3FC3A

Crystal structure of the beta-beta-alpha-me type ii restriction endonuclease hpy99i
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
189
structure length
189
Chain Sequence
MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSELEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCRECRKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHNHDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.
pubmed doi rcsb
molecule keywords Restriction endonuclease Hpy99I
molecule tags Hydrolase/dna
source organism Helicobacter pylori
total genus 48
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02945 Endonuclease_7 Recombination endonuclease VII
A PF18350 SH3_17 Restriction endonuclease SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3fc3A01
3.30.60.130 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 3fc3A02
3.40.1800.10 Alpha Beta 3-Layer(aba) Sandwich His-Me finger endonuclease fold His-Me finger endonucleases 3fc3A03
3OS0A 2K3XA 2XDPA 4E7KA 3UWNA 3MP6A 2R5MA 4BD3A 2GFAA 5D6XA 3L2QA 3L2WA 3UT1A 1OZ3A 4A4GA 4IUVA 5M9OA 5D6WA 3OMCA 5IAYA 4BACA 2QNFA 3PNWC 1SSFA 1MHNA 4FU6A 1N27A 3FLGA 2M1HA 2X4WA 5C6SA 3FEOA 4C5HA 4LD6A 2RHZA 2HQEA 3OYDA 4HCZA 2DIQA 3PMIA 3OYLA 1WJSA 3OYKA 3LGFA 3L2VA 4IUTA 4C5IA 3SD4A 3OYAA 2EQJA 2LTOA 3GOXA 2QNCA 1RI0A 2DAQA 3OYFA 3BDLA 3OYHA 2RO0A 2LDMA 3MEUA 2D9TA 2BKDN 2MWPA 3F70A 3DLMA 3L2UA 4NS5A 2X4XA 3MP1A 3QJ6A 4A4HA 2L8DA 3NTHA 3OS2A 3P8HA 4QQ6A 4BDYA 3OYJA 3PMTA 4RG2A 3C4SA 2RJDA 3H8ZA 3LX7A 2BUDA 5KCOA 3S3MA 3FDRA 4E7JA 3OYMA 1WJQA 2RHYA 1OYXA 3L2RA 3E9GA 2WACA 2L3RA 5CIUA 2B8AA 2P0KA 4N4HA 3DB3A 2BIVA 2R57A 2NLUA 3OQ5A 4Z02A 5IN1A 2EFIA 2JTFA 3KUFA 3MO8A 3Q1JA 4IUUA 3S3NA 4QQGA 1WJRA 4E7HA 3P8DA 3CEYA 2VYTA 3OB9A 3ME9A 3NTKA 5J39A 2R5AA 1E7LA 2LCCA 2MWOA 3LYIA 4IUPA 3OYCA 4E7IA 3S3OA 1EN7A 3OYGA 1G5VA 4A4FA 2E5QA 5KH6A 2EQUA 4EDUA 3META 4BE2A 5D6YA 3O8VA 2G3RA 3DB4A 3OYBA 3EAEA 4OVAA 4PLLA 2JZ2A 4ZTFA 4IURA 5KE2A 2RJCA 3L42A 3OA6A 4BE1A 3ASKA 3OY9A 5KCHA 5C0MA 4N4GA 2E6NA 2RHUA 2X35A 4L59A 3S6WA 3FC3A 3QKJA 3LGLA 4QQDA 1OI1A 2X4YA 4BDZA 2GF7A 3LLRA 4ZTJA 2F5KA 3M9QA 2FHDA 2HQXA 2RHXA 4B9XA 3OYEA 2QQSA 2LRQA 4GY5A 2RJEA 1E7DA 3E9FA 4FL6A 3H6ZA 2GFUA 3OYIA 2RI5A 4X34A 3MP8A 4UC4A 4A4EA 1KHCA 2K3YA 2RHIA 2YRVA 5FRMA 5KE3A 2DIGA 2M0OA 3MEWA 2LVMA 4E7LA 4CRIA 2XK0A 2L89A 3MEVA 3NTIA 3QBYA 4QW2A 4C5GA 2QQRA 4IKFA 5FRNA 2O4XA 2RI3A 2EQKA 2CKKA 4QVZA 3ZEHA 1WGSA 4II1A 4PL6A 5J26A 1XNIA 2RI2A 4IUQA 4N4IA 4Q5WA 2EKOA 3OYNA 2EQMA 2PQWA 4C5EA 3LH0A 1H3ZA 3QIIA 4B9WA 4PLIA 2RJFA 2M16A 3MEAA 3OMGA 3PFSA 5FROA 3OS1A 4BE0A 2R58A 2O4XB 2IG0A 1OZ2A
chains in the Genus database with same CATH superfamily
1IY6A 1BUSA 1WHLA 3R5BA 3MP6A 1NLPC 4CC4B 5M9OA 3A8MB 2BZXA 3AT1B 4R0KA 4FU6A 4J9HA 5A0DA 3CMET 4HXJA 3I35A 2CT4A 3CCVQ 1VQNQ 4D6WA 1QWEA 3MEKA 1V29B 1SSHA 3SDZA 2EYZA 1VIFA 4AMLA 4F04B 3CCUQ 1GCPA 2ARPF 1BI0A 4LDYA 2XKOC 4JPBW 1A0NB 1M5Q1 3HPWA 3UGDA 4FSXA 2V8IA 2FEIA 4LNPA 2DB6A 2EWNA 3I5SA 5GAMd 3RU0A 3OYJA 1R77A 2HZYA 4OMLA 4RG2A 2ORWA 5EX3A 4J9EA 5FU7C 1WHJA 3CCJT 1OYXA 1UVGA 1QMCA 3CCQQ 1RACB 1AZGB 2QTVA 2N71A 4QQGA 1K7VA 4LDXA 2DNUA 3ME9A 3EFOB 1Q81R 3FIFA 3TOAA 4IUPA 1EN7A 2HD0A 3HHTB 1G5VA 3PVQA 5KH6A 4EDUA 1N8RC 2HSEB 1I1JA 2OTLA 2RN8A 2CP5A 2JZ2A 2ORVA 4M7AB 4BE1A 1MMAA 4OGEA 3MHXA 1KIKA 2SGQI 4L59A 4PJOC 3I5RA 3ZBDA 4M77A 5GAOn 1T3LA 2I2LA 2QDLA 5KYWB 1Q7YR 2LZ6B 5J8FA 3I55A 1I5LA 1G83A 1IB8A 2DRKA 1FAQA 2L89A 2CSQA 4PJOG 3BJIA 1JU5C 3CCLQ 2K57A 1VQLQ 1UFFA 2LB7A 1IHWA 1Q82U 2EGEA 4MDWA 1S72A 3MEAA 4NOYA 4F16A 3SGBI 1PC0A 5GAOq 3UATA 1KQSA 2P84A 3TEEA 1QP3A 3M54A 4MZTA 5LJ5f 4E6RA 1NEGA 4C92F 5LJ3j 3FLGA 3RDVA 1UG1A 2HAXA 3CPWA 2FVUA 1Q82C 3OSSC 4L5GA 1OMUA 2MAMA 2W0TA 1ZSZB 1YITT 4E1RA 3CC4T 2FZCB 1R0BG 2F1LA 1D09B 1WI7A 4MZMA 3EHQA 5ECAA 2OX7A 2OJ2A 2LDMA 4ELYC 4LXCA 5FLXE 3TSWA 2C0OA 2K7AA 3QJ6A 3EG9B 1JO8A 3G6EA 4FYWB 1IREB 1GCQA 3G4SA 2A0FB 1QCOA 2VXFA 1IGUA 1M1GA 3ER0A 4EMKB 2RC4A 1I0CA 1J3TA 1IO6A 3TVTA 1VQ4A 3OQ5A 2AZSA 3RKWA 1BCOA 5IH2A 3OVOA 1P92A 5GAN6 3V8LA 2R5AA 2LCCA 2K5FA 2VVKA 4F7UE 4OMQA 2D0NA 2G6FX 3R5CA 2HKQB 1U3OA 1OOTA 2VB6A 1FMKA 4ESRA 2ABLA 5IHIA 2RJCA 3L42A 4Y91A 5C0MA 1X2KA 2KT8A 3REAB 3AHUA 1WDXA 4ZTJA 2BE7D 2DA9A 4M7DA 8ATCB 2Y0MA 1ZBXA 2RF0A 4WTOB 1HSQA 4M78B 1VQKA 4RG8A 3PT9A 1D0YA 2PNIA 3EG1A 2L7XA 2SGPI 2KYMA 2A28A 3HL8A 4OMOA 4PK4A 2LVMA 3QO3A 3NTIA 4A54A 4R55A 2KMTA 3VU3C 3OW2A 4BY6C 4QVZA 1DJ7B 3M5AA 4CI0C 3EG0A 4GBQA 3I55Q 3SFMA 3V7SA 5LJ5e 4C8QB 4GI3C 5GANh 1NEBA 1AT1B 4KGXB 1PSFA 2Y4XA 1T3SA 2WSFE 5CKHA 1FMVA 2X4WA 1S72Q 3FEOA 2VV5A 2CYZB 2LNHB 2KMPA 2NUZA 5LJ3f 3M0TA 1SRMA 1M30A 2EQJA 2E73A 4WCIA 5KYNA 2QNCA 2LT4A 2LX7A 4BB7A 2RH2A 4KGZB 4AG2C 1IHVA 3JCMV 5HI7A 4TVRA 4UXHA 3ZFJA 2HCKA 3GP8A 4J9DA 2BUDA 1B07A 1K1ZA 2L3PA 1KG1A 3EFOA 6AT1B 1AWOA 2DD4A 5LJ5d 4Y92A 2ENNA 2JZMA 2BE9B 1RADB 4J9BA 3Q1JA 3G6EQ 4CC7A 1N8RR 1CT4I 3CEYA 1X27A 2VYTA 3G4SQ 4M7AA 1U5KA 2KMRA 4EIKA 4M7DC 1HJDA 4BE2A 2YUQA 4LDUA 2I0NA 2JS2A 1VQ4Q 2LQ8A 1YWOA 3ASKA 5KYWA 2OTJT 4F7UF 1V1CA 1RL2A 4QQDA 5CAIA 4RTZA 1OPLA 1W2BS 3FSXA 4GLKA 3UA6A 2O88A 2KR3A 5GAN5 3H41A 2GGRA 1G2BA 1VIEA 5KYYA 1NZ9A 1WXBA 2KMQA 1MUZA 1TTHB 2O2OA 1MNEA 1P9ZA 3VYGA 4X34A 2DRMA 3EFRA 1KD1C 2QPOA 4OMNA 4VUBA 1D0ZA 1ULKA 3QHSA 3CC7A 1TBNA 3KXTA 1AEYA 2XD0A 2XK0A 1WZOA 3PIPA 3CMAT 4M77D 3U23A 1QP2A 2JM8A 2XG8D 1YHQT 3CCMA 4FKDA 2QEXT 2GKTI 1WGSA 2P4RA 4II1A 5FU7B 2GTJA 5HY6A 5GAOr 1VQKQ 2DYBA 2YUNA 2QA4A 3WVEB 1WHGA 4PLIA 2E6ZA 1PJUA 1Z7KB 2HL3A 2JA1A 3OYGA 4XTXA 1PKTA 2E12A 2WGCA 4V2SA 3UGLA 2V1CA 4RCBA 1ZSZA 4AFUC 4XAXB 1Q82R 5CO7A 4EPCA 1LOJA 2JXBA 1K7UA 5LJ3e 2HDAA 1M8BA 3OYYA 1IZ6A 1MNDA 2CZ6B 1EZZB 4YTLA 2OZUA 4M77E 3EG9A 2DL5A 4C5IA 1Y96B 3TREA 2AKLA 3BDUA 2GKVA 3JCMh 3HRTA 5LL6S 4RTTA 2JTMA 3OXGA 4EMKA 2K2MA 1TOVA 3NTHA 1W2BP 2CWHA 1SGEI 1RABB 1K8AR 4Z89A 3OYMA 1CKBA 1KQ2A 2JJ9A 5FWCA 1C1AA 2AKKA 1B3QA 2PUOB 3X20B 4BI3A 3IQLA 2XDBA 2SGFI 1YIJA 4HVUA 2X51A 2AIRB 4MPIA 4XU1A 2E10A 4AT1B 1ZUUA 2HKNA 1LCKA 5KE2A 1AHJB 5KCHA 4Z88A 3H9NA 2PUKB 3M57A 4M78A 2ENMA 3THKA 2DIPA 2WVJA 1Q81U 1VOMA 1YCYA 3JCMW 2OD1A 2J87A 1QCFA 2KAFA 4JDSA 1WHHA 3JB9D 2KT1A 5CQYA 4DBRA 5IHNA 3DLLA 5GAMh 3OXLA 2RI5A 2XI9A 3SEMA 2YRVA 5GANg 1QKXA 1OMTA 1Q81C 2W0ZA 3UEYA 4M7DD 4XU3A 1YJWA 2KMOA 4C8QA 2DM1A 1Q7YU 1QVPA 2NUTB 5GMKl 1TUSA 2VRWB 4N4IA 4RUGA 1IY5A 1VQ5A 1BI1A 1BIAA 3RKYA 3JCMX 2HBPA 3C12A 4B9WA 1R8OB 3X28B 1SGQI 4JLIA 3CC7Q 5GAOm 3N5BB 1FYNA 1OZ2A 1B7TA 2XDPA 4C92G 3CCMQ 4BD3A 4XU0A 4J5YA 1PSEA 3L2WA 4RTXA 3VS1A 4JJBA 1Q7YC 1X2QA 1SSFA 1MHNA 3V8KA 2QA4Q 3VDPA 4C5HA 3TJQA 2FNFX 3VE5A 2RHZA 3HFNA 1QQJA 3BY7A 4EMKC 2SGEI 2E5RA 3PMIA 1HJAI 3VV0A 3CCRA 4MMLA 1EIFA 3QPHA 5L23A 3CCST 1PTQA 1YI2T 3VRYA 3GBQA 4BUGA 3MEUA 1RAIB 3TOBA 2KRMA 4M77F 1VQOT 4A4HA 4L9MA 2GTOA 2QQCA 2MOXA 5FW9A 4BY6B 2JTEA 3FRNA 1VUBA 1M90R 2NU1I 2DL4A 4OMPA 3CCVT 3OB9A 5J39A 1Q9BA 2L0AA 2YXYA 1VQ8A 2E41A 1WYXA 2DF6A 3OBWA 2EQUA 2VASA 1JRIA 2G3RA 2CT3A 2Y90A 1M1KR 3CBMA 4F14A 1ABOA 2ZPHB 3OA6A 1YCSB 2GKRI 1YIJQ 1Y1CA 1YTPA 4M75E 1N9SA 3FB9A 4M7AD 3X25B 4RKUE 2X4YA 1TOTA 4PFZA 1R0RI 2KDSA 3A8OB 2HQXA 1KD1R 4C8QC 7AT1B 1JJ2S 4GY5A 1JQQA 1OV3A 4XQ3A 1OVOA 2NUPB 1NUBA 2JN0A 5DM7R 1QVFS 2M51A 1GXIE 1MMGA 3EH1A 3M59A 1KHIA 4OMMA 3SWNB 2DXTA 3LW5E 2CP2A 2GIVA 5GAN4 2X3WD 2R58A 2P0PA 1G3SA 2DL8A 2K3XA 3CCLA 4A24A 1YJWQ 2C06A 4KH0B 2CZ0B 4DBQA 3M0QA 2X3XD 1OU8A 3JCMg 4QT7A 1VQ5Q 4BACA 4R56A 3HH2C 1EFNA 1Y96A 4RMOA 3CD6T 1X6GA 2VGMA 2HQEA 1CHOI 1Y8FA 2YUPA 1BI3A 5EX0A 1YJ9T 3JB9F 4RTWA 1AVZC 1VDDA 5KYXB 2QYZA 1SKUB 3J7AF 4X9DA 2ELIA 3QTLD 3PTAA 3CCET 3OS5A 1VQ7T 3CMEA 1PNJA 3CCRQ 2ATCB 2FPDA 1SRLA 1JJ2P 3L2RA 