3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3ER8C 3OWGA 2GA9D 2GAFD 3ERCC 3ER9B
chains in the Genus database with same CATH superfamily
4YMOA 3PMLA 4LT6A 3BVUA 5DB8A 4IQTA 4UDXX 4OAHA 3BVWA 3C18A 4EZOA 3C5FA 2ZH3A 5HRBA 9ICAA 3CKDA 3OUYB 5C5BA 2ALWA 1MIYA 4NY8A 2O1PA 3DX4A 1ZJMA 9ICEA 7ICPA 5J0XA 2GAFD 3DPPA 1TV9A 3B53X 4PGYA 4UD4A 3B0YA 4KLDA 1E2UA 4LEYA 4O6AA 2O0I1 3Q84A 5HRLA 8ICBA 4NQIA 2OBLA 5DDYA 4RPXA 2BCUA 3PMNA 3MCRA 4UD5A 4RQ6A 4R66A 4PH5A 4RWNA 5C5BB 4KLTA 2JNKA 2O5AA 2BCRA 4QZIA 4RT2A 4O5KA 2ND1A 1I4TA 4UAZA 2M2VA 4MFAA 2M2UA 5DECA 3HJ4A 4LZDA 1ZQNA 3H39A 4AZ5A 7ICOA 8ICQA 9ICCA 1ZQUA 4TURA 1ZQYA 4I2AA 4OAGA 4QZFA 3HWTA 2DR8A 4I2FA 4EP7A 4LVSA 4K98A 3OK8A 2RFFA 3RJIA 5BPCA 4M9JA 4AT8B 4I2CA 2Q13A 3M3WA 2C08A 3LVTA 1ZQWA 4P4OA 5DBAA 2N3KA 4PHDA 2Z0OA 2ZH4A 4RQ0A 1GN9A 4HX0A 3QNIA 3RH6A 2F7PA 4HR1B 3RH4A 1UEUA 2WINM 4QZDA 1OA0A 4I2DA 2YLLA 4Z6CA 5DB6A 4UBCA 2ZHAA 4YMNA 8ICIA 2ZHBA 4KIKA 4P2HA 3OVBA 3CAZA 2RAKA 1R5EA 4KLGA 3NYBA 4XRHA 3JZ0A 5CP2A 4UDYX 1NO5A 4KLQA 4M9GA 1I4DA 4RWQA 7ICGA 4AT9B 4M5DA 9ICPA 3MDCA 4B9QA 1BPBA 4K9AA 2BCSA 1XSPA 3DDFA 2ZH6A 3CV5A 3BVXA 5J0WA 3BVVA 4DYLA 2DRBA 4O5CA 8ICEA 3PLTA 4FHVA 4X4RA 4IM0A 4NXVA 1SU7A 8ICVA 4ATBA 4MFFA 8ICYA 3DX2A 1KNYA 4M2YA 4PHAA 3MDAA 4HYBA 3I2WA 4FO1A 3LMFA 4JNFA 4RPZA 2P66A 5HHHA 4I2BA 1R8CA 4MFCA 2IHMA 9ICXA 4RQ8A 3ISDA 5D62A 3QNJA 3T47A 4F01A 1ZQHA 3V72A 1R33A 2X3VA 4H6HA 8ICCA 2MI7A 3BUBA 3AQLA 3B0XA 3EJRA 4X4OA 4F5RA 5TKYA 4AT8A 1KDHA 2DR7A 2FMQA 4AZCA 2PBEA 8ICXA 5IIJA 4QZEA 3JPNA 4R5LA 2HN2A 4I0UA 2DR9A 3DYTA 5BOMA 3I04A 3RH5A 4I27A 4EZWA 1ZQPA 1ZWWA 2ZH9A 1JQRA 5TZVA 3T48A 2KHOA 4I2EA 4YN4A 4NXUA 8ICLA 4UB3A 5J29A 3UQ2A 9ICQA 3NVOA 4LEVA 3B51X 1V4AA 5D61A 2OZNB 5CWRA 5J0PA 1QX1A 3KAVA 2ND0A 4XJEA 1ZQDA 9ICWA 3Q0KA 4UAYA 2YL8A 4RQ5A 4JN4A 3JPTA 5IILA 4E81A 4WCWA 3RJEA 3KAWA 4FZOA 4OAIZ 4I2IA 1JQKA 5J0YA 1ZQMA 8ICGA 4EZNA 1X03A 4X5VA 2ZH1A 3D50A 8ICKA 4KB6A 1ZQVA 3B52X 4WC3A 4WBYA 4XUSA 4QZGA 3HAJA 3T46A 4WC1A 2BCVA 3QA8A 9ICNA 1TQUA 1R8AA 4NLZA 3CZNA 3SOGA 5CR0A 4NM1A 4F5PA 4R5GA 3FD9A 4OAFA 3OV7A 3D4ZA 2BPGA 4I29A 4IQWA 3WFRE 3RV0A 3H3AA 2M2TA 3HAIA 3LK9A 3KDRA 1ZQXA 3H37A 4O68A 5J2JA 3H38A 2OW6A 5FLEX 2YIBA 3HAHA 4NM2A 4X0AA 7ICTA 4GXIA 4NKTA 4PHEA 4FZSA 2PMRA 4I28A 4RT3A 3RV1A 3D4YA 4IW0A 4EZUA 