3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
2GA9D 3ER8C 2GAFD 3OWGA 3ER9B 3ERCC
chains in the Genus database with same CATH superfamily
2X5CA 4NM1A 2ZH7A 3OK8A 3CV5A 8ICLA 5CFSA 4IWOA 4FHYA 2ISOA 4WOYA 2GA9D 3D52A 3EJQA 2ND1A 4KLUA 4BNEA 3AQLA 1XSLA 4EEBA 3QNIA 3KAVA 5C5BA 1R8BA 4IM2A 3WFQE 4TURA 1YLQA 3DX1A 5DEDA 3DPOA 3C5FA 1TV9A 4AZCA 4K4IA 4JNEA 8ICAA 4JWCA 1GNTA 2YIVX 7ICKA 4IG8A 2YL8A 3RJEA 4UDXX 4S3NA 4I29A 2IHOA 1JAJA 9ICLA 4F5RA 4NLZA 4EBKA 5CR0A 5J2BA 1ZQJA 3GDXA 2B51A 4FM3A 4P2HA 4RQ1A 2VANA 4EZTA 1R8CA 4RPZA 4P4OA 4QZBA 1MIWA 3UPQA 2D4CA 4FZPA 4AVMA 5BPCA 7ICRA 4F5NA 9ICTA 2EWRA 4X4OA 1ZQLA 2O5AA 2M2TA 1Q79A 2IUBA 3JCFA 8ICYA 8ICVA 3BVUA 2Q13A 9ICVA 2BE3A 3PNCA 2Z0OA 3UXOA 5IILA 1HUZA 4WC2A 4KM5A 4IQUA 1SU8A 5HREA 2BPCA 3C5GA 7ICLA 3WFSC 3K75D 5HRDA 1ZQHA 3KAWA 4PHAA 1TQVA 3UQ0A 4AT8A 2ZH4A 7ICHA 2GWSA 4M9LA 8ICQA 3RJGA 1ZQIA 3BUBA 4XUSA 2NCZA 3DX4A 5IIJA 4K4HA 4AZBA 3CAZA 4IWQA 3HIYA 2V0OA 5J2JA 3VEAA 4K99A 1ZQTA 3B52X 3RPMA 3I01A 3AQKA 7ICFA 4YMNA 4O67A 4LVSA 3NYBA 2YIAA 3RH5A 2M2WA 5CA7A 5HRBA 4IQWA 3CK6A 4WQLA 3CKDA 4KLMA 9ICPA 3HJ4A 2ZH2A 5IIMA 4MKPA 5IIIA 4I2DA 3EJPA 4IM3A 5CJ7A 4GXIA 5J2AA 4NLKA 3BUDA 3LLLA 8ICTA 5CB1A 2QKWA 4NXXA 4PGYA 4KLJA 4KLEA 1JQRA 4QZ9A 1E9VA 5DBCA 1X03A 4QZAA 2M2VA 4QZHA 2W9MA 3MDCA 4M04A 9ICCA 2ID1A 2IHMA 1BPYA 2FMQA 4EZVA 3JZ0A 2Z8YA 4H6HA 3ER9B 4RQ6A 4GXKA 4DOBA 4FH3A 5HHHA 1JN3A 4I2BA 3QE6A 3DX2A 4AZ6A 1TQTA 4M47A 2N3KA 2F7QA 3I04A 4E80A 2F7OA 2Z0NA 4EZXA 1XSNA 3T46A 3RH6A 1R89A 3UQ2A 2O0I1 2ELBA 3RV1A 3PMLA 4DO9A 7ICQA 2BCRA 1URUA 3D51A 4AT8B 5CFTA 2O1PA 1JQKA 2PBEA 3OWGA 3VKHA 3M3WA 4K8VA 4R65A 3D2FA 4RWPA 1ZQVA 4M9HA 4XQ7A 3C7NA 2BPFA 5HRFA 3QWEA 3WFRE 2PMRA 5CHGA 4EZRA 3KDRA 1ZQQA 4NY8A 1TFYA 3O3NB 4OAFA 8ICZA 1ZQUA 5DECA 3C2LA 4G6QA 5D61A 3L9DA 2RFFA 4RPXA 4I2IA 2ZH9A 3DDGA 3LMFA 5IIOA 4KLQA 4K96A 2ALWA 4DYLA 1W9MA 2WYIA 5J2CA 4RT3A 4LZGA 8ICMA 5HHIA 4RQ4A 7ICUA 3SOGA 3VEBA 8ICBA 1VJ7A 4EZSA 4M5DA 4K9AA 1ZQRA 3DPPA 3WFOA 1NO5A 4AZGA 4Z6DA 4I1QA 4NLNA 5F2VO 4RWOA 2BCQA 1ZQZA 1X04A 4JLZA 4E3CA 5J0SA 1R33A 4QZ8A 5J0OA 4IWPA 4UB2A 1Y2OA 3MDAA 8ICWA 4UD5A 4X4NA 4XRHA 5D49A 5DB7A 1MQ3A 3B0XA 4FHWA 3T48A 1UEUA 9ICKA 2OBLA 4HY9A 1NOMA 4KIKB 4M2YA 1ZQPA 4UB3A 2X3WA 1ZQWA 4WC1A 4PO2A 9ICGA 2ZH6A 1PS3A 3HAIA 2C08A 1ZQFA 3D50A 