1OPKA 2J6KA 2FPEA 1R79A 1RUWA 5CIUA 3VRZA 1ZUYA 2RK1A 2Y4YA 8AT1B 1QVFP 1YBYA 2EFIA 4QVCA 3SEKC 2LJ0A 1AD5A 2CGHA 3FSYA 5GAN7 4A4FA 2YLCA 1YNZA 3CBOA 1MMDA 4KT0E 3O8VA 4F7UG 5GAMg 4FIBA 2KE9A 4KGVB 2N1AB 1SHFA 2PVGB 3CCJA 3G71T 1G3YA 1N8RU 2CP0A 1VQ8Q 3FJPA 2YLBA 2DTHA 2CH4A 2EIFA 2YT6A 2H8HA 1E7DA 5IHKA 4M75F 2NUTA 4M78D 2K3YA 2RQVA 1GBQA 1WIEA 3M0PA 2RQRA 1WTJA 4JLGA 2QQRA 1PRMC 3TQ7P 4UXJA 2XIDA 1QW1A 4J9CA 1K9MC 3MJXA 4Q5WA 1YN8A 1U8RA 4AFQC 2PZ1A 1TURA 5J8CA 1I5OB 3OMGA 1YP5A 3PVLA 1OX8A 2GQIA 4PFPA 3R6OA 4J83A 1Y57A 2PU9B 4E7KA 3D00A 3A8LB 3E2UA 4C8QD 5D6XA 2F2VA 3L2QA 3M0UA 3RMQA 3R6NA 4MDXA 2OTLT 4M7AF 2N52A 2FO0A 5KYYB 2EYYA 2KSSA 2E65A 2P6AC 2DFUA 1RI9A 1RAFB 3L2ZA 1E6HA 1O9SA 5FU6C 2BZ8A 4J7FA 3UA7A 2RO0A 3I56T 4FW1A 4KH1B 3E19A 2X4XA 4PJNA 1YFNA 1VYVA 2YUUA 2DEQA 1NXUA 4DBFA 1D3BB 4C92B 3C4SA 1WNLA 5CKEA 1YITA 3VDUA 4ZGEB 2V8JA 2FRWA 5GAOp 2YWWA 1WLPB 4XTYA 1MJBA 1CT0I 2DTIA 5I11A 5IXBA 1XBTA 3CMEQ 1WJRA 3P8DA 4AG1C 3E59A 2F69A 1K8AU 2VUBA 9ATCB 5CR2A 2E5QA 2K5IA 4JS4A 5A2QE 3X26B 1X6OA 2L3SA 3UDCA 2NU0I 2LQWA 3GNFB 3CPFA 2DBMA 1HPTA 2NUPA 4OF1A 2BZYA 3FC3A 3CXCS 2IPOB 2NU4I 1MV0B 2GF7A 3QYGB 1K8AC 1AWXA 1VQ6T 3M9QA 1X43A 2ENZA 4HCBA 1Q95G 3CCJQ 2D0QB 1WHMA 3SWNA 1YU6C 1C6VX 2YSQA 4A4EA 1OU9A 2DVJA 5KYUB 2O31A 1KK7A 1X69A 4L6V5 5GANj 5HK3A 3G1JA 2QK0A 1EX4A 2EQMA 1VQ9T 1Y07A 5GMKh 1UHFA 2PVOB 3RBBB 4CC2A 2LMJA 1YJNT 2KRNA 2M02A 3HSBA 2EYQA 4A4GA 3CXLA 4ORZA 2FZKB 3PNWC 2XU8A 1WFWA 5KYXA 3QUIA 2GNCA 3UF4A 2J6FA 5CQXA 1NYGA 1ABQA 2PVDB 3EHRA 3M53A 2ODDA 4OB0B 1WGTA 3HRSA 3OYAA 3GPLA 4PJOD 2LNVA 1UHAA 3L2UA 2E3HA 1U5SA 3CXCP 2L8DA 1K0XA 4RTUA 5A0GA 5KCOA 1UDLA 3FDRA 4E7JA 3C0CA 3PGGA 4XTWA 2RHYA 3E9GA 3SB2A 3CC2T 4EMGA 1X74A 2QI2A 1RAEB 2NLUA 1M4ZA 5DLQE 1MJAA 1GRIA 2CSIA 1Y0MA 3KY9A 2QQDA 1YITQ 3CC4Q 1G3WA 5E3PA 4DA4A 1PKSA 4PJOE 2FYKA 4OVAA 1X6BA 1M90U 2W10A 2EPDA 3SWNC 2ROLA 1PD1A 5LJ5g 5D7UA 3KFVA 2EGCA 1LR8A 1D0XA 2B86A 4IIOA 1VQMT 1MMNA 5FUXA 3OYEA 4C0GA 2DJZA 1M1KU 1RAHB 3VUZA 4XTZA 1OULA 1V1HA 3OYIA 1M90C 4B6DA 4J6YA 2EBPA 1W2BA 1K9MR 2ZPEB 5DLOA 1ARKA 2OTJA 1PM3A 2KK4A 2K5LA 2X3TA 1KD1U 2EQKA 1M8MA 2CKKA 2RD1A 1MGQA 4F7UB 2CP6A 1W4RA 2JMAA 1M1KC 4PJLA 1UGQB 5GANf 1LVKA 3OS1A 1Z9QA 3TU4K 2RM4A 2EQIA 2LX9A 3OS0A 1Z2IA 5FUVA 4JRIA 3H0HA 3M0RA 1K4US 2QNFA 5D6WA 2HEQA 3CQTA 1D1CA 3CMAA 3UGIA 2AK5A 1YHQA 2KXCA 1TBRR 4LD6A 2QEXA 2LUYA 2J7IA 4C0FA 3WVDB 3SD4A 2JYYA 1D3BA 4C92A 1JXMA 1H3HA 4XK8E 1RI0A 3BDLA 2F3CI 3JCMb 4J9GA 1BYMA 1SGPI 4K11A 3G7ZA 4J6WA 1UJYA 2OU2A 1PCXA 3LX7A 5L8RE 2J9RA 2QASA 4HA8A 4WP4A 4M75C 3S3NA 3ZL7C 2ZPIB 2DETA 3NTKA 3LYIA 2DVEA 2DJQA 1G3TA 2GQVA 4C0DC 4PLLA 1K0SA 3QZ9B 5GMKi 1BIBA 1E6GA 4RTYA 1SGDI 3LGLA 2EAYA 4PJOF 4M75G 5KYUA 1X4SA 5GJWB 1U06A 5GAN2 5CKFA 1RAAB 1E7OA 4ZGJB 2K3BA 2GFUA 2YHTA 3OBYA 5FU6B 1UUEA 1TWBA 3VYHB 5LJ3d 4E47A 1KHCA 1WXUA 1SG5A 3PE0A 3EGUA 3UOEA 4E7LA 1SEMA 1SHGA 4CRIA 4PJMA 4IKFA 3B4VC 2RI3A 5GANe 1VQPT 4C0ZA 4HT8A 4PL6A 4HT9A 4DBHA 3ULRB 2RMOA 2DKGA 4PKCC 2RJFA 2M16A 4XTUA 3TCJA 2OTJQ 5J3BA 4Y28E 2L3QA 4PFOA 1OZ3A 3UT1A 5IAYA 3RMSA 4C92C 4OP0A 1BI2A 2A3LA 1NLOC 1IW4A 2QG9B 2WCYA 2KNBB 3VS7A 1HXDA 3M4YA 1BCMA 1AZEA 3JCMf 5IXFA 3NHNA 5CK9A 3LGFA 2XHCA 2CUBA 2PTKA 4E7SA 3INZA 3CMAQ 3EG3A 1ZLMA 2JW4A 1CE3A 1YHQQ 2QEXQ 2EYWA 4SGBI 3VS0A 4JZ4A 5I2SA 2OVOA 5E3RA 2KVQG 2XDDA 3S3MA 2DTOA 3R5DA 3WXMB 1MV3A 4ZNXA 2QDYB 3O5ZA 4HGUA 3P8BB 2ZPGB 1WA7A 1JXOA 4XTVA 3QXEB 4FCYA 2E3IA 4CC3A 4FT4A 4J7IA 4M7DE 1PD0A 3CCSA 1SGRI 4E7HA 2DD5A 2QXFA 1CKAA 3S3OA 4A4KA 3REBB 1VQOA 2D8HA 2HBWA 2HSPA 2MI6A 3QWPA 5CCAA 4N4GA 2X35A 1TUDA 1QVGS 5GJVB 1LR7A 2CWFA 2UZ3A 4DOVA 4HCKA 2L2PA 2DZ9A 1GL5A 1KMAA 5GAMf 1QLYA 1D1BA 4P5NA 2JT4A 3QWXX 1VQNT 2FRYA 4F7UA 4LD9K 4J9FA 2DIGA 2M0OA 3QBYA 3MCAB 2ERWA 2DMOA 3HTRA 3CCUT 5CKBA 3ZEHA 2DL7A 1JJ2A 3BW1A 2CP3A 5I21A 4IUQA 2JM9A 2VXEA 3NMZC 1QVFA 5FROA 3SGQI 4JZ3A 2ESWA 1H92A 2XRCA 4JJCA 3CCQT 2YRDA 1CSOI 5HKCA 1FYBA 1WXTA 3M56A 2VWFA 3JCMe 3I9QA 1TSFA 4LDVA 2K9GA 4HCZA 2HMAA 4Z8AA 3M58A 1UECA 2JW6A 3L2VA 4IUTA 1KBEA 4M7AE 2DAQA 2DZCA 1X01A 1LNXA 2DILA 1QVGP 2J05A 1P9GA 2NU2I 1FX7A 3RIRA 3VS6A 4HCCA 2A20A 3PMTA 1KBFA 2EGAA 2K4YA 2LJ1A 2SGDI 4C92D 1YJ9A 1N5ZA 2JUFA 5A0LA 1ACMB 1ZHIA 1KC8R 3QAHA 4E1PA 1QWFA 2E5KA 1WX6A 1SF9A 4JJNK 1AN1I 9WGAA 2LJ3A 1UB4A 2GVIA 2MWOA 3CCLT 2MPXC 1UGVA 1VQLT 3CCEA 1FMWA 1BU1A 3VS4A 3JCMd 4M7DF 2HQHA 1VQ7A 1RFHA 2LEOA 4IURA 4A63B 1OYVI 2QQ9A 3CCSQ 1YI2Q 2COZA 3HRUA 3S6WA 3QKJA 4BI8B 3LLRA 1XX6A 1VQOQ 2X9HA 1MJ9A 2HNIA 2O9VA 3V7RA 2J06A 2QQSA 4MMKA 3E2IA 4FM4B 4FL6A 2LP5A 3SHWA 1DS2I 3HFOA 1KJWA 2NU3I 1C0MA 4UC4A 2CS7A 2KROA 4JJDA 1M8CA 2ED0A 2OAUA 2KYBA 3MEVA 2DO3A 1IXDA 5FUYA 3G71A 5FRNA 3T9NA 1RLQC 2DERA 3LH0A 1CT2I 2ZPBB 4O5VA 4QVDA 4LUDA 2YUOA 1K9MU 2IG0A 3PDNA 4WF2A 4M75B 2JVVA 2R5MA 2O01E 1W1FA 3EGXB 2QQ0A 2COYA 1WPYA 3PIOA 3JB9J 5GAN3 3JCMJ 3KBGA 3L1AA 4C0DB 2JXDA 2L5QA 4DEYA 4OB3B 1UGPB 5LJ5h 3OYDA 5E3QA 4GLMA 1W4SA 2CP7A 1G8XA 3TO7A 2IVWA 2DIQA 3M4GA 3MKDA 2RIJA 1Y7XA 3VS2A 2YDLA 4MZPA 4FYYB 2L8EA 3TO6A 3VUBA 1YWPA 2D9TA 2BKDN 1NM7A 3VS3A 3OS2A 2BTTA 4BDYA 2AHJB 2DYIA 5GMKm 4JRPA 1QCNA 1H8KA 4M78E 2RA2A 1TG0A 2P0KA 4JRQA 2R57A 1K73R 1FY7A 5I2MA 1H641 1K9AA 1B34B 3C94A 3VJPA 3CD6Q 3I56A 2SRCA 1YJ9Q 3I55T 3META 2PQ8A 1W6XA 2X4JA 1Q86R 2K2VA 1DS3I 3M0SA 2EJ9A 4IIMA 2KXDA 2EVRA 1UHCA 4C8QE 3CC4A 3CCEQ 1VQ7Q 2FHDA 2RHXA 1S72T 1OQKA 1BK2A 5GMKj 4OMFB 1UUCA 3MP8A 1XA6A 2A08A 3CXCA 3QDFA 1UGRB 2KQWA 3QZ5B 2CUDA 1KQSS 2KDPA 4D8KA 4KULA 1AWWA 3BFMA 2V26A 3MPUB 4ME7A 3R5AA 5FUWA 5J26A 1M3CA 2EKOA 1VQ6A 2QAZA 1H3ZA 1H0ZA 4LUEA 1TBOA 3CPWS 2XICA 3LWIA 2JS0A 4AFSC 3G71Q 4JS5A 1UEBA 3GNGA 2M0YA 3RR6A 2GFAA 2IIMA 2J6OA 5FWBA 3OMCA 1V76A 2NYSA 2M1HA 2EJFA 3G6ET 2A37A 4HKEA 3G4ST 2DLPA 4FYVB 1FXXA 1VQ9A 1ULNA 2ZPFB 4QKUA 1T0JA 2MYSA 1VQ4T 2DL3A 1PTRA 4X9CA 4E2FB 1WHKA 5LJ3h 5HQ8A 1YJNA 3OYFA 1N13A 4M77C 2ROTA 2EW3A 2F5TX 2P4TA 2E64A 3P8HA 4QQ6A 1GBRA 3HP9A 2E70A 2FL7A 1NJIR 1FARA 2AT1B 2WACA 2L3RA 1K76A 2BIVA 2H3JA 1XJWB 2OTLQ 3LWHA 1TH7A 2JOYA 3NGPA 1CSKA 1XQHA 2MMPA 2ZZDA 4M77G 4M78F 5GAOl 1W70A 1KQSP 1V1IA 1VQKT 2F2WA 1UTIA 5D6YA 3QYHB 3DB4A 4HVVA 2KCXA 5AYFA 4NL2A 5DY9A 3CPWP 3QDRB 3CC2A 2RHUA 1ZX6A 1U1SA 5GAN8 1PRLC 3FJ5A 3I56Q 2KGTA 1OI1A 3GLXA 2RPNA 2WSEE 1BBZA 1ZQ1A 1JBMA 4N0AA 3OW2S 1PWTA 1TUGB 4B9XA 3J80E 4C8QF 4KUDK 3E9FA 2CJSC 2K9HA 2A7YA 2B0UC 5HCKA 1VYUA 3A8GB 2V53A 5FRMA 5KE3A 1NPPA 3MEWA 1TIHA 1KSWA 2M5XA 3VS5A 4KRTA 2N17A 1SGNI 4M75A 1ZA1B 2V1RA 4B6MA 2CWGA 2PQWA 1PG5B 1GCQC 1QKWA 3EGXA 1VQMA 2QQEA 1MT1A 2B8TA 3H8ZA 1PZWA 1WQ7A 2YQPA 4ZN3A 3UWNA 2VC8A 2CH4W 4IUVA 4OGCA 2DXCA 3JCMP 1VQ6Q 3H0FA 1UE9A 1N27A 4E7ZA 4PNOA 1CGII 4DNCA 2LCLA 1M8VA 4UXIA 4X1VA 3OYLA 1WJSA 2DX1A 4LN2A 3UPUA 2EJGA 1AWJA 4J8OA 5AT1B 2D1XA 1BMOA 3EGDB 3GOXA 1GFDA 3UFFA 1K7TA 4LDWA 5CVIA 2H3EB 1VQ9Q 1UVFA 4ELZC 1UJ0A 4FYXB 3JB9G 1B34A 4KUIA 3OW2P 3J81E 1YJNQ 1WQWA 4M4ZA 1M2VB 1GFCA 3DB3A 2FZGB 2QTXA 2WSCE 2V1QA 1HDLA 5IT9E 2HL5C 3JB9H 3JCMQ 5IN1A 1TUCA 4IUUA 3RUXA 4M7DG 1U1TA 2DPPB 4F17A 4N0AC 1HEVA 4OVOA 2DXUA 1KC8U 3CC7T 3A1PA 1WGCA 2A36A 5JHWC 3HKSA 2E6NA 3JV3A 3CCMT 2MIOA 4OB2B 1OEBA 3A8HB 7WGAA 3H0IA 4ZN1A 1PCEA 2DE0X 4DEXA 2QA4T 1CGJI 2RJEA 3NFCA 1KC8C 1F1BB 3CC2Q 2FPFA 5GMKe 1N6AA 2RHIA 4OB1B 4QW2A 2E4HA 2LC4A 4C5GA 1M9SA 2KEAA 3OSVA 5GAMj 2LQKA 1XNIA 4C5EA 2M9UA 3D7SB 4PJOB 3QIIA 2SEMA 1HD3A 2ED1A 2QGGA 2O4XB 4ANJA 2V8KA 4DQ2A 3BE3A 5LJ3g 5CCMA 1TXQA 2CZ1B 2RNAA 1VQMQ 4M7AC 1I07A 2KBTA 5I22A 2KI7A 3RESA 3CBPA 2FB7A 2GCXA 4LE9A 1ZBJA 1VQPA 1RAGB 1SGYI 2MF2A 2UVOA 2RQWA 3OYKA 2EKHA 1S20A 3DKMA 2LTOA 1ZA2B 2ZAEA 1YIJT 3OYHA 1NE8A 3C95A 4M7AG 5DAEA 4NS5A 3UEJA 1HK9A 3GIBA 3EH2A 1XTDA 2DBKA 