3GMBA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
369
structure length
369
Chain Sequence
b'TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Structure of the PLP degradative enzyme 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti MAFF303099 and its mechanistic implications.
pubmed doi rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 106
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3gmbA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3gmbA01
3NK2X 1BGNA 3CNSA 3V3NA 1IJHA 1ZOYA 2EQ9A 1OJCA 2H89A 4WX1A 1OJAA 1ZDLA 4KPRA 4ICYA 4WCTA 3CGCA 2X8GA 5KXJA 1FL2A 2GEWA 4EIPA 1Y0PA 2XLRA 2OLNA 2BABA 4U2TA 4GDEA 2YAUA 2BXRA 4H4SA 3EF6A 3QFAA 2YLWA 1REOA 4ECHA 2YR5A 1DJNA 3VR8A 4YSXA 1UKVG 2XFPA 2YG3A 3UKFA 3AE4A 4IV9A 5JCMA 5IPYA 1P2EA 2XFQA 2XYOA 2ZZBA 4U2SA 2B9XA 4E0VA 1P2HA 4TM1A 3KVEA 1VRQB 4K5RA 5KVIA 2IVDA 4D04A 2GMJA 4U8LA 5CQFA 1D5TA 2WU5A 3AE2A 1D4CA 4GUVA 3SGLA 1QLBA 2XLUA 3LZXA 5FS9A 4A9WA 1D4DA 4Z24A 2YG5A 2E5VA 4UP3A 3I3LA 2JK6A 4FX9A 3ICTA 4U8MA 4B1BA 1H83A 2BK3A 3JSKA 4RSLA 1DJQA 4CCQA 4YTMA 3UKQA 4USRA 2BXSA 2GAGB 2GB0A 2JB3A 4EQXA 1JRXA 3QFBA 1M6IA 2HQMA 2GR1A 5LV9A 3B6DA 4A65A 1ZK7A 3C4AA 3RHAA 3GWDA 5U63A 3GMCA 1GPEA 3GSIA 2XDOA 3BNUA 5BRTA 4IA6A 4GR1A 2C67A 3AD8B 2VVMA 3NGCX 3KPFA 4K8DA 1DNCA 3UKLA 2F5ZA 5M10A 1D7LA 1E1KA 5KOXA 2Z5XA 2VQ7A 3UKPA 1PBDA 3EAOA 3AE7A 3V3OA 1E39A 3DA1A 3M13A 4IVOB 3LOVA 1W4XA 3LZWA 4CY8A 5J60A 2YVJA 4BK3A 1GOSA 5HXIA 2FJBA 3ATQA 1O95A 1L0VA 2XVFA 1DXLA 4C77A 1GALA 1LPFA 3O0HA 4NEVA 2WU2A 3NNEA 1N4UA 5HHFA 5EBKA 2GQWA 2C65A 5FS7A 4JNAA 4A5LA 1NEKA 3BHFA 3BI5A 3UOVA 2RGHA 1CC2A 1E7PA 2ARDA 2Q6UA 2BA9A 1BZLA 2YWLA 1GRBA 5KVHA 1E6EA 1VG9A 3QJ4A 3DH9A 2E4GA 4AP3A 2BYBA 2WPEA 3NK1X 2V3AA 4APNA 2OLOA 4JN9A 4GDPA 3RP6A 3AB1A 1XANA 1D7YA 1KDGA 1KNRA 3BI4A 4P9SA 2R9ZA 5U25A 1OJDA 1Q9IA 1TDFA 1H84A 3NHOX 2YLXA 3L1RA 2QA1A 5IQ1A 1IUXA 