1OU5A 5DKWA 3HW8A 1HUOA 1MJGA 1Q79A 2ISPA 4KLSA 3GI7A 9ICJA 1GNLA 5HRHA 4JWDA 4TUPA 4AKVA 3AQMA 1TQWA 4YD2A 4P4MA 1R89A 2B56A 4PGQA 2YIAA 3OGUA 5D63A 2IUBA 4Z6DA 4F5NA 1HTYA 4PO2A 2F18A 2F7OA 4WPEA 2X5CA 2V0OA 5DBCA 4EEBA 4K99A 5D4BA 1TVAA 4E3CA 3AU2A 4M0MA 4E80A 2FCLA 2BPFA 4DCNC 3RJKA 3EJQA 4K4HA 7ICUA 1ZQBA 4RWOA 8ICJA 2Z0VA 5DEDA 2X3XA 4HY9A 2X3WA 3ER8C 1FA0A 4R64A 1ZYLA 4TUSA 2GA9D 5CA7A 9ICMA 4Z6EA 4F5QA 3L3OM 7ICRA 1TQVA 4LEWA 4R63A 1W9MA 2QFFA 1GPJA 4AZ6A 4AZBA 3EJSA 4JWIA 3ERCC 4FHPA 2EWFA 3JPOA 2D1LA 4AT7B 4KLFA 4X0BA 1ZQJA 5CHGA 2DR5A 4WBZA 3WFOA 1NOMA 3UPSA 1F5AA 2F1BA 4YMMA 3HIYA 1HWWA 3HJ1A 3VKHA 2OBMA 4PPXA 2NRKA 4X4PA 3V7JA 2GF4A 8ICPA 1BPYA 8ICTA 3DPQA 4K96A 2F7RA 4IM3A 4BNEA 3D2EA 3CVRA 3DX3A 2ZH2A 3UQ0A 4JLXA 4E7XA 4WC2A 1QWNA 3UXPA 4QZ8A 1SUFA 5BOLA 2B4VA 4EZPA 2ZXQA 1RZTA 4UB5A 1KEJA 4QZHA 4EZQA 2M2WA 3JPRA 4H6IA 2BE3A 4UAWA 1GNTA 2EX3B 4AZ7A 3K75D 4EBKA 5DB7A 1DKYA 4NXTA 4I2JA 3C2MA 4QZ9A 2HHPA 4NSWA 1ZQFA 4NLNA 4F00A 1QWUA 5EOZA 4RQ4A 2FYVA 4M0AA 3UXOA 1ZQZA 4IG8A 4WC4A 5J2HA 1XSLA 4M9HA 8ICNA 8ICOA 5HRKA 1ZQQA 4KLOA 5E84A 1URUA 1VJ7A 4K4GA 5HR9A 3JPQA 3TFRA 4FHXA 1Y2OA 8ICWA 1JN3A 1UETA 4RPYA 4EZRA 2ISOA 4FM3A 4KLJA 1SU6A 4NXWA 4JLCA 2Q66A 4NKUA 4R65A 5JTGA 4O69A 4X4UA 5J2IA 5J2DA 7ICJA 4ATBB 4FH3A 4JNEA 4EZVA 2YIVX 3NKUA 1VFGA 4EZYA 4EZSA 3AU6A 4AZIA 4GXJA 4K9BA 7ICHA 2YL9A 8ICUA 4HR1A 4EZTA 5J0OA 5J2KA 3VEAA 5DDMA 4FZPA 5CFSA 2EWRA 4EZXA 4XQ8A 1LQ7A 2OW7A 4RQ3A 4FH5A 5B3PA 5J2FA 4IWOA 4P4PA 4DOCA 2HN1A 2RAJA 3D52A 3TFSA 1ZQKA 4LEZA 4RWPA 2I9GA 1HUZA 2PY6A 8ICHA 1DKXA 3LLLA 1BPXA 1XSNA 2YL5A 4PGXA 7ICLA 4AT9A 5J2EA 4UBBA 4WQKA 3EJPA 5IIIA 3UXNA 7ICVA 5IIKA 5J0RA 3RPMA 3ER9B 4O5EA 4JWMA 4IQVA 3O3OB 9ICLA 5DB9A 4I2GA 3G9GA 4N7RA 4AT7A 2JNSA 5HREA 1DKZA 3JCFA 4QZBA 1SU8A 4XA5A 5IIMA 4M04A 3BUDA 4X4QA 1MIVA 3A98A 4KLMA 4JLZA 2ZH5A 3AQKA 2DVIA 3WFQE 2RAIA 3DX1A 2PXIA 2BCQA 4R5IA 3K7DA 5B3QA 3GDXA 4IM2A 2VANA 4MKPA 1BPEA 5HRGA 1WDZA 5DBBA 3JPSA 4WQLA 4NLKA 4F5OA 2IHOA 4MF2A 1ZJNA 1ZQOA 1E9VA 2PFPA 1X04A 4AZCB 4M9LA 3ABHA 4R5JA 1U00A 3QE6A 4KLUA 1TQTA 4K97A 1RPLA 4KLHA 3C7NA 2OO2A 3EF2A 4MF8A 2GWSA 5F2VO 4K4IA 4H8SA 4XQ7A 2YL6A 1I49A 4EEDA 3UITA 4R5KA 3O3NB 5J0UA 3F7WA 3ZEDA 5KBPA 4EBJA 8ICFA 8ICAA 4TUQA 3RJJA 4Z6FA 1Q78A 8ICMA 3QWEA 2EFLA 1ZQIA 1TQSA 5J0SA 