4KLIA 2EFLA 3QA8A 2I9GA 3OGUA 4NXUA 4KLTA 3T49A 1SU7A 4ATMA 2HHPA 4M0MA 3V7LA 2ZH3A 4AT9A 5KBPA 4WBYA 3MGHA 3JPTA 2RAJA 4K98A 1LQ7A 3FD9A 4P4PA 1HXKA 1SU6A 3Q0KA 3HAHA 4KLSA 4OAIZ 4QZGA 7ICPA 5TZVA 3A98A 3WFPA 1BPEA 1TQSA 2D1LA 2FICA 3D4YA 4EP7A 4UB4A 5BOMA 3TFRA 2FYVA 3ER8C 4FH5A 1ZQSA 4KLLA 1R34A 1OA1A 4O5EA 5J2GA 4YD1A 3B53X 2Z0VA 4TUSA 1FA0A 4X4QA 4X5VA 4IW0A 3DX0A 4Z6CA 2PFPA 3DDFA 4WC4A 2OW7A 3Q84A 4WQKA 1KNYA 4QZDA 4JN4A 4RPYA 4R5LA 5DKWA 2BCSA 3BVTA 3HX0A 1TQWA 3B0YA 5D62A 4KB6A 1WDZA 7ICJA 4I0UA 4Z6FA 1TVAA 4NM2A 2YLAA 2WYHA 4TUPA 3EJSA 9ICXA 4UB1A 1OA0A 4IQTA 4X4TA 3MGIA 2FCLA 5DB6A 3TFSA 1UEVA 1GN9A 4KIKA 2DR8A 4EZQA 3NKUA 3C2MA 3ACOA 4R5IA 2YLLA 4WBZA 4EZNA 2B4VA 4HX0A 1XSPA 3T4AG 1I49A 4AZHA 5JTGA 3RJKA 7ICVA 4UDYX 4NXZA 4RQ8A 1RZTA 1Q78A 5DB8A 2RT6A 4QZFA 3JPSA 1DKZA 4F01A 2OZNB 3HAJA 4E7XA 4QZEA 2YI8A 3C66A 2EX3B 2F7RA 4P4MA 4H6IA 3C2KA 1ZJMA 4YN4A 2ZHAA 1OAOA 2ZH1A 8ICHA 2DRBA 4WH5A 4HR1B 4YMOA 8ICSA 3CVRA 4I27A 3H39A 1MQ2A 5J0RA 7ICNA 2PY6A 4WC6A 4M0AA 3HWTA 3LQCB 5IINA 5HR9A 1HUOA 4MFCA 2QXLA 4M9JA 4UAYA 4LT6A 4H8SA 3OV7A 1ZQDA 4X4SA 3CZSA 4JWDA 3BUIA 3RJJA 4DOCA 5HRLA 5J0TA 2PXIA 4KLFA 3B51X 8ICRA 3NWIA 3AQNA 5J2DA 3OUYB 5J2HA 4PHEA 4R63A 4AZIA 3JPQA 2OO2A 3AU6A 4AZ7A 9ICHA 2PFOA 4R5GA 3OVAA 8ICCA 1BPBA 5B3PA 5FLEX 2M2UA 4X0BA 4EZOA 4UBBA 7ICOA 4RQ3A 3JPPA 4FO1A 4AT7B 4MF2A 9ICUA 3ERCC 4FHPA 4AZCB 4LEWA 3OVSA 4QZIA 3T47A 5IIKA 3RJFA 2RAKA 4EGWA 3K7DA 3H38A 4F5OA 1ZWWA 1DKYA 2DVIA 2FMPA 4YCXA 3LK9A 5DDYA 2PFNA 9ICWA 4NKUA 1WOTA 3D4ZA 5DBBA 2YL6A 4FHVA 1MIVA 4UB5A 3G9GA 3O3OB 8ICEA 9ICRA 8ICIA 1E2UA 9ICEA 4R66A 3ABHA 2F1AA 4I2GA 4N7RA 9ICQA 1SUFA 4UD4A 8ICNA 2X3XA 2DR5A 3O3MB 2EFKA 2HN1A 4ATBA 5HRIA 5CP2A 5DBAA 1TFWA 2BBHA 4KLOA 4KLHA 7ICEA 2DR9A 4I2AA 4NQIA 3C18A 4O9MA 4XA5A 4KLGA 4RQ7A 4D8JA 4WC3A 4ATBB 1ZQCA 5C5BB 3AUOA 4XJEA 4I28A 3ZEDA 1GPJA 1ZQKA 9ICMA 3EJUA 5DDMA 4I2EA 7ICSA 4O5CA 2MI7A 4IQVA 4LEYA 4MFFA 1U00A 8ICKA 2ZH8A 1ZQBA 4EZUA 1DKXA 1O7DC 5EOZA 3AQMA 4WC5A 8ICOA 5FIGA 1MIYA 4EBJA 1TQUA 5CHEA 2NRKA 2YIBA 5D63A 3ISBA 5BOLA 4AT7A 5CFUA 4DOAA 1HTYA 3OVBA 4B9QA 2LXYA 4NXTA 4EZYA 4NXVA 1KDHA 1ZQGA 3H3AA 2PFQA 4OAHA 3DX3A 4X4RA 4UAZA 1ZJNA 4KLDA 1KEJA 3RJHA 3V7JA 9ICBA 4X4VA 5J29A 5J2EA 5J0PA 7ICGA 9ICSA 4OAGA 4X4PA 5J2IA 3HJ1A 2WINM 8ICUA 3OUYA 4EZZA 