CA 1XGKA 1CY0A 2GXQA 3L3BA 5CNKA 1WDMA 4ZAVA 3MF4A 3LOUA 1SC4A 1WDKA 1FK8A 1POWA 1KJZA 8MHTA 5ECDA 1MHPA 2ZKIA 2WIAA 3MIIA 4RMNA 4RW0A 3D7RA 3NIBA 3VAYA 1T9HA 4C2TA 4S1OA 4UFOA 1IQRA 3H5VA 3HWSA 3IQFA 1GPBA 3C3MA 5MDHA 2XR1A 2P9TA 4TPKA 2XWQA 5IWCA 2G1PA 1OXMA 1E96A 1N6IA 1DAKA 4A0RA 1EI9A 1M7GA 3UCFA 4QT0A 5JTTA 4G2NA 2W9XA 2MINA 3DOUA 2YYZA 4IQ4A 4XUCA 1KYIA 1Q7GA 2ZE5A 2XOXA 2WHXA 5ALIA 4D56A 3DO5A 1BKSB 1HOXA 2J33A 4KAXA 2JCGA 4G1BA 4PNEA 1N32B 1DIAA 4CKXA 2YVAA 5L7WA 2QD3A 1FNMA 3PXCX 3ZXIA 3GNQA 1I1QB 4QTTB 5KNLA 3OIUA 4EVQA 1Z0FA 3C5VA 2I9KA 2BFDA 2FPRA 2G5CA 3GLHE 3K09A 3VDXA 4EPVA 1U9YA 1ZD5A 1W0CA 4IRMA 3KO8A 5KOIA 2VO1A 1RQGA 4QARA 2TS1A 2Z83A 2RG1A 4HN4B 2L82A 2WAYA 4KTVE 1BMFD 1FVXA 2DBYA 1BIFA 3F8WA 4LCJA 4N65A 4RD6A 1RSZA 4GE3A 1GKYA 3R5XA 5K1ZA 3V1KA 4BO6A 1EZZA 1HNNA 5GVRA 5L7TA 4JP8A 4G4JA 3I34X 2GD1O 4C4SA 3RR2A 1RXCA 3R77A 1UPFA 3TE7A 2DM6A 1JXAA 1N5DA 2NTVA 3KXDA 3F49S 2FEPA 3E7XA 1M1ZA 1S2LA 1F14A 4ITVA 4HYQA 3U37A 3CH6A 3GAMA 1G2OA 3VZCA 1ECGA 1V25A 3BA1A 4D99A 1G66A 2R60A 4EA8A 2I91A 2IYOA 1AQ6A 2IDZA 1WR8A 2I76A 3PK0A 3PC2A 3OLZA 3TR5A 1FA9A 3X1YA 4D0SA 5B4VA 1MRSA 1QVZA 1U0LA 3EVBA 3PG5A 4FNOA 1VHDA 2P6NA 3CKMA 1V6CA 3LKBA 4KYIB 5DNDA 3GYGA 5I3ZA 3H11A 3I09A 4RK1A 4TYPA 3RAJA 3ZG6A 2PUTA 4F71A 2EBUA 1SCIA 4ZFNA 2XTAA 2ZUEA 5I9IA 4XSVA 5TSDA 3NIFB 3AEXA 1E2MA 3KOMA 3KFXA 2H4ZA 1F3OA 2Q5OA 3GCGA 4IJMA 2B7BA 2B4YA 4WBNA 1Y33E 2FP4A 1AB5A 621PA 1R5NA 5T3YA 4KV7A 1V1JA 4A8JC 4Q4LA 2NU9A 3E8XA 3CUVA 4URVR 1BVHA 3A05A 1IPEA 1KY3A 3MELA 1DAMA 3OWXA 4UBJA 3TS1A 4HT3B 1DUIA 3ASUA 1COZA 4HV4A 1CV2A 2JCVA 1FJHA 1M0TA 2WZCA 2W6JD 4WK4B 4X8OA 2RHJA 4CFZA 2ZM5A 1P39A 4LHYA 1H9AA 3DNMA 3PSAA 4CKZA 1GA6A 3K9GA 5H8WA 1EA5A 3QEMA 2QRVA 4MPDA 1E66A 3PE3A 4KDCA 4RBNA 5DU2A 2QF7A 1PT6A 2PWPA 1W8IA 4OSEA 1M7HA 4CIXA 1HDCA 4MR8B 1HQKA 4RVGA 1IRXA 5KVVA 1QP8A 2ATIA 4K7JA 5CB4B 4OMUA 2JJMA 3FTDA 2PWZA 3TIVA 3R74A 2HIAA 2VH1A 3L7MA 4A26A 3LTNC 1K68A 1WLYA 2PPLA 3HXOA 4CEJA 1I6LA 1ZZEA 4F4DA 4W9MC 1N2GA 4RAQA 1KO4A 2V6JA 1ZGHA 3VH3A 4EKIA 1PV4A 3CB4A 1L4YA 2IZ6A 4G0NA 4LGVA 4ZAFA 4HDMA 3NOXA 1UFKA 2NSYA 1CTQA 3AFOA 5AKZA 1NHGA 4MTCA 1NXTA 1O95C 3BVPA 1AF7A 1B4DA 2P30A 3H9QA 4OBBA 5DB4A 1A9XA 4ZTUB 1RP7A 3DXZA 4NONA 3C7TA 3CSSA 1VB5A 4LBVA 1DU4A 5F2EA 3H7AA 5A04A 4AJKA 1GCUA 4QU5A 2SCUA 4KFTA 2PUGA 1XE3A 2ZS8A 3AR6A 5G0SA 1Y5NA 3GRAA 4FDTA 1TO1E 2P4QA 3G2HA 2Z0MA 3IBYA 2BGGA 1O96B 1AVTA 1SXQA 4TTQA 1P29A 5T64A 2C1XA 2RGYA 4UVGA 2QGNA 3LPCA 2GNAA 3WLRA 1XALA 4DUGD 4E1VA 4F5YA 2W8ZA 4AIRA 2PGIA 4U7WA 5JDIC 3A9VA 3SD7A 5FEUA 1GU7A 5EI5A 2HHLA 3NTUA 3L79A 3AERB 5G0VA 3JVVA 4GYKA 2J9YB 3RLIA 2WJZB 4MGHA 2G1AA 2PS0A 3MGGA 3ZNOA 3UAGA 1WUYA 3N1UA 1UF9A 2BVNA 1LVGA 2RKOA 2WJAA 4EMUA 3TG2A 4BTEA 4N0PA 3VNUA 3M3DA 2WIJA 2ZBFA 1ZCZA 4LMPA 3PX3A 4F5DA