4J9IA 3OXFA 3LH5A 5CKDA 1I8FA 4A53A 2ECZA 4FW2A 1IRXA 4EMHA 3A98A 1PHTA 1TS9A 4N4HA 1SPKA 2O9SA 1AOJA 3RKXA 3JSCA 1M2OA 4O6JA 1KFZA 3M55A 2XMFA 1M3BA 1T0HA 2VKNA 1E7LA 2CZ7B 3V7CA 5GANd 2RQTA 2V1CC 1ZSZC 1K73U 2F2XA 4PJJA 4JCVE 2KRSA 1YJWT 1ZUKA 2MK5A 4BDZA 1VQ5T 1BKBA 5EC7A 4KBMB 2LCSA 2N1UA 2LRQA 1Q86U 2AZVA 1YI2A 2QGFB 2DK3A 3VKIA 2Z0WA 1K73C 1UGSB 1QVGA 3TO9A 4FT2A 4M77B 4FSSA 3RERA 4HVWA 3RNJA 2RI2A 3OYNA 1Q86C 2CDTA 4ATOA 3PFSA 2P0QA 3CCRT 1HYOA 2KY9A 3URGA 2OAWA 2RB6A 3CCVA 1VQNA 1LJOA 1M1FA 2ROWA 1NBEB 3QWYA 1N9RA 4RTVA 4M75D 1M27C 2JNGA 2C0IA 5C6SA 1WKXA 3CCUA 4BI4A 2DKVA 2CREA 3EGDA 3E1SA 2COWA 3QJYA 2K79A 2YRCA 1TU0B 1BB9A 1JB0E 2OI3A 4M78C 4RCCA 3EG2A 1I81A 4AFZC 1JEGA 1I4K1 1NYFA 4JUVA 1VQPQ 3A5ZB 3F70A 2MWPA 1M2VA 1VQ8T 1FWZA 1NG2A 3DLMA 1W3SA 3MP1A 3CCQA 3V8JA 1OX9A 2DXBA 1O75A 1XOVA 3OL0A 2LQNA 3JAME 2RJDA 4DOWA 1TGSI 4D8DA 1WJQA 2K6DA 1RLPC 1VYTA 3JB9I 3JCMc 2RK2A 2ZGWA 4XU2A 2B8AA 2D6FA 1LR9A 3TSZA 4M78G 3QSUA 4Z02A 2JTFA 3KUFA 3MO8A 2JMCA 4AMCA 1X75C 2RQUA 1NPRA 4E7IA 3OYCA 4J6XA 1NJIU 3JRZA 1IGQA 3OYBA 3EAEA 4ZTFA 3CD6A 3OY9A 2QQBA 4ZGDB 1TBQR 4JRKA 3GF5A 1KQ1A 2EYXA 4C8QG 1Y71A 2E1HA 1ZSGA 2F5KA 1NJIC 2BUSA 2GBQA 2C0TA 1VQLA 1PPFI 3H6ZA 2MCNA 2X52A 2FG0A 3EFSA 1Y1BA 3QG1A 2ZCFB 5EG2A 4NL3A 4M7DB 5CCLA 4PJOA 2D8JA 2NWMA 1R0CB 1Z9ZA 5HK0A 2O4XA 1S1NA 2VGNA 5GAMe 1M3AA 2QQAA 2DEUA 3X24B 1ULMA 3NPFA 5LJ5j 4BE0A 2LT1A 1VA7A 4C92E 1D1AA 1LPLA
chains in the Genus database with same CATH topology
1IY6A 1BUSA 3MP6A 5M9OA 3A8MB 4FU6A 5A0DA 3CMET 4D6WA 3MEKA 1V29B 3SDZA 1VIFA 2ARPF 1BI0A 4LDYA 2XKOC 1M5Q1 3HPWA 3UGDA 4FSXA 2V8IA 2DB6A 2EWNA 5GAMd 3RU0A 3OYJA 4RG2A 2ORWA 5EX3A 5FU7C 3CCJT 1OYXA 1UVGA 2N71A 4QQGA 4LDXA 3ME9A 3FIFA 4IUPA 1EN7A 2HD0A 3HHTB 1G5VA 5KH6A 4EDUA 1N8RC 2OTLA 2JZ2A 2ORVA 4M7AB 4BE1A 4OGEA 3MHXA 2SGQI 4L59A 4PJOC 3ZBDA 4M77A 5GAOn 2I2LA 3I55A 1I5LA 1FAQA 2L89A 4PJOG 3BJIA 2K57A 1Q82U 4MDWA 1S72A 3MEAA 4NOYA 3SGBI 5GAOq 1KQSA 3TEEA 1QP3A 3M54A 4MZTA 5LJ5f 4C92F 5LJ3j 3FLGA 2HAXA 3CPWA 2FVUA 1Q82C 3OSSC 4L5GA 1OMUA 2MAMA 2W0TA 4E1RA 1YITT 3CC4T 4MZMA 2LDMA 4ELYC 5FLXE 3QJ6A 3G6EA 1IREB 3G4SA 2VXFA 1M1GA 3ER0A 4EMKB 1VQ4A 3OQ5A 3RKWA 3OVOA 1P92A 5GAN6 3V8LA 2R5AA 2LCCA 2K5FA 4F7UE 2RJCA 3L42A 4Y91A 5C0MA 3AHUA 4ZTJA 4M7DA 1ZBXA 4M78B 1VQKA 4RG8A 3PT9A 2L7XA 2SGPI 3HL8A 2LVMA 3QO3A 3NTIA 4A54A 4R55A 2KMTA 3VU3C 3OW2A 4BY6C 4QVZA 1DJ7B 3M5AA 4CI0C 3SFMA 3V7SA 5LJ5e 4C8QB 4GI3C 5GANh 1PSFA 2Y4XA 2WSFE 5CKHA 2X4WA 3FEOA 2VV5A 2CYZB 2KMPA 5LJ3f 2EQJA 2E73A 2QNCA 2LT4A 4BB7A 2RH2A 3JCMV 5HI7A 4TVRA 4UXHA 3ZFJA 3GP8A 2BUDA 1KG1A 2DD4A 5LJ5d 2ENNA 2JZMA 3Q1JA 1CT4I 3CEYA 2VYTA 4M7AA 1U5KA 2KMRA 4M7DC 4BE2A 4LDUA 2LQ8A 3ASKA 2OTJT 4F7UF 1RL2A 4QQDA 5CAIA 1W2BS 4GLKA 5GAN5 1VIEA 1NZ9A 2KMQA 3VYGA 4X34A 3EFRA 1KD1C 2QPOA 4VUBA 3QHSA 3CC7A 1TBNA 3KXTA 2XD0A 2XK0A 3PIPA 3CMAT 4M77D 1QP2A 2XG8D 1YHQT 3CCMA 4FKDA 2QEXT 2GKTI 1WGSA 4II1A 5FU7B 5HY6A 5GAOr 2QA4A 3WVEB 4PLIA 2E6ZA 1PJUA 1Z7KB 2JA1A 3OYGA 4XTXA 2E12A 3UGLA 4V2SA 2V1CA 4RCBA 4XAXB 5CO7A 4EPCA 1LOJA 5LJ3e 1M8BA 3OYYA 1IZ6A 2CZ6B 4YTLA 4M77E 4C5IA 1Y96B 3TREA 3BDUA 2GKVA 3JCMh 3HRTA 5LL6S 2JTMA 3OXGA 4EMKA 3NTHA 1SGEI 3OYMA 1KQ2A 2PUOB 3X20B 4BI3A 2XDBA 2SGFI 1YIJA 4XU1A 2E10A 5KE2A 1AHJB 5KCHA 3M57A 2DIPA 2PUKB 4M78A 2WVJA 1Q81U 3JCMW 1YCYA 2OD1A 2J87A 2KAFA 4JDSA 3JB9D 5CQYA 3OXLA 3DLLA 5GAMh 2RI5A 2XI9A 2YRVA 5GANg 1OMTA 1Q81C 3UEYA 4M7DD 4XU3A 1YJWA 2KMOA 4C8QA 1Q7YU 1QVPA 5GMKl 1TUSA 2VRWB 4N4IA 1IY5A 1VQ5A 1BI1A 1BIAA 3RKYA 3JCMX 2HBPA 3C12A 4B9WA 1R8OB 1SGQI 3X28B 4JLIA 5GAOm 3N5BB 1OZ2A 2XDPA 4C92G 4BD3A 4XU0A 4J5YA 1PSEA 3L2WA 1Q7YC 1SSFA 1MHNA 3V8KA 3VDPA 4C5HA 3TJQA 2FNFX 3VE5A 2RHZA 3HFNA 3BY7A 4EMKC 2SGEI 2E5RA 3PMIA 1HJAI 3VV0A 3CCRA 4MMLA 1EIFA 3QPHA 3CCST 1PTQA 1YI2T 4BUGA 3MEUA 4M77F 1VQOT 4A4HA 4L9MA 2QQCA 4BY6B 3FRNA 1VUBA 2NU1I 3CCVT 3OB9A 5J39A 1VQ8A 2E41A 3OBWA 2EQUA 1JRIA 2G3RA 2Y90A 3CBMA 2ZPHB 3OA6A 2GKRI 1Y1CA 1YTPA 4M75E 1N9SA 3FB9A 4M7AD 3X25B 4RKUE 2X4YA 1TOTA 1R0RI 2KDSA 3A8OB 2HQXA 4C8QC 1JJ2S 4GY5A 4XQ3A 1OVOA 1NUBA 2JN0A 5DM7R 1QVFS 1GXIE 3M59A 1KHIA 3SWNB 2DXTA 3LW5E 5GAN4 2R58A 2P0PA 1G3SA 2K3XA 3CCLA 4A24A 2C06A 2CZ0B 3JCMg 4BACA 4R56A 3HH2C 1Y96A 4RMOA 3CD6T 2VGMA 2HQEA 1CHOI 1Y8FA 1BI3A 5EX0A 1YJ9T 3JB9F 1VDDA 3J7AF 4X9DA 2ELIA 3QTLD 3PTAA 3CCET 3OS5A 1VQ7T 3CMEA 3L2RA 1R79A 5CIUA 2RK1A 2Y4YA 1YBYA 2EFIA 4QVCA 3SEKC 2CGHA 5GAN7 4A4FA 2YLCA 3CBOA 4KT0E 3O8VA 4F7UG 5GAMg 4FIBA 2N1AB 2PVGB 3CCJA 3G71T 1G3YA 1N8RU 3FJPA 2YLBA 2DTHA 2EIFA 1E7DA 4M75F 4M78D 2K3YA 4JLGA 2QQRA 4UXJA 2XIDA 1QW1A 1K9MC 4Q5WA 1U8RA 1TURA 3OMGA 3R6OA 4J83A 2PU9B 4E7KA 3D00A 3A8LB 4C8QD 5D6XA 3L2QA 3RMQA 4MDXA 2OTLT 4M7AF 2N52A 2KSSA 2E65A 2P6AC 3L2ZA 1O9SA 5FU6C 4J7FA 2RO0A 3I56T 3E19A 2X4XA 2YUUA 2DEQA 1D3BB 4C92B 3C4SA 1WNLA 5CKEA 1YITA 3VDUA 4ZGEB 2V8JA 5GAOp 4XTYA 1CT0I 2DTIA 1XBTA 1WJRA 3P8DA 3E59A 2F69A 1K8AU 2VUBA 5CR2A 2E5QA 2K5IA 4JS4A 5A2QE 3X26B 1X6OA 3UDCA 2NU0I 3GNFB 3CPFA 1HPTA 4OF1A 3FC3A 3CXCS 2NU4I 2GF7A 3QYGB 1K8AC 1VQ6T 3M9QA 2ENZA 4HCBA 2D0QB 3SWNA 1YU6C 4A4EA 4L6V5 5GANj 5HK3A 2EQMA 1VQ9T 1Y07A 5GMKh 2PVOB 1YJNT 3HSBA 2EYQA 4A4GA 3CXLA 3PNWC 2XU8A 3QUIA 5CQXA 2PVDB 3M53A 2ODDA 4OB0B 3HRSA 3OYAA 3GPLA 4PJOD 2LNVA 3L2UA 2L8DA 5A0GA 5KCOA 3FDRA 4E7JA 3PGGA 4XTWA 2RHYA 3E9GA 3SB2A 3CC2T 4EMGA 1X74A 2QI2A 2NLUA 1M4ZA 5DLQE 3KY9A 2QQDA 1G3WA 4DA4A 4PJOE 2FYKA 4OVAA 1M90U 3SWNC 5LJ5g 1LR8A 1VQMT 5FUXA 3OYEA 4C0GA 2DJZA 1M1KU 3VUZA 4XTZA 1V1HA 3OYIA 1M90C 4B6DA 4J6YA 1W2BA 2ZPEB 5DLOA 2OTJA 2KK4A 2K5LA 1KD1U 2EQKA 2CKKA 2RD1A 1MGQA 4F7UB 1W4RA 1M1KC 1UGQB 5GANf 3OS1A 3TU4K 2RM4A 2LX9A 3OS0A 5FUVA 4JRIA 2QNFA 5D6WA 3CMAA 3UGIA 1YHQA 1TBRR 4LD6A 2QEXA 2LUYA 4C0FA 3WVDB 3SD4A 2JYYA 1D3BA 4C92A 4XK8E 1RI0A 3BDLA 2F3CI 3JCMb 1BYMA 1SGPI 3G7ZA 4J6WA 3LX7A 5L8RE 2J9RA 4HA8A 4M75C 3S3NA 2ZPIB 3NTKA 3LYIA 2DVEA 1G3TA 2GQVA 4C0DC 4PLLA 3QZ9B 5GMKi 1BIBA 1SGDI 3LGLA 2EAYA 4PJOF 4M75G 1X4SA 5GAN2 5CKFA 4ZGJB 2GFUA 2YHTA 3OBYA 5FU6B 3VYHB 5LJ3d 4E47A 1KHCA 4E7LA 4CRIA 4IKFA 3B4VC 2RI3A 5GANe 1VQPT 4C0ZA 4HT8A 4PL6A 4HT9A 2DKGA 4PKCC 2RJFA 2M16A 4XTUA 3TCJA 5J3BA 4Y28E 3UT1A 1OZ3A 5IAYA 3RMSA 4C92C 4OP0A 1BI2A 2A3LA 1IW4A 2WCYA 1HXDA 3M4YA 3JCMf 5CK9A 3LGFA 2XHCA 3INZA 1CE3A 4SGBI 5I2SA 2OVOA 2KVQG 2XDDA 3S3MA 2DTOA 3WXMB 2QDYB 4HGUA 3P8BB 2ZPGB 4XTVA 3QXEB 4FT4A 4J7IA 4M7DE 3CCSA 1SGRI 4E7HA 2DD5A 2QXFA 3S3OA 4A4KA 1VQOA 2MI6A 3QWPA 5CCAA 4N4GA 2X35A 1QVGS 1LR7A 2UZ3A 4DOVA 2DZ9A 1KMAA 5GAMf 4P5NA 1VQNT 4F7UA 4LD9K 2DIGA 2M0OA 3QBYA 3MCAB 2ERWA 3CCUT 5CKBA 3ZEHA 1JJ2A 3BW1A 5I21A 4IUQA 2VXEA 1QVFA 5FROA 3SGQI 2XRCA 3CCQT 1CSOI 5HKCA 1FYBA 3M56A 3JCMe 4LDVA 4HCZA 3M58A 2JW6A 3L2VA 4IUTA 1KBEA 4M7AE 2DAQA 2DZCA 1X01A 1LNXA 2NU2I 1FX7A 3RIRA 4HCCA 2A20A 3PMTA 1KBFA 2K4YA 2SGDI 4C92D 1YJ9A 2JUFA 5A0LA 1ZHIA 4E1PA 4JJNK 1AN1I 1UB4A 2GVIA 2MWOA 3CCLT 1VQLT 3CCEA 3JCMd 4M7DF 1VQ7A 1RFHA 2LEOA 4IURA 1OYVI 2QQ9A 3HRUA 3S6WA 3QKJA 4BI8B 3LLRA 1XX6A 2HNIA 3V7RA 2QQSA 4MMKA 3E2IA 4FM4B 4FL6A 1DS2I 3HFOA 2NU3I 4UC4A 2CS7A 1M8CA 2OAUA 3MEVA 2DO3A 5FUYA 3G71A 5FRNA 3T9NA 3LH0A 1CT2I 2ZPBB 4O5VA 4QVDA 1K9MU 2IG0A 3PDNA 4WF2A 4M75B 2JVVA 2R5MA 2O01E 2QQ0A 1WPYA 3PIOA 3JB9J 5GAN3 3JCMJ 3KBGA 3L1AA 4C0DB 2JXDA 2L5QA 5LJ5h 4OB3B 1UGPB 3OYDA 1W4SA 2IVWA 2DIQA 3M4GA 1Y7XA 4MZPA 2L8EA 3VUBA 2D9TA 2BKDN 3OS2A 4BDYA 2AHJB 5GMKm 4JRPA 4M78E 2RA2A 2P0KA 4JRQA 2R57A 5I2MA 1H641 1B34B 3C94A 3VJPA 3I56A 3I55T 3META 2X4JA 2K2VA 1DS3I 2EJ9A 4C8QE 3CC4A 2FHDA 2RHXA 1S72T 5GMKj 4OMFB 1UUCA 3MP8A 1XA6A 3CXCA 1UGRB 2KQWA 3QZ5B 1KQSS 4KULA 3BFMA 4ME7A 5FUWA 5J26A 2EKOA 1VQ6A 1H3ZA 1H0ZA 1TBOA 3CPWS 2XICA 3LWIA 4JS5A 1UEBA 3GNGA 