4QZCA 4LZDA 2BCUA 4NXWA 3BUPA 8ICGA 5B3QA 4JWMA 2F7PA 2ZXQA 5TKYA 3F7WA 1ZQEA 1R5EA 3JYYA 2JNSA 4O69A 5J0YA 3BVVA 4R64A 1R8AA 2YKTA 5HRKA 2YI9A 4X4UA 2OW6A 2QFFA 4FHXA 4RQ5A 4TUQA 2GAFD 4JWIA 3UITA 1ZQYA 1I4LA 4FZOA 2LM0A 4UAWA 3H37A 3JPOA 4K97A 4O5KA 9ICFA 9ICJA 2FMSA 5J0XA 4YD2A 1UPXA 4PHDA 3I2WA 2ND0A 3I39X 4R5JA 4FZSA 4JWNA 4GXJA 3RH4A 1BPXA 1V4AA 4RQ2A 4AKVA 3LVTA 1JMSA 4JLXA 4Z6EA 1ZQMA 5HRGA 4E81A 9ICIA 3BVWA 3MBYA 5HC9A 2YL9A 9ICNA 4HYBA 1ZQOA 4EEDA 4WC7A 4I2JA 4M9NA 4PH5A 3EJRA 2Q12A 9ICOA 1QWNA 4RQ0A 5D46A 4AZ5A 1UETA 5J0UA 2F18A 1ZQNA 3ISCA 3SYVA 8ICJA 1O7DB 4I2FA 4EZWA 3D2EA 4UBCA 4WPEA 2BCVA 4WCWA 4LEZA 3EJTA 3JPNA 4PGXA 2HN2A 1QWUA 4NPHA 4EZPA 1F5AA 5J0QA 4JWEA 3ISDA 5J2KA 4JNFA 2ZH5A 2Q66A 4EV6A 2X3VA 3AU2A 1E1DA 2JNKA 4O6AA 2BPGA 3EF2A 1ZQAA 2RAIA 2DRAA 3DPQA 3PHZA 2B56A 4I2CA 1YWMA 3BUQA 3PMNA 8ICXA 3UXNA 5J0WA 4WC0A 1HWWA 3OHXM 2DR7A 3V72A 3MCRA 5CWRA 3QNJA 3NVOA 2P66A 5DB9A 1OU5A 4I2HA 9ICAA 4NSWA 4XQ8A 3BVXA 4JLCA 4MF8A 4K9BA 4RWQA 4WPCA 4F00A 1ZQXA 3L3PA 2YL5A 2ZHBA 1BPDA 4NKTA 4RWNA 4JL9A 8ICPA 3BLBA 2F1BA 4K4GA 2OBMA 4M9GA 4R5KA 3PLTA 1I4DA 1RPLA 5D4BA 3V7KA 3RJIA 3RV0A 4HR1A 4AT9B 1VFGA 3DYTA 2KHOA 3GI7A 3L3OM 4DCNC 1PX5A 4PHPA 5J2FA 1BPZA 4PPXA 3JPRA 8ICFA 4MFAA 4YMMA 4X0AA 4LEVA 4FO6A 4F5PA 7ICMA 7ICIA 7ICTA 1QX1A 4RT2A 4F5QA 2BBJA 1MJGA 3CZNA 1ZYLA 4IM0A 5E84A 5HRHA 4PGQA 3HW8A 3UXPA 2ISPA 1I4TA 4E8FA 1GNLA 2EWFA 2GF4A 3UPSA 4O68A
chains in the Genus database with same CATH topology
4R5IA 5CFTA 2X5CA 4EZNA 2B4VA 1JQKA 3OWGA 3VKHA 4IWOA 4OAGA 4HX0A 4K8VA 5CFSA 3T4AG 3D2FA 2WINM 4WOYA 2GA9D 4EZZA 3C7NA 4NXWA 2ND1A 4UDYX 2RT6A 5B3QA 1DKZA 3KDRA 4EZRA 4F01A 3NKUA 5TKYA 2YI8A 3F7WA 2EX3B 3KAVA 3O3NB 4OAFA 2JNSA 4H6IA 4IM2A 4O69A 4G6QA 1OAOA 5D61A 3DPOA 4JNEA 4WH5A 4HR1B 3LMFA 4JWCA 1GNTA 2YIVX 2YI9A 2QFFA 2GAFD 4JWIA 3UITA 4K96A 2PY6A 4UDXX 2LM0A 4K97A 2IHOA 1W9MA 2QXLA 1UPXA 3VEBA 4K9AA 4EZSA 2B51A 4FM3A 3DPPA 4JWDA 2ND0A 3I39X 4R5JA 4EZTA 3B51X 4JLXA 4E3CA 4JLZA 4E81A 4IWPA 2EWRA 4R5GA 4HYBA 3T48A 5B3PA 4KM5A 5FLEX 4EZOA 1SU8A 2OBLA 4HY9A 4KIKB 4FO1A 3KAWA 4PO2A 3ERCC 4LEWA 4EZWA 3T47A 3D2EA 3K7DA 3QA8A 1DKYA 4LEZA 2NCZA 4NXUA 3T49A 1SU7A 4M0MA 4IWQA 4NPHA 4EZPA 3VEAA 4JWEA 4K99A 3B52X 4K98A 3FD9A 3I01A 3O3OB 4JNFA 1SU6A 1E2UA 1E1DA 4O6AA 4O67A 3EF2A 4OAIZ 