4QZAA 2FMPA 1TFWA 1ZQEA 3L3PA 3EJUA 4NXXA 3C66A 5J0QA 5J2GA 9ICKA 4WC0A 4KM5A 1I4LA 5J0TA 3DPOA 4QZCA 3OVAA 4YD1A 5CJ7A 1ZQLA 1O7DB 4WC6A 9ICRA 3ISBA 2PFQA 1JMSA 1BPDA 2WYIA 3V7KA 2ID1A 9ICHA 4D8JA 3MGIA 5J2CA 3DX0A 5HRIA 1PX5A 4O9MA 4KLIA 3BUIA 3UPQA 8ICSA 1JAJA 5J2BA 4DO9A 9ICOA 3OHXM 7ICEA 3C5GA 7ICIA 1ZQSA 3SYVA 2FICA 3HX0A 1ZQGA 1ZQTA 4YCXA 1MQ2A 2LM0A 2QXLA 1R8BA 2D4CA 5J2AA 9ICBA 4G6QA 4JWCA 3JPPA 1ZQAA 2Q12A 7ICSA 7ICMA 3AUOA 4M9NA 4X4TA 3ACOA 4UB1A 4AZGA 2BPCA 1WOTA 2YI9A 4FHWA 4KIKB 3BUQA 1YWMA 4JWEA 4ATMA 4UB2A 2PFOA 4DOAA 4JWNA 2RT6A 4IQUA 2YKTA 3D2FA 5D46A 2B51A 1PS3A 2Z0NA 4RQ2A 1UEVA 4LZGA 3WFPA 4EGWA 4S3NA 1YLQA 9ICSA 4RQ7A 3L9DA 3OUYA 3PHZA 1R34A 2ELBA 2ZH7A 5IIOA 9ICFA 4I1QA 3T4AG 3MGHA 1MQ3A 4IWPA 4UB4A 3RJGA 4E8FA 3CZSA 4M47A 3I01A 5CFTA 9ICIA 3DDGA 1OAOA 4NXZA 7ICKA 1BPZA 4FO6A 9ICTA 2W9MA 2Z8YA 4IWQA 3I39X 2EFKA 4K8VA 4X4VA 2WYHA 4WC5A 3O3MB 1MIWA 3AQNA 3BUPA 3LQCB 8ICZA 7ICQA 2PFNA 4AVMA 5FIGA 3JYYA 2DRAA 4PHPA 5CB1A 4WOYA 2ZH8A 3T49A 3MBYA 2BBJA 5HRFA 3V7LA 4AZHA 3RJFA 4X4SA 3C2LA 3ISCA 3VEBA 5CFUA 3EJTA 3BVTA 5HHIA 7ICFA 9ICGA 3CK6A 4KLEA 8ICRA 4WC7A 9ICUA 4O67A 1HXKA 3OVSA 2FMSA 3C2KA 2YLAA 4GXKA 3NWIA 4JL9A 3RJHA 1TFYA 5D49A 4EZZA 1OA1A 2LXYA 3PNCA 2F1AA 4RQ1A 4FHYA 4KLLA 1UPXA 1ZQCA 3OWGA 9ICVA 4X4NA 2QKWA 5HRDA 1O7DC 4WH5A 3BLBA 4I2HA 2YI8A 1E1DA 2F7QA 5IINA 3WFSC 4DOBA 2BBHA 4EV6A 1ZQRA 4NPHA 3D51A 7ICNA 5HC9A 2NCZA 5CHEA 4WPCA
chains in the Genus database with same CATH topology
2KHOA 4NXUA 4EZQA 4H6IA 4KM5A 1GNTA 2EX3B 3DPOA 4UDXX 4LEVA 4OAHA 3B51X 5D61A 4EZOA 1DKYA 4NXTA 4XJEA 3KAVA 2ND0A 4F00A 2GAFD 3DPPA 4JN4A 4D8JA 4E81A 3B53X 3KAWA 1E2UA 4LEYA 4O6AA 4OAIZ 1JQKA 3OHXM 5E84A 2OBLA 4EZNA 3MCRA 2LM0A 2QXLA 4KB6A 4EZRA 4FM3A 3B52X 4G6QA 1SU6A 4JWCA 4NXWA 4JLCA 3T46A 4O69A 2ND1A 3QA8A 4JNEA 4EZVA 2YIVX 3NKUA 4R5GA 2YI9A 3FD9A 4EZYA 4KIKB 4EZSA 4OAFA 4K9BA 3RV0A 4JWEA 4HR1A 4EZTA 2RT6A 3KDRA 3VEAA 4O68A 3D2FA 5FLEX 2YIBA 5CFSA 2EWRA 4EZXA 2B51A 4OAGA 4K98A 5B3PA 4IWOA 2N3KA 3RV1A 4LEZA 4IW0A 4EZUA 1GN9A 1MJGA 4HX0A 3GI7A 2PY6A 3PHZA 1GNLA 4HR1B 4JWDA 1DKXA 3T4AG 2WINM 2B56A 4IWPA 1OA0A 2YIAA 3I01A 5D63A 4WQKA 5CFTA 1OAOA 4PO2A 2X5CA 4KIKA 4K99A 3ER9B 4E3CA 2Z8YA 4IWQA 3I39X 3O3OB 4M0MA 4K8VA 4N7RA 3O3MB 2JNSA 2FCLA 1DKZA 5FIGA 1SU8A 4WOYA 3A98A 4UDYX 