2GFAA 3OMCA 2M1HA 2EJFA 3G6ET 3G4ST 4HKEA 1FXXA 1VQ9A 2ZPFB 1VQ4T 1PTRA 4X9CA 5LJ3h 5HQ8A 1YJNA 3OYFA 1N13A 4M77C 2F5TX 2P4TA 2E64A 3P8HA 4QQ6A 3HP9A 2E70A 2FL7A 1FARA 2WACA 2L3RA 2BIVA 2H3JA 3LWHA 1TH7A 2JOYA 1XQHA 2MMPA 2ZZDA 4M77G 4M78F 5GAOl 1V1IA 1VQKT 5D6YA 3QYHB 3DB4A 2KCXA 5AYFA 4NL2A 5DY9A 3QDRB 3CC2A 2RHUA 1U1SA 5GAN8 1OI1A 3GLXA 2WSEE 1ZQ1A 1JBMA 4N0AA 3OW2S 4B9XA 3J80E 4C8QF 4KUDK 3E9FA 2CJSC 2K9HA 2A7YA 2B0UC 3A8GB 2V53A 5FRMA 5KE3A 1NPPA 3MEWA 1TIHA 2M5XA 2N17A 1SGNI 4M75A 2PQWA 1VQMA 2QQEA 1MT1A 2B8TA 3H8ZA 1WQ7A 2YQPA 4ZN3A 3UWNA 2VC8A 4OGCA 4IUVA 2DXCA 3JCMP 1N27A 4PNOA 1CGII 2LCLA 1M8VA 4UXIA 3OYLA 1WJSA 3UPUA 2EJGA 4J8OA 1BMOA 3GOXA 3UFFA 4LDWA 5CVIA 1UVFA 4ELZC 3JB9G 1B34A 4KUIA 3J81E 1WQWA 3DB3A 2QTXA 2WSCE 1HDLA 5IT9E 3JB9H 3JCMQ 5IN1A 4IUUA 3RUXA 4M7DG 1U1TA 2DPPB 4N0AC 4OVOA 2DXUA 1KC8U 3CC7T 5JHWC 3HKSA 2E6NA 3CCMT 4OB2B 3A8HB 4ZN1A 1PCEA 2QA4T 1CGJI 2RJEA 3NFCA 1KC8C 5GMKe 1N6AA 2RHIA 4OB1B 4QW2A 2LC4A 4C5GA 1M9SA 3OSVA 5GAMj 2LQKA 1XNIA 4C5EA 2M9UA 4PJOB 3QIIA 2O4XB 2V8KA 4DQ2A 5LJ3g 5CCMA 2CZ1B 4M7AC 3RESA 3CBPA 2FB7A 2GCXA 1VQPA 1SGYI 2MF2A 3OYKA 3DKMA 2LTOA 1YIJT 3OYHA 1NE8A 3C95A 4M7AG 5DAEA 4NS5A 3UEJA 1HK9A 3GIBA 1XTDA 3OXFA 5CKDA 1I8FA 4A53A 4EMHA 4N4HA 3RKXA 3JSCA 4O6JA 3M55A 1E7LA 2CZ7B 3V7CA 5GANd 2V1CC 1K73U 4JCVE 1YJWT 4BDZA 1VQ5T 1BKBA 4KBMB 2LRQA 1Q86U 1YI2A 2DK3A 3VKIA 1K73C 1UGSB 1QVGA 4FT2A 4M77B 3RERA 2RI2A 3OYNA 1Q86C 4ATOA 3PFSA 2P0QA 3CCRT 2KY9A 3URGA 3CCVA 2RB6A 1VQNA 1LJOA 1M1FA 2ROWA 1N9RA 4M75D 2JNGA 5C6SA 3CCUA 4BI4A 3E1SA 3QJYA 1JB0E 4M78C 4RCCA 1I81A 1I4K1 4JUVA 3A5ZB 3F70A 2MWPA 1VQ8T 1W3SA 1FWZA 3DLMA 3MP1A 3CCQA 3V8JA 2DXBA 1O75A 1XOVA 3OL0A 3JAME 2RJDA 4DOWA 1TGSI 1WJQA 3JB9I 3JCMc 2RK2A 2ZGWA 4XU2A 2B8AA 2D6FA 1LR9A 4M78G 3QSUA 4Z02A 2JTFA 3KUFA 3MO8A 1X75C 1NPRA 4E7IA 3OYCA 4J6XA 1NJIU 3JRZA 3OYBA 3EAEA 4ZTFA 3CD6A 3OY9A 2QQBA 4ZGDB 1TBQR 4JRKA 3GF5A 1KQ1A 4C8QG 1Y71A 2E1HA 2F5KA 1NJIC 2BUSA 1VQLA 1PPFI 3H6ZA 3EFSA 1Y1BA 3QG1A 4M7DB 2ZCFB 5EG2A 4NL3A 5CCLA 4PJOA 5HK0A 2O4XA 2VGNA 5GAMe 2QQAA 3X24B 5LJ5j 4BE0A 2LT1A 4C92E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OS0 A;  2K3X A;  2XDP A;  4E7K A;  3UWN A;  3MP6 A;  2R5M A;  4BD3 A;  2GFA A;  5D6X A;  3L2Q A;  3L2W A;  3UT1 A;  1OZ3 A;  4A4G A;  4IUV A;  5M9O A;  5D6W A;  3OMC A;  5IAY A;  4BAC A;  2QNF A;  3PNW C;  1SSF A;  1MHN A;  4FU6 A;  1N27 A;  3FLG A;  2M1H A;  2X4W A;  5C6S A;  3FEO A;  4C5H A;  4LD6 A;  2RHZ A;  2HQE A;  3OYD A;  4HCZ A;  2DIQ A;  3PMI A;  3OYL A;  1WJS A;  3OYK A;  3LGF A;  3L2V A;  4IUT A;  4C5I A;  3SD4 A;  3OYA A;  2EQJ A;  2LTO A;  3GOX A;  2QNC A;  1RI0 A;  2DAQ A;  3OYF A;  3BDL A;  3OYH A;  2RO0 A;  2LDM A;  3MEU A;  2D9T A;  2BKD N;  2MWP A;  3F70 A;  3DLM A;  3L2U A;  4NS5 A;  2X4X A;  3MP1 A;  3QJ6 A;  4A4H A;  2L8D A;  3NTH A;  3OS2 A;  3P8H A;  4QQ6 A;  4BDY A;  3OYJ A;  3PMT A;  4RG2 A;  3C4S A;  2RJD A;  3H8Z A;  3LX7 A;  2BUD A;  5KCO A;  3S3M A;  3FDR A;  4E7J A;  3OYM A;  1WJQ A;  2RHY A;  1OYX A;  3L2R A;  3E9G A;  2WAC A;  2L3R A;  5CIU A;  2B8A A;  2P0K A;  4N4H A;  3DB3 A;  2BIV A;  2R57 A;  2NLU A;  3OQ5 A;  4Z02 A;  5IN1 A;  2EFI A;  2JTF A;  3KUF A;  3MO8 A;  3Q1J A;  4IUU A;  3S3N A;  4QQG A;  1WJR A;  4E7H A;  3P8D A;  3CEY A;  2VYT A;  3OB9 A;  3ME9 A;  3NTK A;  5J39 A;  2R5A A;  1E7L A;  2LCC A;  2MWO A;  3LYI A;  4IUP A;  3OYC A;  4E7I A;  3S3O A;  1EN7 A;  3OYG A;  1G5V A;  4A4F A;  2E5Q A;  5KH6 A;  2EQU A;  4EDU A;  3MET A;  4BE2 A;  5D6Y A;  3O8V A;  2G3R A;  3DB4 A;  3OYB A;  3EAE A;  4OVA A;  4PLL A;  2JZ2 A;  4ZTF A;  4IUR A;  5KE2 A;  2RJC A;  3L42 A;  3OA6 A;  4BE1 A;  3ASK A;  3OY9 A;  5KCH A;  5C0M A;  4N4G A;  2E6N A;  2RHU A;  2X35 A;  4L59 A;  3S6W A;  3FC3 A;  3QKJ A;  3LGL A;  4QQD A;  1OI1 A;  2X4Y A;  4BDZ A;  2GF7 A;  3LLR A;  4ZTJ A;  2F5K A;  3M9Q A;  2FHD A;  2HQX A;  2RHX A;  4B9X A;  3OYE A;  2QQS A;  2LRQ A;  4GY5 A;  2RJE A;  1E7D A;  3E9F A;  4FL6 A;  3H6Z A;  2GFU A;  3OYI A;  2RI5 A;  4X34 A;  3MP8 A;  4UC4 A;  4A4E A;  1KHC A;  2K3Y A;  2RHI A;  2YRV A;  5FRM A;  5KE3 A;  2DIG A;  2M0O A;  3MEW A;  2LVM A;  4E7L A;  4CRI A;  2XK0 A;  2L89 A;  3MEV A;  3NTI A;  3QBY A;  4QW2 A;  4C5G A;  2QQR A;  4IKF A;  5FRN A;  2O4X A;  2RI3 A;  2EQK A;  2CKK A;  4QVZ A;  3ZEH A;  1WGS A;  4II1 A;  4PL6 A;  5J26 A;  1XNI A;  2RI2 A;  4IUQ A;  4N4I A;  4Q5W A;  2EKO A;  3OYN A;  2EQM A;  2PQW A;  4C5E A;  3LH0 A;  1H3Z A;  3QII A;  4B9W A;  4PLI A;  2RJF A;  2M16 A;  3MEA A;  3OMG A;  3PFS A;  5FRO A;  3OS1 A;  4BE0 A;  2R58 A;  2O4X B;  2IG0 A;  1OZ2 A; 
#chains in the Genus database with same CATH topology
 1IY6 A;  1BUS A;  1WHL A;  3R5B A;  3MP6 A;  1NLP C;  4CC4 B;  5M9O A;  3A8M B;  2BZX A;  3AT1 B;  4R0K A;  4FU6 A;  4J9H A;  5A0D A;  3CME T;  4HXJ A;  3I35 A;  2CT4 A;  3CCV Q;  1VQN Q;  4D6W A;  1QWE A;  3MEK A;  1V29 B;  1SSH A;  3SDZ A;  2EYZ A;  1VIF A;  4AML A;  4F04 B;  3CCU Q;  1GCP A;  2ARP F;  1BI0 A;  4LDY A;  2XKO C;  4JPB W;  1A0N B;  1M5Q 1;  3HPW A;  3UGD A;  4FSX A;  2V8I A;  2FEI A;  4LNP A;  2DB6 A;  2EWN A;  3I5S A;  5GAM d;  3RU0 A;  3OYJ A;  1R77 A;  2HZY A;  4OML A;  4RG2 A;  2ORW A;  5EX3 A;  4J9E A;  5FU7 C;  1WHJ A;  3CCJ T;  1OYX A;  1UVG A;  1QMC A;  3CCQ Q;  1RAC B;  1AZG B;  2QTV A;  2N71 A;  4QQG A;  1K7V A;  4LDX A;  2DNU A;  3ME9 A;  3EFO B;  1Q81 R;  3FIF A;  3TOA A;  4IUP A;  1EN7 A;  2HD0 A;  3HHT B;  1G5V A;  3PVQ A;  5KH6 A;  4EDU A;  1N8R C;  2HSE B;  1I1J A;  2OTL A;  2RN8 A;  2CP5 A;  2JZ2 A;  2ORV A;  4M7A B;  4BE1 A;  1MMA A;  4OGE A;  3MHX A;  1KIK A;  2SGQ I;  4L59 A;  4PJO C;  3I5R A;  3ZBD A;  4M77 A;  5GAO n;  1T3L A;  2I2L A;  2QDL A;  5KYW B;  1Q7Y R;  2LZ6 B;  5J8F A;  3I55 A;  1I5L A;  1G83 A;  1IB8 A;  2DRK A;  1FAQ A;  2L89 A;  2CSQ A;  4PJO G;  3BJI A;  1JU5 C;  3CCL Q;  2K57 A;  1VQL Q;  1UFF A;  2LB7 A;  1IHW A;  1Q82 U;  2EGE A;  4MDW A;  1S72 A;  3MEA A;  4NOY A;  4F16 A;  3SGB I;  1PC0 A;  5GAO q;  3UAT A;  1KQS A;  2P84 A;  3TEE A;  1QP3 A;  3M54 A;  4MZT A;  5LJ5 f;  4E6R A;  1NEG A;  4C92 F;  5LJ3 j;  3FLG A;  3RDV A;  1UG1 A;  2HAX A;  3CPW A;  2FVU A;  1Q82 C;  3OSS C;  4L5G A;  1OMU A;  2MAM A;  2W0T A;  1ZSZ B;  1YIT T;  4E1R A;  3CC4 T;  2FZC B;  1R0B G;  2F1L A;  1D09 B;  1WI7 A;  4MZM A;  3EHQ A;  5ECA A;  2OX7 A;  2OJ2 A;  2LDM A;  4ELY C;  4LXC A;  5FLX E;  3TSW A;  2C0O A;  2K7A A;  3QJ6 A;  3EG9 B;  1JO8 A;  3G6E A;  4FYW B;  1IRE B;  1GCQ A;  3G4S A;  2A0F B;  1QCO A;  2VXF A;  1IGU A;  1M1G A;  3ER0 A;  4EMK B;  2RC4 A;  1I0C A;  1J3T A;  1IO6 A;  3TVT A;  1VQ4 A;  3OQ5 A;  2AZS A;  3RKW A;  1BCO A;  5IH2 A;  3OVO A;  1P92 A;  5GAN 6;  3V8L A;  2R5A A;  2LCC A;  2K5F A;  2VVK A;  4F7U E;  4OMQ A;  2D0N A;  2G6F X;  3R5C A;  2HKQ B;  1U3O A;  1OOT A;  2VB6 A;  1FMK A;  4ESR A;  2ABL A;  5IHI A;  2RJC A;  3L42 A;  4Y91 A;  5C0M A;  1X2K A;  2KT8 A;  3REA B;  3AHU A;  1WDX A;  4ZTJ A;  2BE7 D;  2DA9 A;  4M7D A;  8ATC B;  2Y0M A;  1ZBX A;  2RF0 A;  4WTO B;  1HSQ A;  4M78 B;  1VQK A;  4RG8 A;  3PT9 A;  1D0Y A;  2PNI A;  3EG1 A;  2L7X A;  2SGP I;  2KYM A;  2A28 A;  3HL8 A;  4OMO A;  4PK4 A;  2LVM A;  3QO3 A;  3NTI A;  4A54 A;  4R55 A;  2KMT A;  3VU3 C;  3OW2 A;  4BY6 C;  4QVZ A;  1DJ7 B;  3M5A A;  4CI0 C;  3EG0 A;  4GBQ A;  3I55 Q;  3SFM A;  3V7S A;  5LJ5 e;  4C8Q B;  4GI3 C;  5GAN h;  1NEB A;  1AT1 B;  4KGX B;  1PSF A;  2Y4X A;  1T3S A;  2WSF E;  5CKH A;  1FMV A;  2X4W A;  1S72 Q;  3FEO A;  2VV5 A;  2CYZ B;  2LNH B;  2KMP A;  2NUZ A;  5LJ3 f;  3M0T A;  1SRM A;  1M30 A;  2EQJ A;  2E73 A;  4WCI A;  5KYN A;  2QNC