4N7RA 2YIAA 1SUFA 3DPQA 3PHZA 3A98A 2B56A 4WQLA 3O3MB 3OHXM 3MCRA 4MKPA 3ER8C 3QNJA 4IM3A 1OA1A 3B53X 4JLCA 4K9BA 4NXXA 4D8JA 4IW0A 4F00A 1E9VA 4WQKA 4JN4A 4JL9A 4R5LA 3ZEDA 1GPJA 4XJEA 2OBMA 4R5KA 4EZVA 2Z8YA 4H6HA 3RV0A 4HR1A 3ER9B 5D62A 4LEYA 3GI7A 2KHOA 1U00A 3L3OM 4KB6A 4EZUA 1DKXA 4LEVA 2N3KA 5FIGA 3I04A 5CHEA 1OA0A 1MJGA 2YIBA 4EZXA 5D63A 3T46A 2FCLA 1ZYLA 4IM0A 5E84A 5CFUA 4B9QA 4KIKA 1GN9A 3RV1A 4EZYA 4NXTA 4NXVA 4EZQA 1GNLA 2EWFA 4OAHA 4O68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA9 D;  3ER8 C;  2GAF D;  3OWG A;  3ER9 B;  3ERC C; 
#chains in the Genus database with same CATH topology
 2X5C A;  4NM1 A;  2ZH7 A;  3OK8 A;  3CV5 A;  8ICL A;  5CFS A;  4IWO A;  4FHY A;  2ISO A;  4WOY A;  2GA9 D;  3D52 A;  3EJQ A;  2ND1 A;  4KLU A;  4BNE A;  3AQL A;  1XSL A;  4EEB A;  3QNI A;  3KAV A;  5C5B A;  1R8B A;  4IM2 A;  3WFQ E;  4TUR A;  1YLQ A;  3DX1 A;  5DED A;  3DPO A;  3C5F A;  1TV9 A;  4AZC A;  4K4I A;  4JNE A;  8ICA A;  4JWC A;  1GNT A;  2YIV X;  7ICK A;  4IG8 A;  2YL8 A;  3RJE A;  4UDX X;  4S3N A;  4I29 A;  2IHO A;  1JAJ A;  9ICL A;  4F5R A;  4NLZ A;  4EBK A;  5CR0 A;  5J2B A;  1ZQJ A;  3GDX A;  2B51 A;  4FM3 A;  4P2H A;  4RQ1 A;  2VAN A;  4EZT A;  1R8C A;  4RPZ A;  4P4O A;  4QZB A;  1MIW A;  3UPQ A;  2D4C A;  4FZP A;  4AVM A;  5BPC A;  7ICR A;  4F5N A;  9ICT A;  2EWR A;  4X4O A;  1ZQL A;  2O5A A;  2M2T A;  1Q79 A;  2IUB A;  3JCF A;  8ICY A;  8ICV A;  3BVU A;  2Q13 A;  9ICV A;  2BE3 A;  3PNC A;  2Z0O A;  3UXO A;  5IIL A;  1HUZ A;  4WC2 A;  4KM5 A;  4IQU A;  1SU8 A;  5HRE A;  2BPC A;  3C5G A;  7ICL A;  3WFS C;  3K75 D;  5HRD A;  1ZQH A;  3KAW A;  4PHA A;  1TQV A;  3UQ0 A;  4AT8 A;  2ZH4 A;  7ICH A;  2GWS A;  4M9L A;  8ICQ A;  3RJG A;  1ZQI A;  3BUB A;  4XUS A;  2NCZ A;  3DX4 A;  5IIJ A;  4K4H A;  4AZB A;  3CAZ A;  4IWQ A;  3HIY A;  2V0O A;  5J2J A;  3VEA A;  4K99 A;  1ZQT A;  3B52 X;  3RPM A;  3I01 A;  3AQK A;  7ICF A;  4YMN A;  4O67 A;  4LVS A;  3NYB A;  2YIA A;  3RH5 A;  2M2W A;  5CA7 A;  5HRB A;  4IQW A;  3CK6 A;  4WQL A;  3CKD A;  4KLM A;  9ICP A;  3HJ4 A;  2ZH2 A;  5IIM A;  4MKP A;  5III A;  4I2D A;  3EJP A;  4IM3 A;  5CJ7 A;  4GXI A;  5J2A A;  4NLK A;  3BUD A;  3LLL A;  8ICT A;  5CB1 A;  2QKW A;  4NXX A;  4PGY A;  4KLJ A;  4KLE A;  1JQR A;  4QZ9 A;  1E9V A;  