3T49A 4JLZA 4B9QA 4K9AA 4R5IA 3VEBA 3K7DA 5B3QA 4HY9A 5CFUA 3ER8C 1ZYLA 4IM2A 4MKPA 2GA9D 4O67A 4IM0A 4WQLA 4NXVA 2IHOA 1SU7A 1E9VA 3L3OM 4JL9A 4LEWA 4R5JA 4HYBA 1W9MA 2QFFA 3LMFA 1U00A 4JNFA 4JWIA 1GPJA 4EZZA 3ERCC 4FO1A 2EWFA 1OA1A 3C7NA 4K97A 3EF2A 5D62A 1UPXA 3QNJA 3T47A 3OWGA 4F01A 2OBMA 4R5KA 3O3NB 4H6HA 3F7WA 3UITA 3ZEDA 3VKHA 5TKYA 4WH5A 3DPQA 4R5LA 4K96A 4IM3A 2YI8A 1E1DA 3D2EA 4JLXA 3I04A 4EZWA 1SUFA 4NPHA 2B4VA 4EZPA 4NXXA 2NCZA 5CHEA 3T48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER8 C;  3OWG A;  2GA9 D;  2GAF D;  3ERC C;  3ER9 B; 
#chains in the Genus database with same CATH topology
 4YMO A;  3PML A;  4LT6 A;  3BVU A;  5DB8 A;  4IQT A;  4UDX X;  4OAH A;  3BVW A;  3C18 A;  4EZO A;  3C5F A;  2ZH3 A;  5HRB A;  9ICA A;  3CKD A;  3OUY B;  5C5B A;  2ALW A;  1MIY A;  4NY8 A;  2O1P A;  3DX4 A;  1ZJM A;  9ICE A;  7ICP A;  5J0X A;  2GAF D;  3DPP A;  1TV9 A;  3B53 X;  4PGY A;  4UD4 A;  3B0Y A;  4KLD A;  1E2U A;  4LEY A;  4O6A A;  2O0I 1;  3Q84 A;  5HRL A;  8ICB A;  4NQI A;  2OBL A;  5DDY A;  4RPX A;  2BCU A;  3PMN A;  3MCR A;  4UD5 A;  4RQ6 A;  4R66 A;  4PH5 A;  4RWN A;  5C5B B;  4KLT A;  2JNK A;  2O5A A;  2BCR A;  4QZI A;  4RT2 A;  4O5K A;  2ND1 A;  1I4T A;  4UAZ A;  2M2V A;  4MFA A;  2M2U A;  5DEC A;  3HJ4 A;  4LZD A;  1ZQN A;  3H39 A;  4AZ5 A;  7ICO A;  8ICQ A;  9ICC A;  1ZQU A;  4TUR A;  1ZQY A;  4I2A A;  4OAG A;  4QZF A;  3HWT A;  2DR8 A;  4I2F A;  4EP7 A;  4LVS A;  4K98 A;  3OK8 A;  2RFF A;  3RJI A;  5BPC A;  4M9J A;  4AT8 B;  4I2C A;  2Q13 A;  3M3W A;  2C08 A;  3LVT A;  1ZQW A;  4P4O A;  5DBA A;  2N3K A;  4PHD A;  2Z0O A;  2ZH4 A;  4RQ0 A;  1GN9 A;  4HX0 A;  3QNI A;  3RH6 A;  2F7P A;  4HR1 B;  3RH4 A;  1UEU A;  2WIN M;  4QZD A;  1OA0 A;  4I2D A;  2YLL A;  4Z6C A;  5DB6 A;  4UBC A;  2ZHA A;  4YMN A;  8ICI A;  2ZHB A;  4KIK A;  4P2H A;  3OVB A;  3CAZ A;  2RAK A;  1R5E A;  4KLG A;  3NYB A;  4XRH A;  3JZ0 A;  5CP2 A;  4UDY X;  1NO5 A;  4KLQ A;  4M9G A;  1I4D A;  4RWQ A;  7ICG A;  4AT9 B;  4M5D A;  9ICP A;  3MDC A;  4B9Q A;  1BPB A;  4K9A A;  2BCS A;  1XSP A;  3DDF A;  2ZH6 A;  3CV5 A;  3BVX A;  5J0W A;  3BVV A;  4DYL A;  2DRB A;  4O5C A;  8ICE A;  3PLT A;  4FHV A;  4X4R A;  4IM0 A;  4NXV A;  1SU7 A;  8ICV A;  4ATB A;  4MFF A;  8ICY A;  3DX2 A;  1KNY A;  4M2Y A;  