A;  2LT4 A;  2LX7 A;  4BB7 A;  2RH2 A;  4KGZ B;  4AG2 C;  1IHV A;  3JCM V;  5HI7 A;  4TVR A;  4UXH A;  3ZFJ A;  2HCK A;  3GP8 A;  4J9D A;  2BUD A;  1B07 A;  1K1Z A;  2L3P A;  1KG1 A;  3EFO A;  6AT1 B;  1AWO A;  2DD4 A;  5LJ5 d;  4Y92 A;  2ENN A;  2JZM A;  2BE9 B;  1RAD B;  4J9B A;  3Q1J A;  3G6E Q;  4CC7 A;  1N8R R;  1CT4 I;  3CEY A;  1X27 A;  2VYT A;  3G4S Q;  4M7A A;  1U5K A;  2KMR A;  4EIK A;  4M7D C;  1HJD A;  4BE2 A;  2YUQ A;  4LDU A;  2I0N A;  2JS2 A;  1VQ4 Q;  2LQ8 A;  1YWO A;  3ASK A;  5KYW A;  2OTJ T;  4F7U F;  1V1C A;  1RL2 A;  4QQD A;  5CAI A;  4RTZ A;  1OPL A;  1W2B S;  3FSX A;  4GLK A;  3UA6 A;  2O88 A;  2KR3 A;  5GAN 5;  3H41 A;  2GGR A;  1G2B A;  1VIE A;  5KYY A;  1NZ9 A;  1WXB A;  2KMQ A;  1MUZ A;  1TTH B;  2O2O A;  1MNE A;  1P9Z A;  3VYG A;  4X34 A;  2DRM A;  3EFR A;  1KD1 C;  2QPO A;  4OMN A;  4VUB A;  1D0Z A;  1ULK A;  3QHS A;  3CC7 A;  1TBN A;  3KXT A;  1AEY A;  2XD0 A;  2XK0 A;  1WZO A;  3PIP A;  3CMA T;  4M77 D;  3U23 A;  1QP2 A;  2JM8 A;  2XG8 D;  1YHQ T;  3CCM A;  4FKD A;  2QEX T;  2GKT I;  1WGS A;  2P4R A;  4II1 A;  5FU7 B;  2GTJ A;  5HY6 A;  5GAO r;  1VQK Q;  2DYB A;  2YUN A;  2QA4 A;  3WVE B;  1WHG A;  4PLI A;  2E6Z A;  1PJU A;  1Z7K B;  2HL3 A;  2JA1 A;  3OYG A;  4XTX A;  1PKT A;  2E12 A;  2WGC A;  4V2S A;  3UGL A;  2V1C A;  4RCB A;  1ZSZ A;  4AFU C;  4XAX B;  1Q82 R;  5CO7 A;  4EPC A;  1LOJ A;  2JXB A;  1K7U A;  5LJ3 e;  2HDA A;  1M8B A;  3OYY A;  1IZ6 A;  1MND A;  2CZ6 B;  1EZZ B;  4YTL A;  2OZU A;  4M77 E;  3EG9 A;  2DL5 A;  4C5I A;  1Y96 B;  3TRE A;  2AKL A;  3BDU A;  2GKV A;  3JCM h;  3HRT A;  5LL6 S;  4RTT A;  2JTM A;  3OXG A;  4EMK A;  2K2M A;  1TOV A;  3NTH A;  1W2B P;  2CWH A;  1SGE I;  1RAB B;  1K8A R;  4Z89 A;  3OYM A;  1CKB A;  1KQ2 A;  2JJ9 A;  5FWC A;  1C1A A;  2AKK A;  1B3Q A;  2PUO B;  3X20 B;  4BI3 A;  3IQL A;  2XDB A;  2SGF I;  1YIJ A;  4HVU A;  2X51 A;  2AIR B;  4MPI A;  4XU1 A;  2E10 A;  4AT1 B;  1ZUU A;  2HKN A;  1LCK A;  5KE2 A;  1AHJ B;  5KCH A;  4Z88 A;  3H9N A;  2PUK B;  3M57 A;  4M78 A;  2ENM A;  3THK A;  2DIP A;  2WVJ A;  1Q81 U;  1VOM A;  1YCY A;  3JCM W;  2OD1 A;  2J87 A;  1QCF A;  2KAF A;  4JDS A;  1WHH A;  3JB9 D;  2KT1 A;  5CQY A;  4DBR A;  5IHN A;  3DLL A;  5GAM h;  3OXL A;  2RI5 A;  2XI9 A;  3SEM A;  2YRV A;  5GAN g;  1QKX A;  1OMT A;  1Q81 C;  2W0Z A;  3UEY A;  4M7D D;  4XU3 A;  1YJW A;  2KMO A;  4C8Q A;  2DM1 A;  1Q7Y U;  1QVP A;  2NUT B;  5GMK l;  1TUS A;  2VRW B;  4N4I A;  4RUG A;  1IY5 A;  1VQ5 A;  1BI1 A;  1BIA A;  3RKY A;  3JCM X;  2HBP A;  3C12 A;  4B9W A;  1R8O B;  3X28 B;  1SGQ I;  4JLI A;  3CC7 Q;  5GAO m;  3N5B B;  1FYN A;  1OZ2 A;  1B7T A;  2XDP A;  4C92 G;  3CCM Q;  4BD3 A;  4XU0 A;  4J5Y A;  1PSE A;  3L2W A;  4RTX A;  3VS1 A;  4JJB A;  1Q7Y C;  1X2Q A;  1SSF A;  1MHN A;  3V8K A;  2QA4 Q;  3VDP A;  4C5H A;  3TJQ A;  2FNF X;  3VE5 A;  2RHZ A;  3HFN A;  1QQJ A;  3BY7 A;  4EMK C;  2SGE I;  2E5R A;  3PMI A;  1HJA I;  3VV0 A;  3CCR A;  4MML A;  1EIF A;  3QPH A;  5L23 A;  3CCS T;  1PTQ A;  1YI2 T;  3VRY A;  3GBQ A;  4BUG A;  3MEU A;  1RAI B;  3TOB A;  2KRM A;  4M77 F;  1VQO T;  4A4H A;  4L9M A;  2GTO A;  2QQC A;  2MOX A;  5FW9 A;  4BY6 B;  2JTE A;  3FRN A;  1VUB A;  1M90 R;  2NU1 I;  2DL4 A;  4OMP A;  3CCV T;  3OB9 A;  5J39 A;  1Q9B A;  2L0A A;  2YXY A;  1VQ8 A;  2E41 A;  1WYX A;  2DF6 A;  3OBW A;  2EQU A;  2VAS A;  1JRI A;  2G3R A;  2CT3 A;  2Y90 A;  1M1K R;  3CBM A;  4F14 A;  1ABO A;  2ZPH B;  3OA6 A;  1YCS B;  2GKR I;  1YIJ Q;  1Y1C A;  1YTP A;  4M75 E;  1N9S A;  3FB9 A;  4M7A D;  3X25 B;  4RKU E;  2X4Y A;  1TOT A;  4PFZ A;  1R0R I;  2KDS A;  3A8O B;  2HQX A;  1KD1 R;  4C8Q C;  7AT1 B;  1JJ2 S;  4GY5 A;  1JQQ A;  1OV3 A;  4XQ3 A;  1OVO A;  2NUP B;  1NUB A;  2JN0 A;  5DM7 R;  1QVF S;  2M51 A;  1GXI E;  1MMG A;  3EH1 A;  3M59 A;  1KHI A;  4OMM A;  3SWN B;  2DXT A;  3LW5 E;  2CP2 A;  2GIV A;  5GAN 4;  2X3W D;  2R58 A;  2P0P A;  1G3S A;  2DL8 A;  2K3X A;  3CCL A;  4A24 A;  1YJW Q;  2C06 A;  4KH0 B;  2CZ0 B;  4DBQ A;  3M0Q A;  2X3X D;  1OU8 A;  3JCM g;  4QT7 A;  1VQ5 Q;  4BAC A;  4R56 A;  3HH2 C;  1EFN A;  1Y96 A;  4RMO A;  3CD6 T;  1X6G A;  2VGM A;  2HQE A;  1CHO I;  1Y8F A;  2YUP A;  1BI3 A;  5EX0 A;  1YJ9 T;  3JB9 F;  4RTW A;  1AVZ C;  1VDD A;  5KYX B;  2QYZ A;  1SKU B;  3J7A F;  4X9D A;  2ELI A;  3QTL D;  3PTA A;  3CCE T;  3OS5 A;  1VQ7 T;  3CME A;  1PNJ A;  3CCR Q;  2ATC B;  2FPD A;  1SRL A;  1JJ2 P;  3L2R A;  1OPK A;  2J6K A;  2FPE A;  1R79 A;  1RUW A;  5CIU A;  3VRZ A;  1ZUY A;  2RK1 A;  2Y4Y A;  8AT1 B;  1QVF P;  1YBY A;  2EFI A;  4QVC A;  3SEK C;  2LJ0 A;  1AD5 A;  2CGH A;  3FSY A;  5GAN 7;  4A4F A;  2YLC A;  1YNZ A;  3CBO A;  1MMD A;  4KT0 E;  3O8V A;  4F7U G;  5GAM g;  4FIB A;  2KE9 A;  4KGV B;  2N1A B;  1SHF A;  2PVG B;  3CCJ A;  3G71 T;  1G3Y A;  1N8R U;  2CP0 A;  1VQ8 Q;  3FJP A;  2YLB A;  2DTH A;  2CH4 A;  2EIF A;  2YT6 A;  2H8H A;  1E7D A;  5IHK A;  4M75 F;  2NUT A;  4M78 D;  2K3Y A;  2RQV A;  1GBQ A;  1WIE A;  3M0P A;  2RQR A;  1WTJ A;  4JLG A;  2QQR A;  1PRM C;  3TQ7 P;  4UXJ A;  2XID A;  1QW1 A;  4J9C A;  1K9M C;  3MJX A;  4Q5W A;  1YN8 A;  1U8R A;  4AFQ C;  2PZ1 A;  1TUR A;  5J8C A;  1I5O B;  3OMG A;  1YP5 A;  3PVL A;  1OX8 A;  2GQI A;  4PFP A;  3R6O A;  4J83 A;  1Y57 A;  2PU9 B;  4E7K A;  3D00 A;  3A8L B;  3E2U A;  4C8Q D;  5D6X A;  2F2V A;  3L2Q A;  3M0U A;  3RMQ A;  3R6N A;  4MDX A;  2OTL T;  4M7A F;  2N52 A;  2FO0 A;  5KYY B;  2EYY A;  2KSS A;  2E65 A;  2P6A C;  2DFU A;  1RI9 A;  1RAF B;  3L2Z A;  1E6H A;  1O9S A;  5FU6 C;  2BZ8 A;  4J7F A;  3UA7 A;  2RO0 A;  3I56 T;  4FW1 A;  4KH1 B;  3E19 A;  2X4X A;  4PJN A;  1YFN A;  1VYV A;  2YUU A;  2DEQ A;  1NXU A;  4DBF A;  1D3B B;  4C92 B;  3C4S A;  1WNL A;  5CKE A;  1YIT A;  3VDU A;  4ZGE B;  2V8J A;  2FRW A;  5GAO p;  2YWW A;  1WLP B;  4XTY A;  1MJB A;  1CT0 I;  2DTI A;  5I11 A;  5IXB A;  1XBT A;  3CME Q;  1WJR A;  3P8D A;  4AG1 C;  3E59 A;  2F69 A;  1K8A U;  2VUB A;  9ATC B;  5CR2 A;  2E5Q A;  2K5I A;  4JS4 A;  5A2Q E;  3X26 B;  1X6O A;  2L3S A;  3UDC A;  2NU0 I;  2LQW A;  3GNF B;  3CPF A;  2DBM A;  1HPT A;  2NUP A;  4OF1 A;  2BZY A;  3FC3 A;  3CXC S;  2IPO B;  2NU4 I;  1MV0 B;  2GF7 A;  3QYG B;  1K8A C;  1AWX A;  1VQ6 T;  3M9Q A;  1X43 A;  2ENZ A;  4HCB A;  1Q95 G;  3CCJ Q;  2D0Q B;  1WHM A;  3SWN A;  1YU6 C;  1C6V X;  2YSQ A;  4A4E A;  1OU9 A;  2DVJ A;  5KYU B;  2O31 A;  1KK7 A;  1X69 A;  4L6V 5;  5GAN j;  5HK3 A;  3G1J A;  2QK0 A;  1EX4 A;  2EQM A;  1VQ9 T;  1Y07 A;  5GMK h;  1UHF A;  2PVO B;  3RBB B;  4CC2 A;  2LMJ A;  1YJN T;  2KRN A;  2M02 A;  3HSB A;  2EYQ A;  4A4G A;  3CXL A;  4ORZ A;  2FZK B;  3PNW C;  2XU8 A;  1WFW A;  5KYX A;  3QUI A;  2GNC A;  3UF4 A;  2J6F A;  5CQX A;  1NYG A;  1ABQ A;  2PVD B;  3EHR A;  3M53 A;  2ODD A;  4OB0 B;  1WGT A;  3HRS A;  3OYA A;  3GPL A;  4PJO D;  2LNV A;  1UHA A;  3L2U A;  2E3H A;  1U5S A;  3CXC P;  2L8D A;  1K0X A;  4RTU A;  5A0G A;  5KCO A;  1UDL A;  3FDR A;  4E7J A;  3C0C A;  3PGG A;  4XTW A;  2RHY A;  3E9G A;  3SB2 A;  3CC2 T;  4EMG A;  1X74 A;  2QI2 A;  1RAE B;  2NLU A;  1M4Z A;  5DLQ E;  1MJA A;  1GRI A;  2CSI A;  1Y0M A;  3KY9 A;  2QQD A;  1YIT Q;  3CC4 Q;  1G3W A;  5E3P A;  4DA4 A;  1PKS A;  4PJO E;  2FYK A;  4OVA A;  1X6B A;  1M90 U;  2W10 A;  2EPD A;  3SWN C;  2ROL A;  1PD1 A;  5LJ5 g;  5D7U A;  3KFV A;  2EGC A;  1LR8 A;  1D0X A;  2B86 A;  4IIO A;  1VQM T;  1MMN A;  5FUX A;  3OYE A;  4C0G A;  2DJZ A;  1M1K U;  1RAH B;  3VUZ A;  4XTZ A;  1OUL A;  1V1H A;  3OYI A;  1M90 C;  4B6D A;  4J6Y A;  2EBP A;  1W2B A;  1K9M R;  2ZPE B;  5DLO A;  1ARK A;  2OTJ A;  1PM3 A;  2KK4 A;  2K5L A;  2X3T A;  