5DBC A;  1X03 A;  4QZA A;  2M2V A;  4QZH A;  2W9M A;  3MDC A;  4M04 A;  9ICC A;  2ID1 A;  2IHM A;  1BPY A;  2FMQ A;  4EZV A;  3JZ0 A;  2Z8Y A;  4H6H A;  3ER9 B;  4RQ6 A;  4GXK A;  4DOB A;  4FH3 A;  5HHH A;  1JN3 A;  4I2B A;  3QE6 A;  3DX2 A;  4AZ6 A;  1TQT A;  4M47 A;  2N3K A;  2F7Q A;  3I04 A;  4E80 A;  2F7O A;  2Z0N A;  4EZX A;  1XSN A;  3T46 A;  3RH6 A;  1R89 A;  3UQ2 A;  2O0I 1;  2ELB A;  3RV1 A;  3PML A;  4DO9 A;  7ICQ A;  2BCR A;  1URU A;  3D51 A;  4AT8 B;  5CFT A;  2O1P A;  1JQK A;  2PBE A;  3OWG A;  3VKH A;  3M3W A;  4K8V A;  4R65 A;  3D2F A;  4RWP A;  1ZQV A;  4M9H A;  4XQ7 A;  3C7N A;  2BPF A;  5HRF A;  3QWE A;  3WFR E;  2PMR A;  5CHG A;  4EZR A;  3KDR A;  1ZQQ A;  4NY8 A;  1TFY A;  3O3N B;  4OAF A;  8ICZ A;  1ZQU A;  5DEC A;  3C2L A;  4G6Q A;  5D61 A;  3L9D A;  2RFF A;  4RPX A;  4I2I A;  2ZH9 A;  3DDG A;  3LMF A;  5IIO A;  4KLQ A;  4K96 A;  2ALW A;  4DYL A;  1W9M A;  2WYI A;  5J2C A;  4RT3 A;  4LZG A;  8ICM A;  5HHI A;  4RQ4 A;  7ICU A;  3SOG A;  3VEB A;  8ICB A;  1VJ7 A;  4EZS A;  4M5D A;  4K9A A;  1ZQR A;  3DPP A;  3WFO A;  1NO5 A;  4AZG A;  4Z6D A;  4I1Q A;  4NLN A;  5F2V O;  4RWO A;  2BCQ A;  1ZQZ A;  1X04 A;  4JLZ A;  4E3C A;  5J0S A;  1R33 A;  4QZ8 A;  5J0O A;  4IWP A;  4UB2 A;  1Y2O A;  3MDA A;  8ICW A;  4UD5 A;  4X4N A;  4XRH A;  5D49 A;  5DB7 A;  1MQ3 A;  3B0X A;  4FHW A;  3T48 A;  1UEU A;  9ICK A;  2OBL A;  4HY9 A;  1NOM A;  4KIK B;  4M2Y A;  1ZQP A;  4UB3 A;  2X3W A;  1ZQW A;  4WC1 A;  4PO2 A;  9ICG A;  2ZH6 A;  1PS3 A;  3HAI A;  2C08 A;  1ZQF A;  3D50 A;  4KLI A;  2EFL A;  3QA8 A;  2I9G A;  3OGU A;  4NXU A;  4KLT A;  3T49 A;  1SU7 A;  4ATM A;  2HHP A;  4M0M A;  3V7L A;  2ZH3 A;  4AT9 A;  5KBP A;  4WBY A;  3MGH A;  3JPT A;  2RAJ A;  4K98 A;  1LQ7 A;  3FD9 A;  4P4P A;  1HXK A;  1SU6 A;  3Q0K A;  3HAH A;  4KLS A;  4OAI Z;  4QZG A;  7ICP A;  5TZV A;  3A98 A;  3WFP A;  1BPE A;  1TQS A;  2D1L A;  2FIC A;  3D4Y A;  4EP7 A;  4UB4 A;  5BOM A;  3TFR A;  2FYV A;  3ER8 C;  4FH5 A;  1ZQS A;  4KLL A;  1R34 A;  1OA1 A;  4O5E A;  5J2G A;  4YD1 A;  3B53 X;  2Z0V A;  4TUS A;  1FA0 A;  4X4Q A;  4X5V A;  4IW0 A;  3DX0 A;  4Z6C A;  2PFP A;  3DDF A;  4WC4 A;  2OW7 A;  3Q84 A;  4WQK A;  1KNY A;  4QZD A;  4JN4 A;  4RPY A;  4R5L A;  5DKW A;  2BCS A;  3BVT A;  3HX0 A;  1TQW A;  