4PHA A;  3MDA A;  4HYB A;  3I2W A;  4FO1 A;  3LMF A;  4JNF A;  4RPZ A;  2P66 A;  5HHH A;  4I2B A;  1R8C A;  4MFC A;  2IHM A;  9ICX A;  4RQ8 A;  3ISD A;  5D62 A;  3QNJ A;  3T47 A;  4F01 A;  1ZQH A;  3V72 A;  1R33 A;  2X3V A;  4H6H A;  8ICC A;  2MI7 A;  3BUB A;  3AQL A;  3B0X A;  3EJR A;  4X4O A;  4F5R A;  5TKY A;  4AT8 A;  1KDH A;  2DR7 A;  2FMQ A;  4AZC A;  2PBE A;  8ICX A;  5IIJ A;  4QZE A;  3JPN A;  4R5L A;  2HN2 A;  4I0U A;  2DR9 A;  3DYT A;  5BOM A;  3I04 A;  3RH5 A;  4I27 A;  4EZW A;  1ZQP A;  1ZWW A;  2ZH9 A;  1JQR A;  5TZV A;  3T48 A;  2KHO A;  4I2E A;  4YN4 A;  4NXU A;  8ICL A;  4UB3 A;  5J29 A;  3UQ2 A;  9ICQ A;  3NVO A;  4LEV A;  3B51 X;  1V4A A;  5D61 A;  2OZN B;  5CWR A;  5J0P A;  1QX1 A;  3KAV A;  2ND0 A;  4XJE A;  1ZQD A;  9ICW A;  3Q0K A;  4UAY A;  2YL8 A;  4RQ5 A;  4JN4 A;  3JPT A;  5IIL A;  4E81 A;  4WCW A;  3RJE A;  3KAW A;  4FZO A;  4OAI Z;  4I2I A;  1JQK A;  5J0Y A;  1ZQM A;  8ICG A;  4EZN A;  1X03 A;  4X5V A;  2ZH1 A;  3D50 A;  8ICK A;  4KB6 A;  1ZQV A;  3B52 X;  4WC3 A;  4WBY A;  4XUS A;  4QZG A;  3HAJ A;  3T46 A;  4WC1 A;  2BCV A;  3QA8 A;  9ICN A;  1TQU A;  1R8A A;  4NLZ A;  3CZN A;  3SOG A;  5CR0 A;  4NM1 A;  4F5P A;  4R5G A;  3FD9 A;  4OAF A;  3OV7 A;  3D4Z A;  2BPG A;  4I29 A;  4IQW A;  3WFR E;  3RV0 A;  3H3A A;  2M2T A;  3HAI A;  3LK9 A;  3KDR A;  1ZQX A;  3H37 A;  4O68 A;  5J2J A;  3H38 A;  2OW6 A;  5FLE X;  2YIB A;  3HAH A;  4NM2 A;  4X0A A;  7ICT A;  4GXI A;  4NKT A;  4PHE A;  4FZS A;  2PMR A;  4I28 A;  4RT3 A;  3RV1 A;  3D4Y A;  4IW0 A;  4EZU A;  1OU5 A;  5DKW A;  3HW8 A;  1HUO A;  1MJG A;  1Q79 A;  2ISP A;  4KLS A;  3GI7 A;  9ICJ A;  1GNL A;  5HRH A;  4JWD A;  4TUP A;  4AKV A;  3AQM A;  1TQW A;  4YD2 A;  4P4M A;  1R89 A;  2B56 A;  4PGQ A;  2YIA A;  3OGU A;  5D63 A;  2IUB A;  4Z6D A;  4F5N A;  1HTY A;  4PO2 A;  2F18 A;  2F7O A;  4WPE A;  2X5C A;  2V0O A;  5DBC A;  4EEB A;  4K99 A;  5D4B A;  1TVA A;  4E3C A;  3AU2 A;  4M0M A;  4E80 A;  2FCL A;  2BPF A;  4DCN C;  3RJK A;  3EJQ A;  4K4H A;  7ICU A;  1ZQB A;  4RWO A;  8ICJ A;  2Z0V A;  5DED A;  2X3X A;  4HY9 A;  2X3W A;  3ER8 C;  1FA0 A;  4R64 A;  1ZYL A;  4TUS A;  2GA9 D;  5CA7 A;  9ICM A;  4Z6E A;  4F5Q A;  3L3O M;  7ICR A;  1TQV A;  4LEW A;  4R63 A;  1W9M A;  2QFF A;  1GPJ A;  4AZ6 A;  4AZB A;  