1KD1 U;  2EQK A;  1M8M A;  2CKK A;  2RD1 A;  1MGQ A;  4F7U B;  2CP6 A;  1W4R A;  2JMA A;  1M1K C;  4PJL A;  1UGQ B;  5GAN f;  1LVK A;  3OS1 A;  1Z9Q A;  3TU4 K;  2RM4 A;  2EQI A;  2LX9 A;  3OS0 A;  1Z2I A;  5FUV A;  4JRI A;  3H0H A;  3M0R A;  1K4U S;  2QNF A;  5D6W A;  2HEQ A;  3CQT A;  1D1C A;  3CMA A;  3UGI A;  2AK5 A;  1YHQ A;  2KXC A;  1TBR R;  4LD6 A;  2QEX A;  2LUY A;  2J7I A;  4C0F A;  3WVD B;  3SD4 A;  2JYY A;  1D3B A;  4C92 A;  1JXM A;  1H3H A;  4XK8 E;  1RI0 A;  3BDL A;  2F3C I;  3JCM b;  4J9G A;  1BYM A;  1SGP I;  4K11 A;  3G7Z A;  4J6W A;  1UJY A;  2OU2 A;  1PCX A;  3LX7 A;  5L8R E;  2J9R A;  2QAS A;  4HA8 A;  4WP4 A;  4M75 C;  3S3N A;  3ZL7 C;  2ZPI B;  2DET A;  3NTK A;  3LYI A;  2DVE A;  2DJQ A;  1G3T A;  2GQV A;  4C0D C;  4PLL A;  1K0S A;  3QZ9 B;  5GMK i;  1BIB A;  1E6G A;  4RTY A;  1SGD I;  3LGL A;  2EAY A;  4PJO F;  4M75 G;  5KYU A;  1X4S A;  5GJW B;  1U06 A;  5GAN 2;  5CKF A;  1RAA B;  1E7O A;  4ZGJ B;  2K3B A;  2GFU A;  2YHT A;  3OBY A;  5FU6 B;  1UUE A;  1TWB A;  3VYH B;  5LJ3 d;  4E47 A;  1KHC A;  1WXU A;  1SG5 A;  3PE0 A;  3EGU A;  3UOE A;  4E7L A;  1SEM A;  1SHG A;  4CRI A;  4PJM A;  4IKF A;  3B4V C;  2RI3 A;  5GAN e;  1VQP T;  4C0Z A;  4HT8 A;  4PL6 A;  4HT9 A;  4DBH A;  3ULR B;  2RMO A;  2DKG A;  4PKC C;  2RJF A;  2M16 A;  4XTU A;  3TCJ A;  2OTJ Q;  5J3B A;  4Y28 E;  2L3Q A;  4PFO A;  1OZ3 A;  3UT1 A;  5IAY A;  3RMS A;  4C92 C;  4OP0 A;  1BI2 A;  2A3L A;  1NLO C;  1IW4 A;  2QG9 B;  2WCY A;  2KNB B;  3VS7 A;  1HXD A;  3M4Y A;  1BCM A;  1AZE A;  3JCM f;  5IXF A;  3NHN A;  5CK9 A;  3LGF A;  2XHC A;  2CUB A;  2PTK A;  4E7S A;  3INZ A;  3CMA Q;  3EG3 A;  1ZLM A;  2JW4 A;  1CE3 A;  1YHQ Q;  2QEX Q;  2EYW A;  4SGB I;  3VS0 A;  4JZ4 A;  5I2S A;  2OVO A;  5E3R A;  2KVQ G;  2XDD A;  3S3M A;  2DTO A;  3R5D A;  3WXM B;  1MV3 A;  4ZNX A;  2QDY B;  3O5Z A;  4HGU A;  3P8B B;  2ZPG B;  1WA7 A;  1JXO A;  4XTV A;  3QXE B;  4FCY A;  2E3I A;  4CC3 A;  4FT4 A;  4J7I A;  4M7D E;  1PD0 A;  3CCS A;  1SGR I;  4E7H A;  2DD5 A;  2QXF A;  1CKA A;  3S3O A;  4A4K A;  3REB B;  1VQO A;  2D8H A;  2HBW A;  2HSP A;  2MI6 A;  3QWP A;  5CCA A;  4N4G A;  2X35 A;  1TUD A;  1QVG S;  5GJV B;  1LR7 A;  2CWF A;  2UZ3 A;  4DOV A;  4HCK A;  2L2P A;  2DZ9 A;  1GL5 A;  1KMA A;  5GAM f;  1QLY A;  1D1B A;  4P5N A;  2JT4 A;  3QWX X;  1VQN T;  2FRY A;  4F7U A;  4LD9 K;  4J9F A;  2DIG A;  2M0O A;  3QBY A;  3MCA B;  2ERW A;  2DMO A;  3HTR A;  3CCU T;  5CKB A;  3ZEH A;  2DL7 A;  1JJ2 A;  3BW1 A;  2CP3 A;  5I21 A;  4IUQ A;  2JM9 A;  2VXE A;  3NMZ C;  1QVF A;  5FRO A;  3SGQ I;  4JZ3 A;  2ESW A;  1H92 A;  2XRC A;  4JJC A;  3CCQ T;  2YRD A;  1CSO I;  5HKC A;  1FYB A;  1WXT A;  3M56 A;  2VWF A;  3JCM e;  3I9Q A;  1TSF A;  4LDV A;  2K9G A;  4HCZ A;  2HMA A;  4Z8A A;  3M58 A;  1UEC A;  2JW6 A;  3L2V A;  4IUT A;  1KBE A;  4M7A E;  2DAQ A;  2DZC A;  1X01 A;  1LNX A;  2DIL A;  1QVG P;  2J05 A;  1P9G A;  2NU2 I;  1FX7 A;  3RIR A;  3VS6 A;  4HCC A;  2A20 A;  3PMT A;  1KBF A;  2EGA A;  2K4Y A;  2LJ1 A;  2SGD I;  4C92 D;  1YJ9 A;  1N5Z A;  2JUF A;  5A0L A;  1ACM B;  1ZHI A;  1KC8 R;  3QAH A;  4E1P A;  1QWF A;  2E5K A;  1WX6 A;  1SF9 A;  4JJN K;  1AN1 I;  9WGA A;  2LJ3 A;  1UB4 A;  2GVI A;  2MWO A;  3CCL T;  2MPX C;  1UGV A;  1VQL T;  3CCE A;  1FMW A;  1BU1 A;  3VS4 A;  3JCM d;  4M7D F;  2HQH A;  1VQ7 A;  1RFH A;  2LEO A;  4IUR A;  4A63 B;  1OYV I;  2QQ9 A;  3CCS Q;  1YI2 Q;  2COZ A;  3HRU A;  3S6W A;  3QKJ A;  4BI8 B;  3LLR A;  1XX6 A;  1VQO Q;  2X9H A;  1MJ9 A;  2HNI A;  2O9V A;  3V7R A;  2J06 A;  2QQS A;  4MMK A;  3E2I A;  4FM4 B;  4FL6 A;  2LP5 A;  3SHW A;  1DS2 I;  3HFO A;  1KJW A;  2NU3 I;  1C0M A;  4UC4 A;  2CS7 A;  2KRO A;  4JJD A;  1M8C A;  2ED0 A;  2OAU A;  2KYB A;  3MEV A;  2DO3 A;  1IXD A;  5FUY A;  3G71 A;  5FRN A;  3T9N A;  1RLQ C;  2DER A;  3LH0 A;  1CT2 I;  2ZPB B;  4O5V A;  4QVD A;  4LUD A;  2YUO A;  1K9M U;  2IG0 A;  3PDN A;  4WF2 A;  4M75 B;  2JVV A;  2R5M A;  2O01 E;  1W1F A;  3EGX B;  2QQ0 A;  2COY A;  1WPY A;  3PIO A;  3JB9 J;  5GAN 3;  3JCM J;  3KBG A;  3L1A A;  4C0D B;  2JXD A;  2L5Q A;  4DEY A;  4OB3 B;  1UGP B;  5LJ5 h;  3OYD A;  5E3Q A;  4GLM A;  1W4S A;  2CP7 A;  1G8X A;  3TO7 A;  2IVW A;  2DIQ A;  3M4G A;  3MKD A;  2RIJ A;  1Y7X A;  3VS2 A;  2YDL A;  4MZP A;  4FYY B;  2L8E A;  3TO6 A;  3VUB A;  1YWP A;  2D9T A;  2BKD N;  1NM7 A;  3VS3 A;  3OS2 A;  2BTT A;  4BDY A;  2AHJ B;  2DYI A;  5GMK m;  4JRP A;  1QCN A;  1H8K A;  4M78 E;  2RA2 A;  1TG0 A;  2P0K A;  4JRQ A;  2R57 A;  1K73 R;  1FY7 A;  5I2M A;  1H64 1;  1K9A A;  1B34 B;  3C94 A;  3VJP A;  3CD6 Q;  3I56 A;  2SRC A;  1YJ9 Q;  3I55 T;  3MET A;  2PQ8 A;  1W6X A;  2X4J A;  1Q86 R;  2K2V A;  1DS3 I;  3M0S A;  2EJ9 A;  4IIM A;  2KXD A;  2EVR A;  1UHC A;  4C8Q E;  3CC4 A;  3CCE Q;  1VQ7 Q;  2FHD A;  2RHX A;  1S72 T;  1OQK A;  1BK2 A;  5GMK j;  4OMF B;  1UUC A;  3MP8 A;  1XA6 A;  2A08 A;  3CXC A;  3QDF A;  1UGR B;  2KQW A;  3QZ5 B;  2CUD A;  1KQS S;  2KDP A;  4D8K A;  4KUL A;  1AWW A;  3BFM A;  2V26 A;  3MPU B;  4ME7 A;  3R5A A;  5FUW A;  5J26 A;  1M3C A;  2EKO A;  1VQ6 A;  2QAZ A;  1H3Z A;  1H0Z A;  4LUE A;  1TBO A;  3CPW S;  2XIC A;  3LWI A;  2JS0 A;  4AFS C;  3G71 Q;  4JS5 A;  1UEB A;  3GNG A;  2M0Y A;  3RR6 A;  2GFA A;  2IIM A;  2J6O A;  5FWB A;  3OMC A;  1V76 A;  2NYS A;  2M1H A;  2EJF A;  3G6E T;  2A37 A;  4HKE A;  3G4S T;  2DLP A;  4FYV B;  1FXX A;  1VQ9 A;  1ULN A;  2ZPF B;  4QKU A;  1T0J A;  2MYS A;  1VQ4 T;  2DL3 A;  1PTR A;  4X9C A;  4E2F B;  1WHK A;  5LJ3 h;  5HQ8 A;  1YJN A;  3OYF A;  1N13 A;  4M77 C;  2ROT A;  2EW3 A;  2F5T X;  2P4T A;  2E64 A;  3P8H A;  4QQ6 A;  1GBR A;  3HP9 A;  2E70 A;  2FL7 A;  1NJI R;  1FAR A;  2AT1 B;  2WAC A;  2L3R A;  1K76 A;  2BIV A;  2H3J A;  1XJW B;  2OTL Q;  3LWH A;  1TH7 A;  2JOY A;  3NGP A;  1CSK A;  1XQH A;  2MMP A;  2ZZD A;  4M77 G;  4M78 F;  5GAO l;  1W70 A;  1KQS P;  1V1I A;  1VQK T;  2F2W A;  1UTI A;  5D6Y A;  3QYH B;  3DB4 A;  4HVV A;  2KCX A;  5AYF A;  4NL2 A;  5DY9 A;  3CPW P;  3QDR B;  3CC2 A;  2RHU A;  1ZX6 A;  1U1S A;  5GAN 8;  1PRL C;  3FJ5 A;  3I56 Q;  2KGT A;  1OI1 A;  3GLX A;  2RPN A;  2WSE E;  1BBZ A;  1ZQ1 A;  1JBM A;  4N0A A;  3OW2 S;  1PWT A;  1TUG B;  4B9X A;  3J80 E;  4C8Q F;  4KUD K;  3E9F A;  2CJS C;  2K9H A;  2A7Y A;  2B0U C;  5HCK A;  1VYU A;  3A8G B;  2V53 A;  5FRM A;  5KE3 A;  1NPP A;  3MEW A;  1TIH A;  1KSW A;  2M5X A;  3VS5 A;  4KRT A;  2N17 A;  1SGN I;  4M75 A;  1ZA1 B;  2V1R A;  4B6M A;  2CWG A;  2PQW A;  1PG5 B;  1GCQ C;  1QKW A;  3EGX A;  1VQM A;  2QQE A;  1MT1 A;  2B8T A;  3H8Z A;  1PZW A;  1WQ7 A;  2YQP A;  4ZN3 A;  3UWN A;  2VC8 A;  2CH4 W;  4IUV A;  4OGC A;  2DXC A;  3JCM P;  1VQ6 Q;  3H0F A;  1UE9 A;  1N27 A;  4E7Z A;  4PNO A;  1CGI I;  4DNC A;  2LCL A;  1M8V A;  4UXI A;  4X1V A;  3OYL A;  1WJS A;  2DX1 A;  4LN2 A;  3UPU A;  2EJG A;  1AWJ A;  4J8O A;  5AT1 B;  2D1X A;  1BMO A;  3EGD B;  3GOX A;  1GFD A;  3UFF A;  1K7T A;  4LDW A;  5CVI A;  2H3E B;  1VQ9 Q;  1UVF A;  4ELZ C;  1UJ0 A;  4FYX B;  3JB9 G;  1B34 A;  4KUI A;  3OW2 P;  3J81 E;  1YJN Q;  1WQW A;  4M4Z A;  1M2V B;  1GFC A;  3DB3 A;  2FZG B;  2QTX A;  2WSC E;  2V1Q A;  1HDL A;  5IT9 E;  2HL5 C;  3JB9 H;  3JCM Q;  5IN1 A;  1TUC A;  4IUU A;  3RUX A;  4M7D G;  1U1T A;  2DPP B;  4F17 A;  4N0A C;  1HEV A;  4OVO A;  2DXU A;  1KC8 U;  3CC7 T;  3A1P A;  1WGC A;  2A36 A;  5JHW C;  3HKS A;  2E6N A;  3JV3 A;  3CCM T;  2MIO A;  4OB2 B;  1OEB A;  3A8H B;  7WGA A;  3H0I A;  4ZN1 A;  1PCE A;  2DE0 X;  4DEX A;  2QA4 T;  1CGJ I;  2RJE A;  3NFC A;  1KC8 C;  1F1B B;  3CC2 Q;  2FPF A;  5GMK e;  1N6A A;  2RHI A;  4OB1 B;  