3B0Y A;  5D62 A;  4KB6 A;  1WDZ A;  7ICJ A;  4I0U A;  4Z6F A;  1TVA A;  4NM2 A;  2YLA A;  2WYH A;  4TUP A;  3EJS A;  9ICX A;  4UB1 A;  1OA0 A;  4IQT A;  4X4T A;  3MGI A;  2FCL A;  5DB6 A;  3TFS A;  1UEV A;  1GN9 A;  4KIK A;  2DR8 A;  4EZQ A;  3NKU A;  3C2M A;  3ACO A;  4R5I A;  2YLL A;  4WBZ A;  4EZN A;  2B4V A;  4HX0 A;  1XSP A;  3T4A G;  1I49 A;  4AZH A;  5JTG A;  3RJK A;  7ICV A;  4UDY X;  4NXZ A;  4RQ8 A;  1RZT A;  1Q78 A;  5DB8 A;  2RT6 A;  4QZF A;  3JPS A;  1DKZ A;  4F01 A;  2OZN B;  3HAJ A;  4E7X A;  4QZE A;  2YI8 A;  3C66 A;  2EX3 B;  2F7R A;  4P4M A;  4H6I A;  3C2K A;  1ZJM A;  4YN4 A;  2ZHA A;  1OAO A;  2ZH1 A;  8ICH A;  2DRB A;  4WH5 A;  4HR1 B;  4YMO A;  8ICS A;  3CVR A;  4I27 A;  3H39 A;  1MQ2 A;  5J0R A;  7ICN A;  2PY6 A;  4WC6 A;  4M0A A;  3HWT A;  3LQC B;  5IIN A;  5HR9 A;  1HUO A;  4MFC A;  2QXL A;  4M9J A;  4UAY A;  4LT6 A;  4H8S A;  3OV7 A;  1ZQD A;  4X4S A;  3CZS A;  4JWD A;  3BUI A;  3RJJ A;  4DOC A;  5HRL A;  5J0T A;  2PXI A;  4KLF A;  3B51 X;  8ICR A;  3NWI A;  3AQN A;  5J2D A;  3OUY B;  5J2H A;  4PHE A;  4R63 A;  4AZI A;  3JPQ A;  2OO2 A;  3AU6 A;  4AZ7 A;  9ICH A;  2PFO A;  4R5G A;  3OVA A;  8ICC A;  1BPB A;  5B3P A;  5FLE X;  2M2U A;  4X0B A;  4EZO A;  4UBB A;  7ICO A;  4RQ3 A;  3JPP A;  4FO1 A;  4AT7 B;  4MF2 A;  9ICU A;  3ERC C;  4FHP A;  4AZC B;  4LEW A;  3OVS A;  4QZI A;  3T47 A;  5IIK A;  3RJF A;  2RAK A;  4EGW A;  3K7D A;  3H38 A;  4F5O A;  1ZWW A;  1DKY A;  2DVI A;  2FMP A;  4YCX A;  3LK9 A;  5DDY A;  2PFN A;  9ICW A;  4NKU A;  1WOT A;  3D4Z A;  5DBB A;  2YL6 A;  4FHV A;  1MIV A;  4UB5 A;  3G9G A;  3O3O B;  8ICE A;  9ICR A;  8ICI A;  1E2U A;  9ICE A;  4R66 A;  3ABH A;  2F1A A;  4I2G A;  4N7R A;  9ICQ A;  1SUF A;  4UD4 A;  8ICN A;  2X3X A;  2DR5 A;  3O3M B;  2EFK A;  2HN1 A;  4ATB A;  5HRI A;  5CP2 A;  5DBA A;  1TFW A;  2BBH A;  4KLO A;  4KLH A;  7ICE A;  2DR9 A;  4I2A A;  4NQI A;  3C18 A;  4O9M A;  4XA5 A;  4KLG A;  4RQ7 A;  4D8J A;  4WC3 A;  4ATB B;  1ZQC A;  5C5B B;  3AUO A;  4XJE A;  4I28 A;  3ZED A;  1GPJ A;  1ZQK A;  9ICM A;  3EJU A;  5DDM A;  4I2E A;  7ICS A;  4O5C A;  2MI7 A;  4IQV A;  4LEY A;  4MFF A;  1U00 A;  8ICK A;  2ZH8 A;  1ZQB A;  4EZU A;  1DKX A;  1O7D C;  5EOZ A;  3AQM A;  4WC5 A;  8ICO A;  5FIG A;  1MIY A;  4EBJ A;  1TQU A;  5CHE