3EJS A;  4JWI A;  3ERC C;  4FHP A;  2EWF A;  3JPO A;  2D1L A;  4AT7 B;  4KLF A;  4X0B A;  1ZQJ A;  5CHG A;  2DR5 A;  4WBZ A;  3WFO A;  1NOM A;  3UPS A;  1F5A A;  2F1B A;  4YMM A;  3HIY A;  1HWW A;  3HJ1 A;  3VKH A;  2OBM A;  4PPX A;  2NRK A;  4X4P A;  3V7J A;  2GF4 A;  8ICP A;  1BPY A;  8ICT A;  3DPQ A;  4K96 A;  2F7R A;  4IM3 A;  4BNE A;  3D2E A;  3CVR A;  3DX3 A;  2ZH2 A;  3UQ0 A;  4JLX A;  4E7X A;  4WC2 A;  1QWN A;  3UXP A;  4QZ8 A;  1SUF A;  5BOL A;  2B4V A;  4EZP A;  2ZXQ A;  1RZT A;  4UB5 A;  1KEJ A;  4QZH A;  4EZQ A;  2M2W A;  3JPR A;  4H6I A;  2BE3 A;  4UAW A;  1GNT A;  2EX3 B;  4AZ7 A;  3K75 D;  4EBK A;  5DB7 A;  1DKY A;  4NXT A;  4I2J A;  3C2M A;  4QZ9 A;  2HHP A;  4NSW A;  1ZQF A;  4NLN A;  4F00 A;  1QWU A;  5EOZ A;  4RQ4 A;  2FYV A;  4M0A A;  3UXO A;  1ZQZ A;  4IG8 A;  4WC4 A;  5J2H A;  1XSL A;  4M9H A;  8ICN A;  8ICO A;  5HRK A;  1ZQQ A;  4KLO A;  5E84 A;  1URU A;  1VJ7 A;  4K4G A;  5HR9 A;  3JPQ A;  3TFR A;  4FHX A;  1Y2O A;  8ICW A;  1JN3 A;  1UET A;  4RPY A;  4EZR A;  2ISO A;  4FM3 A;  4KLJ A;  1SU6 A;  4NXW A;  4JLC A;  2Q66 A;  4NKU A;  4R65 A;  5JTG A;  4O69 A;  4X4U A;  5J2I A;  5J2D A;  7ICJ A;  4ATB B;  4FH3 A;  4JNE A;  4EZV A;  2YIV X;  3NKU A;  1VFG A;  4EZY A;  4EZS A;  3AU6 A;  4AZI A;  4GXJ A;  4K9B A;  7ICH A;  2YL9 A;  8ICU A;  4HR1 A;  4EZT A;  5J0O A;  5J2K A;  3VEA A;  5DDM A;  4FZP A;  5CFS A;  2EWR A;  4EZX A;  4XQ8 A;  1LQ7 A;  2OW7 A;  4RQ3 A;  4FH5 A;  5B3P A;  5J2F A;  4IWO A;  4P4P A;  4DOC A;  2HN1 A;  2RAJ A;  3D52 A;  3TFS A;  1ZQK A;  4LEZ A;  4RWP A;  2I9G A;  1HUZ A;  2PY6 A;  8ICH A;  1DKX A;  3LLL A;  1BPX A;  1XSN A;  2YL5 A;  4PGX A;  7ICL A;  4AT9 A;  5J2E A;  4UBB A;  4WQK A;  3EJP A;  5III A;  3UXN A;  7ICV A;  5IIK A;  5J0R A;  3RPM A;  3ER9 B;  4O5E A;  4JWM A;  4IQV A;  3O3O B;  9ICL A;  5DB9 A;  4I2G A;  3G9G A;  4N7R A;  4AT7 A;  2JNS A;  5HRE A;  1DKZ A;  3JCF A;  4QZB A;  1SU8 A;  4XA5 A;  5IIM A;  4M04 A;  3BUD A;  4X4Q A;  1MIV A;  3A98 A;  4KLM A;  4JLZ A;  2ZH5 A;  3AQK A;  2DVI A;  3WFQ E;  2RAI A;  3DX1 A;  2PXI A;  2BCQ A;  4R5I A;  3K7D A;  5B3Q A;  3GDX A;  4IM2 A;  2VAN A;  4MKP A;  1BPE A;  5HRG A;  1WDZ A;  5DBB A;  3JPS A;  4WQL A;  4NLK A;  4F5O A;  2IHO A;  4MF2 A;  1ZJN A;  1ZQO A;  1E9V A;  2PFP A;  1X04 