4QW2 A;  2E4H A;  2LC4 A;  4C5G A;  1M9S A;  2KEA A;  3OSV A;  5GAM j;  2LQK A;  1XNI A;  4C5E A;  2M9U A;  3D7S B;  4PJO B;  3QII A;  2SEM A;  1HD3 A;  2ED1 A;  2QGG A;  2O4X B;  4ANJ A;  2V8K A;  4DQ2 A;  3BE3 A;  5LJ3 g;  5CCM A;  1TXQ A;  2CZ1 B;  2RNA A;  1VQM Q;  4M7A C;  1I07 A;  2KBT A;  5I22 A;  2KI7 A;  3RES A;  3CBP A;  2FB7 A;  2GCX A;  4LE9 A;  1ZBJ A;  1VQP A;  1RAG B;  1SGY I;  2MF2 A;  2UVO A;  2RQW A;  3OYK A;  2EKH A;  1S20 A;  3DKM A;  2LTO A;  1ZA2 B;  2ZAE A;  1YIJ T;  3OYH A;  1NE8 A;  3C95 A;  4M7A G;  5DAE A;  4NS5 A;  3UEJ A;  1HK9 A;  3GIB A;  3EH2 A;  1XTD A;  2DBK A;  4J9I A;  3OXF A;  3LH5 A;  5CKD A;  1I8F A;  4A53 A;  2ECZ A;  4FW2 A;  1IRX A;  4EMH A;  3A98 A;  1PHT A;  1TS9 A;  4N4H A;  1SPK A;  2O9S A;  1AOJ A;  3RKX A;  3JSC A;  1M2O A;  4O6J A;  1KFZ A;  3M55 A;  2XMF A;  1M3B A;  1T0H A;  2VKN A;  1E7L A;  2CZ7 B;  3V7C A;  5GAN d;  2RQT A;  2V1C C;  1ZSZ C;  1K73 U;  2F2X A;  4PJJ A;  4JCV E;  2KRS A;  1YJW T;  1ZUK A;  2MK5 A;  4BDZ A;  1VQ5 T;  1BKB A;  5EC7 A;  4KBM B;  2LCS A;  2N1U A;  2LRQ A;  1Q86 U;  2AZV A;  1YI2 A;  2QGF B;  2DK3 A;  3VKI A;  2Z0W A;  1K73 C;  1UGS B;  1QVG A;  3TO9 A;  4FT2 A;  4M77 B;  4FSS A;  3RER A;  4HVW A;  3RNJ A;  2RI2 A;  3OYN A;  1Q86 C;  2CDT A;  4ATO A;  3PFS A;  2P0Q A;  3CCR T;  1HYO A;  2KY9 A;  3URG A;  2OAW A;  2RB6 A;  3CCV A;  1VQN A;  1LJO A;  1M1F A;  2ROW A;  1NBE B;  3QWY A;  1N9R A;  4RTV A;  4M75 D;  1M27 C;  2JNG A;  2C0I A;  5C6S A;  1WKX A;  3CCU A;  4BI4 A;  2DKV A;  2CRE A;  3EGD A;  3E1S A;  2COW A;  3QJY A;  2K79 A;  2YRC A;  1TU0 B;  1BB9 A;  1JB0 E;  2OI3 A;  4M78 C;  4RCC A;  3EG2 A;  1I81 A;  4AFZ C;  1JEG A;  1I4K 1;  1NYF A;  4JUV A;  1VQP Q;  3A5Z B;  3F70 A;  2MWP A;  1M2V A;  1VQ8 T;  1FWZ A;  1NG2 A;  3DLM A;  1W3S A;  3MP1 A;  3CCQ A;  3V8J A;  1OX9 A;  2DXB A;  1O75 A;  1XOV A;  3OL0 A;  2LQN A;  3JAM E;  2RJD A;  4DOW A;  1TGS I;  4D8D A;  1WJQ A;  2K6D A;  1RLP C;  1VYT A;  3JB9 I;  3JCM c;  2RK2 A;  2ZGW A;  4XU2 A;  2B8A A;  2D6F A;  1LR9 A;  3TSZ A;  4M78 G;  3QSU A;  4Z02 A;  2JTF A;  3KUF A;  3MO8 A;  2JMC A;  4AMC A;  1X75 C;  2RQU A;  1NPR A;  4E7I A;  3OYC A;  4J6X A;  1NJI U;  3JRZ A;  1IGQ A;  3OYB A;  3EAE A;  4ZTF A;  3CD6 A;  3OY9 A;  2QQB A;  4ZGD B;  1TBQ R;  4JRK A;  3GF5 A;  1KQ1 A;  2EYX A;  4C8Q G;  1Y71 A;  2E1H A;  1ZSG A;  2F5K A;  1NJI C;  2BUS A;  2GBQ A;  2C0T A;  1VQL A;  1PPF I;  3H6Z A;  2MCN A;  2X52 A;  2FG0 A;  3EFS A;  1Y1B A;  3QG1 A;  2ZCF B;  5EG2 A;  4NL3 A;  4M7D B;  5CCL A;  4PJO A;  2D8J A;  2NWM A;  1R0C B;  1Z9Z A;  5HK0 A;  2O4X A;  1S1N A;  2VGN A;  5GAM e;  1M3A A;  2QQA A;  2DEU A;  3X24 B;  1ULM A;  3NPF A;  5LJ5 j;  4BE0 A;  2LT1 A;  1VA7 A;  4C92 E;  1D1A A;  1LPL A; 
#chains in the Genus database with same CATH homology
 1IY6 A;  1BUS A;  3MP6 A;  5M9O A;  3A8M B;  4FU6 A;  5A0D A;  3CME T;  4D6W A;  3MEK A;  1V29 B;  3SDZ A;  1VIF A;  2ARP F;  1BI0 A;  4LDY A;  2XKO C;  1M5Q 1;  3HPW A;  3UGD A;  4FSX A;  2V8I A;  2DB6 A;  2EWN A;  5GAM d;  3RU0 A;  3OYJ A;  4RG2 A;  2ORW A;  5EX3 A;  5FU7 C;  3CCJ T;  1OYX A;  1UVG A;  2N71 A;  4QQG A;  4LDX A;  3ME9 A;  3FIF A;  4IUP A;  1EN7 A;  2HD0 A;  3HHT B;  1G5V A;  5KH6 A;  4EDU A;  1N8R C;  2OTL A;  2JZ2 A;  2ORV A;  4M7A B;  4BE1 A;  4OGE A;  3MHX A;  2SGQ I;  4L59 A;  4PJO C;  3ZBD A;  4M77 A;  5GAO n;  2I2L A;  3I55 A;  1I5L A;  1FAQ A;  2L89 A;  4PJO G;  3BJI A;  2K57 A;  1Q82 U;  4MDW A;  1S72 A;  3MEA A;  4NOY A;  3SGB I;  5GAO q;  1KQS A;  3TEE A;  1QP3 A;  3M54 A;  4MZT A;  5LJ5 f;  4C92 F;  5LJ3 j;  3FLG A;  2HAX A;  3CPW A;  2FVU A;  1Q82 C;  3OSS C;  4L5G A;  1OMU A;  2MAM A;  2W0T A;  4E1R A;  1YIT T;  3CC4 T;  4MZM A;  2LDM A;  4ELY C;  5FLX E;  3QJ6 A;  3G6E A;  1IRE B;  3G4S A;  2VXF A;  1M1G A;  3ER0 A;  4EMK B;  1VQ4 A;  3OQ5 A;  3RKW A;  3OVO A;  1P92 A;  5GAN 6;  3V8L A;  2R5A A;  2LCC A;  2K5F A;  4F7U E;  2RJC A;  3L42 A;  4Y91 A;  5C0M A;  3AHU A;  4ZTJ A;  4M7D A;  1ZBX A;  4M78 B;  1VQK A;  4RG8 A;  3PT9 A;  2L7X A;  2SGP I;  3HL8 A;  2LVM A;  3QO3 A;  3NTI A;  4A54 A;  4R55 A;  2KMT A;  3VU3 C;  3OW2 A;  4BY6 C;  4QVZ A;  1DJ7 B;  3M5A A;  4CI0 C;  3SFM A;  3V7S A;  5LJ5 e;  4C8Q B;  4GI3 C;  5GAN h;  1PSF A;  2Y4X A;  2WSF E;  5CKH A;  2X4W A;  3FEO A;  2VV5 A;  2CYZ B;  2KMP A;  5LJ3 f;  2EQJ A;  2E73 A;  2QNC A;  2LT4 A;  4BB7 A;  2RH2 A;  3JCM V;  5HI7 A;  4TVR A;  4UXH A;  3ZFJ A;  3GP8 A;  2BUD A;  1KG1 A;  2DD4 A;  5LJ5 d;  2ENN A;  2JZM A;  3Q1J A;  1CT4 I;  3CEY A;  2VYT A;  4M7A A;  1U5K A;  2KMR A;  4M7D C;  4BE2 A;  4LDU A;  2LQ8 A;  3ASK A;  2OTJ T;  4F7U F;  1RL2 A;  4QQD A;  5CAI A;  1W2B S;  4GLK A;  5GAN 5;  1VIE A;  1NZ9 A;  2KMQ A;  3VYG A;  4X34 A;  3EFR A;  1KD1 C;  2QPO A;  4VUB A;  3QHS A;  3CC7 A;  1TBN A;  3KXT A;  2XD0 A;  2XK0 A;  3PIP A;  3CMA T;  4M77 D;  1QP2 A;  2XG8 D;  1YHQ T;  3CCM A;  4FKD A;  2QEX T;  2GKT I;  1WGS A;  4II1 A;  5FU7 B;  5HY6 A;  5GAO r;  2QA4 A;  3WVE B;  4PLI A;  2E6Z A;  1PJU A;  1Z7K B;  2JA1 A;  3OYG A;  4XTX A;  2E12 A;  3UGL A;  4V2S A;  2V1C A;  4RCB A;  4XAX B;  5CO7 A;  4EPC A;  1LOJ A;  5LJ3 e;  1M8B A;  3OYY A;  1IZ6 A;  2CZ6 B;  4YTL A;  4M77 E;  4C5I A;  1Y96 B;  3TRE A;  3BDU A;  2GKV A;  3JCM h;  3HRT A;  5LL6 S;  2JTM A;  3OXG A;  4EMK A;  3NTH A;  1SGE I;  3OYM A;  1KQ2 A;  2PUO B;  3X20 B;  4BI3 A;  2XDB A;  2SGF I;  1YIJ A;  4XU1 A;  2E10 A;  5KE2 A;  1AHJ B;  5KCH A;  3M57 A;  2DIP A;  2PUK B;  4M78 A;  2WVJ A;  1Q81 U;  3JCM W;  1YCY A;  2OD1 A;  2J87 A;  2KAF A;  4JDS A;  3JB9 D;  5CQY A;  3OXL A;  3DLL A;  5GAM h;  2RI5 A;  2XI9 A;  2YRV A;  5GAN g;  1OMT A;  1Q81 C;  3UEY A;  4M7D D;  4XU3 A;  1YJW A;  2KMO A;  4C8Q A;  1Q7Y U;  1QVP A;  5GMK l;  1TUS A;  2VRW B;  4N4I A;  1IY5 A;  1VQ5 A;  1BI1 A;  1BIA A;  3RKY A;  3JCM X;  2HBP A;  3C12 A;  4B9W A;  1R8O B;  1SGQ I;  3X28 B;  4JLI A;  5GAO m;  3N5B B;  1OZ2 A;  2XDP A;  4C92 G;  4BD3 A;  4XU0 A;  4J5Y A;  1PSE A;  3L2W A;  1Q7Y C;  1SSF A;  1MHN A;  3V8K A;  3VDP A;  4C5H A;  3TJQ A;  2FNF X;  3VE5 A;  2RHZ A;  3HFN A;  3BY7 A;  4EMK C;  2SGE I;  2E5R A;  3PMI A;  1HJA I;  3VV0 A;  3CCR A;  4MML A;  1EIF A;  3QPH A;  3CCS T;  1PTQ A;  1YI2 T;  4BUG A;  3MEU A;  4M77 F;  1VQO T;  4A4H A;  4L9M A;  2QQC A;  4BY6 B;  3FRN A;  1VUB A;  2NU1 I;  3CCV T;  3OB9 A;  5J39 A;  1VQ8 A;  2E41 A;  3OBW A;  2EQU A;  1JRI A;  2G3R A;  2Y90 A;  3CBM A;  2ZPH B;  3OA6 A;  2GKR I;  1Y1C A;  1YTP A;  4M75 E;  1N9S A;  3FB9 A;  4M7A D;  3X25 B;  4RKU E;  2X4Y A;  1TOT A;  1R0R I;  2KDS A;  3A8O B;  2HQX A;  4C8Q C;  1JJ2 S;  4GY5 A;  4XQ3 A;  1OVO A;  1NUB A;  2JN0 A;  5DM7 R;  1QVF S;  1GXI E;  3M59 A;  1KHI A;  3SWN B;  2DXT A;  3LW5 E;  5GAN 4;  2R58 A;  2P0P A;  1G3S A;  2K3X A;  3CCL A;  4A24 A;  2C06 A;  2CZ0 B;  3JCM g;  4BAC A;  4R56 A;  3HH2 C;  1Y96 A;  4RMO A;  3CD6 T;  2VGM A;  2HQE A;  1CHO I;  1Y8F A;  1BI3 A;  5EX0 A;  1YJ9 T;  3JB9 F;  1VDD A;  3J7A F;  4X9D A;  2ELI A;  3QTL D;  3PTA A;  3CCE T;  3OS5 A;  1VQ7 T;  3CME A;  3L2R A;  1R79 A;  5CIU A;  2RK1 A;  2Y4Y A;  1YBY A;  2EFI A;  4QVC A;  3SEK C;  2CGH A;  5GAN 7;  4A4F A;  2YLC A;  3CBO A;  4KT0 E;  3O8V A;  4F7U G;  5GAM g;  4FIB A;  2N1A B;  2PVG B;  3CCJ A;  3G71 T;  1G3Y A;  1N8R U;  3FJP A;  2YLB A;  2DTH A;  2EIF A;  1E7D A;  4M75 F;  4M78 D;  2K3Y A;  4JLG A;  2QQR A;  4UXJ A;  2XID A;  1QW1 A;  1K9M C;  4Q5W A;  1U8R A;  1TUR A;  3OMG A;  3R6O A;  4J83 A;  2PU9 B;  4E7K A;  3D00 A;  3A8L B;  4C8Q D;  5D6X A;  3L2Q A;  3RMQ A;  4MDX A;  2OTL T;  4M7A F;  2N52 