A;  2NRK A;  2YIB A;  5D63 A;  3ISB A;  5BOL A;  4AT7 A;  5CFU A;  4DOA A;  1HTY A;  3OVB A;  4B9Q A;  2LXY A;  4NXT A;  4EZY A;  4NXV A;  1KDH A;  1ZQG A;  3H3A A;  2PFQ A;  4OAH A;  3DX3 A;  4X4R A;  4UAZ A;  1ZJN A;  4KLD A;  1KEJ A;  3RJH A;  3V7J A;  9ICB A;  4X4V A;  5J29 A;  5J2E A;  5J0P A;  7ICG A;  9ICS A;  4OAG A;  4X4P A;  5J2I A;  3HJ1 A;  2WIN M;  8ICU A;  3OUY A;  4EZZ A;  4QZC A;  4LZD A;  2BCU A;  4NXW A;  3BUP A;  8ICG A;  5B3Q A;  4JWM A;  2F7P A;  2ZXQ A;  5TKY A;  3F7W A;  1ZQE A;  1R5E A;  3JYY A;  2JNS A;  4O69 A;  5J0Y A;  3BVV A;  4R64 A;  1R8A A;  2YKT A;  5HRK A;  2YI9 A;  4X4U A;  2OW6 A;  2QFF A;  4FHX A;  4RQ5 A;  4TUQ A;  2GAF D;  4JWI A;  3UIT A;  1ZQY A;  1I4L A;  4FZO A;  2LM0 A;  4UAW A;  3H37 A;  3JPO A;  4K97 A;  4O5K A;  9ICF A;  9ICJ A;  2FMS A;  5J0X A;  4YD2 A;  1UPX A;  4PHD A;  3I2W A;  2ND0 A;  3I39 X;  4R5J A;  4FZS A;  4JWN A;  4GXJ A;  3RH4 A;  1BPX A;  1V4A A;  4RQ2 A;  4AKV A;  3LVT A;  1JMS A;  4JLX A;  4Z6E A;  1ZQM A;  5HRG A;  4E81 A;  9ICI A;  3BVW A;  3MBY A;  5HC9 A;  2YL9 A;  9ICN A;  4HYB A;  1ZQO A;  4EED A;  4WC7 A;  4I2J A;  4M9N A;  4PH5 A;  3EJR A;  2Q12 A;  9ICO A;  1QWN A;  4RQ0 A;  5D46 A;  4AZ5 A;  1UET A;  5J0U A;  2F18 A;  1ZQN A;  3ISC A;  3SYV A;  8ICJ A;  1O7D B;  4I2F A;  4EZW A;  3D2E A;  4UBC A;  4WPE A;  2BCV A;  4WCW A;  4LEZ A;  3EJT A;  3JPN A;  4PGX A;  2HN2 A;  1QWU A;  4NPH A;  4EZP A;  1F5A A;  5J0Q A;  4JWE A;  3ISD A;  5J2K A;  4JNF A;  2ZH5 A;  2Q66 A;  4EV6 A;  2X3V A;  3AU2 A;  1E1D A;  2JNK A;  4O6A A;  2BPG A;  3EF2 A;  1ZQA A;  2RAI A;  2DRA A;  3DPQ A;  3PHZ A;  2B56 A;  4I2C A;  1YWM A;  3BUQ A;  3PMN A;  8ICX A;  3UXN A;  5J0W A;  4WC0 A;  1HWW A;  3OHX M;  2DR7 A;  3V72 A;  3MCR A;  5CWR A;  3QNJ A;  3NVO A;  2P66 A;  5DB9 A;  1OU5 A;  4I2H A;  9ICA A;  4NSW A;  4XQ8 A;  3BVX A;  4JLC A;  4MF8 A;  4K9B A;  4RWQ A;  4WPC A;  4F00 A;  1ZQX A;  3L3P A;  2YL5 A;  2ZHB A;  1BPD A;  4NKT A;  4RWN A;  4JL9 A;  8ICP A;  3BLB A;  2F1B A;  4K4G A;  2OBM A;  4M9G A;  4R5K A;  3PLT A;  1I4D A;  1RPL A;  5D4B A;  3V7K A;  3RJI A;  3RV0 A;  4HR1 A;  4AT9 B;  1VFG A;  3DYT A;  2KHO A;  3GI7 A;  3L3O M;  4DCN C;  1PX5 A;  4PHP A;  5J2F A;  1BPZ A;  4PPX A;  3JPR A;  8ICF A;  4MFA A;  4YMM A;  4X0A A;  4LEV A;  4FO6 A;  4F5P A;  7ICM A;  7ICI A;  7ICT A;  1QX1 A;  4RT2 A;  4F5Q A;  2BBJ A;  1MJG A;  3CZN A;  1ZYL A;  4IM0 A;  5E84 A;  5HRH A;  4PGQ A;  3HW8 A;  3UXP A;  2ISP A;  1I4T A;  4E8F A;  1GNL A;  2EWF A;  2GF4 A;  3UPS A;  4O68 A; 