A;  4AZC B;  4M9L A;  3ABH A;  4R5J A;  1U00 A;  3QE6 A;  4KLU A;  1TQT A;  4K97 A;  1RPL A;  4KLH A;  3C7N A;  2OO2 A;  3EF2 A;  4MF8 A;  2GWS A;  5F2V O;  4K4I A;  4H8S A;  4XQ7 A;  2YL6 A;  1I49 A;  4EED A;  3UIT A;  4R5K A;  3O3N B;  5J0U A;  3F7W A;  3ZED A;  5KBP A;  4EBJ A;  8ICF A;  8ICA A;  4TUQ A;  3RJJ A;  4Z6F A;  1Q78 A;  8ICM A;  3QWE A;  2EFL A;  1ZQI A;  1TQS A;  5J0S A;  4QZA A;  2FMP A;  1TFW A;  1ZQE A;  3L3P A;  3EJU A;  4NXX A;  3C66 A;  5J0Q A;  5J2G A;  9ICK A;  4WC0 A;  4KM5 A;  1I4L A;  5J0T A;  3DPO A;  4QZC A;  3OVA A;  4YD1 A;  5CJ7 A;  1ZQL A;  1O7D B;  4WC6 A;  9ICR A;  3ISB A;  2PFQ A;  1JMS A;  1BPD A;  2WYI A;  3V7K A;  2ID1 A;  9ICH A;  4D8J A;  3MGI A;  5J2C A;  3DX0 A;  5HRI A;  1PX5 A;  4O9M A;  4KLI A;  3BUI A;  3UPQ A;  8ICS A;  1JAJ A;  5J2B A;  4DO9 A;  9ICO A;  3OHX M;  7ICE A;  3C5G A;  7ICI A;  1ZQS A;  3SYV A;  2FIC A;  3HX0 A;  1ZQG A;  1ZQT A;  4YCX A;  1MQ2 A;  2LM0 A;  2QXL A;  1R8B A;  2D4C A;  5J2A A;  9ICB A;  4G6Q A;  4JWC A;  3JPP A;  1ZQA A;  2Q12 A;  7ICS A;  7ICM A;  3AUO A;  4M9N A;  4X4T A;  3ACO A;  4UB1 A;  4AZG A;  2BPC A;  1WOT A;  2YI9 A;  4FHW A;  4KIK B;  3BUQ A;  1YWM A;  4JWE A;  4ATM A;  4UB2 A;  2PFO A;  4DOA A;  4JWN A;  2RT6 A;  4IQU A;  2YKT A;  3D2F A;  5D46 A;  2B51 A;  1PS3 A;  2Z0N A;  4RQ2 A;  1UEV A;  4LZG A;  3WFP A;  4EGW A;  4S3N A;  1YLQ A;  9ICS A;  4RQ7 A;  3L9D A;  3OUY A;  3PHZ A;  1R34 A;  2ELB A;  2ZH7 A;  5IIO A;  9ICF A;  4I1Q A;  3T4A G;  3MGH A;  1MQ3 A;  4IWP A;  4UB4 A;  3RJG A;  4E8F A;  3CZS A;  4M47 A;  3I01 A;  5CFT A;  9ICI A;  3DDG A;  1OAO A;  4NXZ A;  7ICK A;  1BPZ A;  4FO6 A;  9ICT A;  2W9M A;  2Z8Y A;  4IWQ A;  3I39 X;  2EFK A;  4K8V A;  4X4V A;  2WYH A;  4WC5 A;  3O3M B;  1MIW A;  3AQN A;  3BUP A;  3LQC B;  8ICZ A;  7ICQ A;  2PFN A;  4AVM A;  5FIG A;  3JYY A;  2DRA A;  4PHP A;  5CB1 A;  4WOY A;  2ZH8 A;  3T49 A;  3MBY A;  2BBJ A;  5HRF A;  3V7L A;  4AZH A;  3RJF A;  4X4S A;  3C2L A;  3ISC A;  3VEB A;  5CFU A;  3EJT A;  3BVT A;  5HHI A;  7ICF A;  9ICG A;  3CK6 A;  4KLE A;  8ICR A;  4WC7 A;  9ICU A;  4O67 A;  1HXK A;  3OVS A;  2FMS A;  3C2K A;  2YLA A;  4GXK A;  3NWI A;  4JL9 A;  3RJH A;  1TFY A;  5D49 A;  4EZZ A;  1OA1 A;  2LXY A;  3PNC A;  2F1A A;  4RQ1 A;  4FHY A;  4KLL A;  1UPX A;  1ZQC A;  3OWG A;  9ICV A;  4X4N A;  2QKW A;  5HRD A;  1O7D C;  4WH5 A;  3BLB A;  4I2H A;  2YI8 A;  1E1D A;  2F7Q A;  5IIN A;  3WFS C;  4DOB A;  2BBH A;  4EV6 A;  1ZQR A;  4NPH A;  3D51 A;  7ICN A;  5HC9 A;  2NCZ A;  5CHE A;  4WPC A; 