A;  2KSS A;  2E65 A;  2P6A C;  3L2Z A;  1O9S A;  5FU6 C;  4J7F A;  2RO0 A;  3I56 T;  3E19 A;  2X4X A;  2YUU A;  2DEQ A;  1D3B B;  4C92 B;  3C4S A;  1WNL A;  5CKE A;  1YIT A;  3VDU A;  4ZGE B;  2V8J A;  5GAO p;  4XTY A;  1CT0 I;  2DTI A;  1XBT A;  1WJR A;  3P8D A;  3E59 A;  2F69 A;  1K8A U;  2VUB A;  5CR2 A;  2E5Q A;  2K5I A;  4JS4 A;  5A2Q E;  3X26 B;  1X6O A;  3UDC A;  2NU0 I;  3GNF B;  3CPF A;  1HPT A;  4OF1 A;  3FC3 A;  3CXC S;  2NU4 I;  2GF7 A;  3QYG B;  1K8A C;  1VQ6 T;  3M9Q A;  2ENZ A;  4HCB A;  2D0Q B;  3SWN A;  1YU6 C;  4A4E A;  4L6V 5;  5GAN j;  5HK3 A;  2EQM A;  1VQ9 T;  1Y07 A;  5GMK h;  2PVO B;  1YJN T;  3HSB A;  2EYQ A;  4A4G A;  3CXL A;  3PNW C;  2XU8 A;  3QUI A;  5CQX A;  2PVD B;  3M53 A;  2ODD A;  4OB0 B;  3HRS A;  3OYA A;  3GPL A;  4PJO D;  2LNV A;  3L2U A;  2L8D A;  5A0G A;  5KCO A;  3FDR A;  4E7J A;  3PGG A;  4XTW A;  2RHY A;  3E9G A;  3SB2 A;  3CC2 T;  4EMG A;  1X74 A;  2QI2 A;  2NLU A;  1M4Z A;  5DLQ E;  3KY9 A;  2QQD A;  1G3W A;  4DA4 A;  4PJO E;  2FYK A;  4OVA A;  1M90 U;  3SWN C;  5LJ5 g;  1LR8 A;  1VQM T;  5FUX A;  3OYE A;  4C0G A;  2DJZ A;  1M1K U;  3VUZ A;  4XTZ A;  1V1H A;  3OYI A;  1M90 C;  4B6D A;  4J6Y A;  1W2B A;  2ZPE B;  5DLO A;  2OTJ A;  2KK4 A;  2K5L A;  1KD1 U;  2EQK A;  2CKK A;  2RD1 A;  1MGQ A;  4F7U B;  1W4R A;  1M1K C;  1UGQ B;  5GAN f;  3OS1 A;  3TU4 K;  2RM4 A;  2LX9 A;  3OS0 A;  5FUV A;  4JRI A;  2QNF A;  5D6W A;  3CMA A;  3UGI A;  1YHQ A;  1TBR R;  4LD6 A;  2QEX A;  2LUY A;  4C0F A;  3WVD B;  3SD4 A;  2JYY A;  1D3B A;  4C92 A;  4XK8 E;  1RI0 A;  3BDL A;  2F3C I;  3JCM b;  1BYM A;  1SGP I;  3G7Z A;  4J6W A;  3LX7 A;  5L8R E;  2J9R A;  4HA8 A;  4M75 C;  3S3N A;  2ZPI B;  3NTK A;  3LYI A;  2DVE A;  1G3T A;  2GQV A;  4C0D C;  4PLL A;  3QZ9 B;  5GMK i;  1BIB A;  1SGD I;  3LGL A;  2EAY A;  4PJO F;  4M75 G;  1X4S A;  5GAN 2;  5CKF A;  4ZGJ B;  2GFU A;  2YHT A;  3OBY A;  5FU6 B;  3VYH B;  5LJ3 d;  4E47 A;  1KHC A;  4E7L A;  4CRI A;  4IKF A;  3B4V C;  2RI3 A;  5GAN e;  1VQP T;  4C0Z A;  4HT8 A;  4PL6 A;  4HT9 A;  2DKG A;  4PKC C;  2RJF A;  2M16 A;  4XTU A;  3TCJ A;  5J3B A;  4Y28 E;  3UT1 A;  1OZ3 A;  5IAY A;  3RMS A;  4C92 C;  4OP0 A;  1BI2 A;  2A3L A;  1IW4 A;  2WCY A;  1HXD A;  3M4Y A;  3JCM f;  5CK9 A;  3LGF A;  2XHC A;  3INZ A;  1CE3 A;  4SGB I;  5I2S A;  2OVO A;  2KVQ G;  2XDD A;  3S3M A;  2DTO A;  3WXM B;  2QDY B;  4HGU A;  3P8B B;  2ZPG B;  4XTV A;  3QXE B;  4FT4 A;  4J7I A;  4M7D E;  3CCS A;  1SGR I;  4E7H A;  2DD5 A;  2QXF A;  3S3O A;  4A4K A;  1VQO A;  2MI6 A;  3QWP A;  5CCA A;  4N4G A;  2X35 A;  1QVG S;  1LR7 A;  2UZ3 A;  4DOV A;  2DZ9 A;  1KMA A;  5GAM f;  4P5N A;  1VQN T;  4F7U A;  4LD9 K;  2DIG A;  2M0O A;  3QBY A;  3MCA B;  2ERW A;  3CCU T;  5CKB A;  3ZEH A;  1JJ2 A;  3BW1 A;  5I21 A;  4IUQ A;  2VXE A;  1QVF A;  5FRO A;  3SGQ I;  2XRC A;  3CCQ T;  1CSO I;  5HKC A;  1FYB A;  3M56 A;  3JCM e;  4LDV A;  4HCZ A;  3M58 A;  2JW6 A;  3L2V A;  4IUT A;  1KBE A;  4M7A E;  2DAQ A;  2DZC A;  1X01 A;  1LNX A;  2NU2 I;  1FX7 A;  3RIR A;  4HCC A;  2A20 A;  3PMT A;  1KBF A;  2K4Y A;  2SGD I;  4C92 D;  1YJ9 A;  2JUF A;  5A0L A;  1ZHI A;  4E1P A;  4JJN K;  1AN1 I;  1UB4 A;  2GVI A;  2MWO A;  3CCL T;  1VQL T;  3CCE A;  3JCM d;  4M7D F;  1VQ7 A;  1RFH A;  2LEO A;  4IUR A;  1OYV I;  2QQ9 A;  3HRU A;  3S6W A;  3QKJ A;  4BI8 B;  3LLR A;  1XX6 A;  2HNI A;  3V7R A;  2QQS A;  4MMK A;  3E2I A;  4FM4 B;  4FL6 A;  1DS2 I;  3HFO A;  2NU3 I;  4UC4 A;  2CS7 A;  1M8C A;  2OAU A;  3MEV A;  2DO3 A;  5FUY A;  3G71 A;  5FRN A;  3T9N A;  3LH0 A;  1CT2 I;  2ZPB B;  4O5V A;  4QVD A;  1K9M U;  2IG0 A;  3PDN A;  4WF2 A;  4M75 B;  2JVV A;  2R5M A;  2O01 E;  2QQ0 A;  1WPY A;  3PIO A;  3JB9 J;  5GAN 3;  3JCM J;  3KBG A;  3L1A A;  4C0D B;  2JXD A;  2L5Q A;  5LJ5 h;  4OB3 B;  1UGP B;  3OYD A;  1W4S A;  2IVW A;  2DIQ A;  3M4G A;  1Y7X A;  4MZP A;  2L8E A;  3VUB A;  2D9T A;  2BKD N;  3OS2 A;  4BDY A;  2AHJ B;  5GMK m;  4JRP A;  4M78 E;  2RA2 A;  2P0K A;  4JRQ A;  2R57 A;  5I2M A;  1H64 1;  1B34 B;  3C94 A;  3VJP A;  3I56 A;  3I55 T;  3MET A;  2X4J A;  2K2V A;  1DS3 I;  2EJ9 A;  4C8Q E;  3CC4 A;  2FHD A;  2RHX A;  1S72 T;  5GMK j;  4OMF B;  1UUC A;  3MP8 A;  1XA6 A;  3CXC A;  1UGR B;  2KQW A;  3QZ5 B;  1KQS S;  4KUL A;  3BFM A;  4ME7 A;  5FUW A;  5J26 A;  2EKO A;  1VQ6 A;  1H3Z A;  1H0Z A;  1TBO A;  3CPW S;  2XIC A;  3LWI A;  4JS5 A;  1UEB A;  3GNG A;  2GFA A;  3OMC A;  2M1H A;  2EJF A;  3G6E T;  3G4S T;  4HKE A;  1FXX A;  1VQ9 A;  2ZPF B;  1VQ4 T;  1PTR A;  4X9C A;  5LJ3 h;  5HQ8 A;  1YJN A;  3OYF A;  1N13 A;  4M77 C;  2F5T X;  2P4T A;  2E64 A;  3P8H A;  4QQ6 A;  3HP9 A;  2E70 A;  2FL7 A;  1FAR A;  2WAC A;  2L3R A;  2BIV A;  2H3J A;  3LWH A;  1TH7 A;  2JOY A;  1XQH A;  2MMP A;  2ZZD A;  4M77 G;  4M78 F;  5GAO l;  1V1I A;  1VQK T;  5D6Y A;  3QYH B;  3DB4 A;  2KCX A;  5AYF A;  4NL2 A;  5DY9 A;  3QDR B;  3CC2 A;  2RHU A;  1U1S A;  5GAN 8;  1OI1 A;  3GLX A;  2WSE E;  1ZQ1 A;  1JBM A;  4N0A A;  3OW2 S;  4B9X A;  3J80 E;  4C8Q F;  4KUD K;  3E9F A;  2CJS C;  2K9H A;  2A7Y A;  2B0U C;  3A8G B;  2V53 A;  5FRM A;  5KE3 A;  1NPP A;  3MEW A;  1TIH A;  2M5X A;  2N17 A;  1SGN I;  4M75 A;  2PQW A;  1VQM A;  2QQE A;  1MT1 A;  2B8T A;  3H8Z A;  1WQ7 A;  2YQP A;  4ZN3 A;  3UWN A;  2VC8 A;  4OGC A;  4IUV A;  2DXC A;  3JCM P;  1N27 A;  4PNO A;  1CGI I;  2LCL A;  1M8V A;  4UXI A;  3OYL A;  1WJS A;  3UPU A;  2EJG A;  4J8O A;  1BMO A;  3GOX A;  3UFF A;  4LDW A;  5CVI A;  1UVF A;  4ELZ C;  3JB9 G;  1B34 A;  4KUI A;  3J81 E;  1WQW A;  3DB3 A;  2QTX A;  2WSC E;  1HDL A;  5IT9 E;  3JB9 H;  3JCM Q;  5IN1 A;  4IUU A;  3RUX A;  4M7D G;  1U1T A;  2DPP B;  4N0A C;  4OVO A;  2DXU A;  1KC8 U;  3CC7 T;  5JHW C;  3HKS A;  2E6N A;  3CCM T;  4OB2 B;  3A8H B;  4ZN1 A;  1PCE A;  2QA4 T;  1CGJ I;  2RJE A;  3NFC A;  1KC8 C;  5GMK e;  1N6A A;  2RHI A;  4OB1 B;  4QW2 A;  2LC4 A;  4C5G A;  1M9S A;  3OSV A;  5GAM j;  2LQK A;  1XNI A;  4C5E A;  2M9U A;  4PJO B;  3QII A;  2O4X B;  2V8K A;  4DQ2 A;  5LJ3 g;  5CCM A;  2CZ1 B;  4M7A C;  3RES A;  3CBP A;  2FB7 A;  2GCX A;  1VQP A;  1SGY I;  2MF2 A;  3OYK A;  3DKM A;  2LTO A;  1YIJ T;  3OYH A;  1NE8 A;  3C95 A;  4M7A G;  5DAE A;  4NS5 A;  3UEJ A;  1HK9 A;  3GIB A;  1XTD A;  3OXF A;  5CKD A;  1I8F A;  4A53 A;  4EMH A;  4N4H A;  3RKX A;  3JSC A;  4O6J A;  3M55 A;  1E7L A;  2CZ7 B;  3V7C A;  5GAN d;  2V1C C;  1K73 U;  4JCV E;  1YJW T;  4BDZ A;  1VQ5 T;  1BKB A;  4KBM B;  2LRQ A;  1Q86 U;  1YI2 A;  2DK3 A;  3VKI A;  1K73 C;  1UGS B;  1QVG A;  4FT2 A;  4M77 B;  3RER A;  2RI2 A;  3OYN A;  1Q86 C;  4ATO A;  3PFS A;  2P0Q A;  3CCR T;  2KY9 A;  3URG A;  3CCV A;  2RB6 A;  1VQN A;  1LJO A;  1M1F A;  2ROW A;  1N9R A;  4M75 D;  2JNG A;  5C6S A;  3CCU A;  4BI4 A;  3E1S A;  3QJY A;  1JB0 E;  4M78 C;  4RCC A;  1I81 A;  1I4K 1;  4JUV A;  3A5Z B;  3F70 A;  2MWP A;  1VQ8 T;  1W3S A;  1FWZ A;  3DLM A;  3MP1 A;  3CCQ A;  3V8J A;  2DXB A;  1O75 A;  1XOV A;  3OL0 A;  3JAM E;  2RJD A;  4DOW A;  1TGS I;  1WJQ A;  3JB9 I;  3JCM c;  2RK2 A;  2ZGW A;  4XU2 A;  2B8A A;  2D6F A;  1LR9 A;  4M78 G;  3QSU A;  4Z02 A;  2JTF A;  3KUF A;  3MO8 A;  1X75 C;  1NPR A;  4E7I A;  3OYC A;  4J6X A;  1NJI U;  3JRZ A;  3OYB A;  3EAE A;  4ZTF A;  3CD6 A;  3OY9 A;  2QQB A;  4ZGD B;  1TBQ R;  4JRK A;  3GF5 A;  1KQ1 A;  4C8Q G;  1Y71 A;  2E1H A;  2F5K A;  1NJI C;  2BUS A;  1VQL A;  1PPF I;  3H6Z A;  3EFS A;  1Y1B A;  3QG1 A;  4M7D B;  2ZCF B;  5EG2 A;  4NL3 A;  5CCL A;  4PJO A;  5HK0 A;  2O4X A;  2VGN A;  5GAM e;  2QQA A;  3X24 B;  5LJ5 j;  4BE0 A;  2LT1 A;  4C92 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...