#chains in the Genus database with same CATH homology
 4R5I A;  5CFT A;  2X5C A;  4EZN A;  2B4V A;  1JQK A;  3OWG A;  3VKH A;  4IWO A;  4OAG A;  4HX0 A;  4K8V A;  5CFS A;  3T4A G;  3D2F A;  2WIN M;  4WOY A;  2GA9 D;  4EZZ A;  3C7N A;  4NXW A;  2ND1 A;  4UDY X;  2RT6 A;  5B3Q A;  1DKZ A;  3KDR A;  4EZR A;  4F01 A;  3NKU A;  5TKY A;  2YI8 A;  3F7W A;  2EX3 B;  3KAV A;  3O3N B;  4OAF A;  2JNS A;  4H6I A;  4IM2 A;  4O69 A;  4G6Q A;  1OAO A;  5D61 A;  3DPO A;  4JNE A;  4WH5 A;  4HR1 B;  3LMF A;  4JWC A;  1GNT A;  2YIV X;  2YI9 A;  2QFF A;  2GAF D;  4JWI A;  3UIT A;  4K96 A;  2PY6 A;  4UDX X;  2LM0 A;  4K97 A;  2IHO A;  1W9M A;  2QXL A;  1UPX A;  3VEB A;  4K9A A;  4EZS A;  2B51 A;  4FM3 A;  3DPP A;  4JWD A;  2ND0 A;  3I39 X;  4R5J A;  4EZT A;  3B51 X;  4JLX A;  4E3C A;  4JLZ A;  4E81 A;  4IWP A;  2EWR A;  4R5G A;  4HYB A;  3T48 A;  5B3P A;  4KM5 A;  5FLE X;  4EZO A;  1SU8 A;  2OBL A;  4HY9 A;  4KIK B;  4FO1 A;  3KAW A;  4PO2 A;  3ERC C;  4LEW A;  4EZW A;  3T47 A;  3D2E A;  3K7D A;  3QA8 A;  1DKY A;  4LEZ A;  2NCZ A;  4NXU A;  3T49 A;  1SU7 A;  4M0M A;  4IWQ A;  4NPH A;  4EZP A;  3VEA A;  4JWE A;  4K99 A;  3B52 X;  4K98 A;  3FD9 A;  3I01 A;  3O3O B;  4JNF A;  1SU6 A;  1E2U A;  1E1D A;  4O6A A;  4O67 A;  3EF2 A;  4OAI Z;  4N7R A;  2YIA A;  1SUF A;  3DPQ A;  3PHZ A;  3A98 A;  2B56 A;  4WQL A;  3O3M B;  3OHX M;  3MCR A;  4MKP A;  3ER8 C;  3QNJ A;  4IM3 A;  1OA1 A;  3B53 X;  4JLC A;  4K9B A;  4NXX A;  4D8J A;  4IW0 A;  4F00 A;  1E9V A;  4WQK A;  4JN4 A;  4JL9 A;  4R5L A;  3ZED A;  1GPJ A;  4XJE A;  2OBM A;  4R5K A;  4EZV A;  2Z8Y A;  4H6H A;  3RV0 A;  4HR1 A;  3ER9 B;  5D62 A;  4LEY A;  3GI7 A;  2KHO A;  1U00 A;  3L3O M;  4KB6 A;  4EZU A;  1DKX A;  4LEV A;  2N3K A;  5FIG A;  3I04 A;  5CHE A;  1OA0 A;  1MJG A;  2YIB A;  4EZX A;  5D63 A;  3T46 A;  2FCL A;  1ZYL A;  4IM0 A;  5E84 A;  5CFU A;  4B9Q A;  4KIK A;  1GN9 A;  3RV1 A;  4EZY A;  4NXT A;  4NXV A;  4EZQ A;  1GNL A;  2EWF A;  4OAH A;  4O68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...