#chains in the Genus database with same CATH homology
 2KHO A;  4NXU A;  4EZQ A;  4H6I A;  4KM5 A;  1GNT A;  2EX3 B;  3DPO A;  4UDX X;  4LEV A;  4OAH A;  3B51 X;  5D61 A;  4EZO A;  1DKY A;  4NXT A;  4XJE A;  3KAV A;  2ND0 A;  4F00 A;  2GAF D;  3DPP A;  4JN4 A;  4D8J A;  4E81 A;  3B53 X;  3KAW A;  1E2U A;  4LEY A;  4O6A A;  4OAI Z;  1JQK A;  3OHX M;  5E84 A;  2OBL A;  4EZN A;  3MCR A;  2LM0 A;  2QXL A;  4KB6 A;  4EZR A;  4FM3 A;  3B52 X;  4G6Q A;  1SU6 A;  4JWC A;  4NXW A;  4JLC A;  3T46 A;  4O69 A;  2ND1 A;  3QA8 A;  4JNE A;  4EZV A;  2YIV X;  3NKU A;  4R5G A;  2YI9 A;  3FD9 A;  4EZY A;  4KIK B;  4EZS A;  4OAF A;  4K9B A;  3RV0 A;  4JWE A;  4HR1 A;  4EZT A;  2RT6 A;  3KDR A;  3VEA A;  4O68 A;  3D2F A;  5FLE X;  2YIB A;  5CFS A;  2EWR A;  4EZX A;  2B51 A;  4OAG A;  4K98 A;  5B3P A;  4IWO A;  2N3K A;  3RV1 A;  4LEZ A;  4IW0 A;  4EZU A;  1GN9 A;  1MJG A;  4HX0 A;  3GI7 A;  2PY6 A;  3PHZ A;  1GNL A;  4HR1 B;  4JWD A;  1DKX A;  3T4A G;  2WIN M;  2B56 A;  4IWP A;  1OA0 A;  2YIA A;  3I01 A;  5D63 A;  4WQK A;  5CFT A;  1OAO A;  4PO2 A;  2X5C A;  4KIK A;  4K99 A;  3ER9 B;  4E3C A;  2Z8Y A;  4IWQ A;  3I39 X;  3O3O B;  4M0M A;  4K8V A;  4N7R A;  3O3M B;  2JNS A;  2FCL A;  1DKZ A;  5FIG A;  1SU8 A;  4WOY A;  3A98 A;  4UDY X;  3T49 A;  4JLZ A;  4B9Q A;  4K9A A;  4R5I A;  3VEB A;  3K7D A;  5B3Q A;  4HY9 A;  5CFU A;  3ER8 C;  1ZYL A;  4IM2 A;  4MKP A;  2GA9 D;  4O67 A;  4IM0 A;  4WQL A;  4NXV A;  2IHO A;  1SU7 A;  1E9V A;  3L3O M;  4JL9 A;  4LEW A;  4R5J A;  4HYB A;  1W9M A;  2QFF A;  3LMF A;  1U00 A;  4JNF A;  4JWI A;  1GPJ A;  4EZZ A;  3ERC C;  4FO1 A;  2EWF A;  1OA1 A;  3C7N A;  4K97 A;  3EF2 A;  5D62 A;  1UPX A;  3QNJ A;  3T47 A;  3OWG A;  4F01 A;  2OBM A;  4R5K A;  3O3N B;  4H6H A;  3F7W A;  3UIT A;  3ZED A;  3VKH A;  5TKY A;  4WH5 A;  3DPQ A;  4R5L A;  4K96 A;  4IM3 A;  2YI8 A;  1E1D A;  3D2E A;  4JLX A;  3I04 A;  4EZW A;  1SUF A;  4NPH A;  2B4V A;  4EZP A;  4NXX A;  2NCZ A;  5CHE A;  3T48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...