2J3NA 4H4PA 1HYUA 1N1PA 4AT0A 1NPXA 1TDOA 2CDUA 3FBSA 4OPLA 4RG3A 1TDKA 3D1CA 3S5WA 3DK8A 2Q7VA 2EQ8A 4Z2TA 1LTXR 3CNPA 2V6OA 3LB8A 3CGBA 3M0OA 2XFOA 3K7TA 1TDNA 1Y56B 4Y4LA 3FIMB 5CKUA 5ER0A 1NDAA 2QAEA 2YVGA 2WDQA 3KKJA 4EIQA 3PO7A 3UOYA 1KF6A 2B7RA 4EM4A 3NIXA 4EM3A 2A89A 1EL8A 1GTEA 1SEZA 2CVJA 4CBQA 5KOWA 1GETA 1CF3A 1LQUA 1E1LA 1ZMDA 3NH3X 4H2RA 2X99A 3M12A 5GSNA 5BVAA 3LADA 5M0ZA 5J7XA 3F8RA 4EMWA 1GRFA 1PXCA 3AEEA 1K0IA 1TYPA 2BK4A 1GRGA 3ABVA 4H4ZA 1FEBA 2WPFA 2E1MA 1F8RA 2B9WA 4H4QA 3QSMA 2NVKX 2IIDA 2DKIA 4HB9A 4PAAA 1JNZA 2RGJA 4FK1C 1QO8A 1NENA 3CPJG 3DJDA 4ZCCA 2C73A 2JKCA 2OA1A 4JQ9A 1JRZA 3CNJA 2WBAA 3II4A 4H2QA 4USQA 3AE6A 3SM8A 1L9CA 5TR3A 3PS9A 4YSYA 5U1OA 3UKAA 2XVJA 4H7UA 1LJ1A 1H6VA 1F6MA 1ZMCA 4JDRA 5FS8A 1PN0A 1VG0A 3LJPA 1H86A 4IVMB 1GNDA 1BKWA 3V76A 1AOGA 1N4VA 2XVHA 3F8PA 4HA6A 4O5QA 4I58A 1O94A 1YKJA 1PBEA 4AP1A 3AE5A 1B8SA 4C3XA 3IHMA 1EBDA 1YQZA 4DSHA 2FJAA 3SQPA 4J2WA 3NYCA 5FS6A 2C64A 4Y4MA 1MOKA 3ZDNA 4GF7A 2YM2A 3GYIA 1FOHA 3K30A 4AT2A 1IUSA 4H4WA 2JB2A 2C75A 2XVEA 1FCDA 2WOIA 2WDRA 2XLPA 3F8DA 2WPCA 2YG6A 3B3RA 4BJYA 4K7ZA 3VQRA 2R0PA 3P1WA 3NTAA 1PJ7A 2BS2A 1ZOVA 4UDQA 3H8IA 3CIRA 3VRDB 4J31A 4YT0A 1E1NA 2UZZA 3CN8A 2VRLA 1ELIA 3DK4A 3T37A 3GDPA 1PDHA 1KFYA 2C7GA 4MJWA 4U8NA 4Z25A 1NG3A 3UTHA 3URHA 1VDCA 2EQ6A 2VQBA 4XWZA 2H88A 3NT6A 3VRAA 2R4EA 2JBVA 3EANA 3AYJA 3D8XA 1ZKQA 3IHGA 2WP6A 4C5OA 3ATRA 3G5RA 3GMBA 5C3JA 1NHQA 1MXTA 1PBFA 4EMJA 4AOXA 4EQWA 5JCLA 3FMWA 1B37A 3AE3A 2Q0LA 2WHDA 2WS3A 3UP5A 3WE0A 1H7XA 3NK0X 4H4RA 1PHHA 1VQWA 2AAQA 2RGOA 4KX6A 4U8IA 1JU2A 2C3DA 4B68A 2OALA 1S2YA 5JCKA 4OPTA 1CHUA 4H2PA 3G5QA 1EL7A 2AR8A 1ZX9A 2VVLA 2GH5A 2R0GA 2TMDA 4Y4NA 2WOVA 2QA2A 1KSSA 2V61A 4NTCA 2WEUA 3H4KA 3NYFA 2Y6QA 4J33A 4LIIA 4A99A 2BK5A 2XFNA 3QSSA 3BI2A 2A8XA 4GRTA 3G5SA 2C3CA 1TYTA 3AECA 4Z43A 1H7WA 3L8KA 2QCUA 2R46A 4U8OA 1JEHA 3RP7A 3FPZA 1O5WA 5JCIA 2TPRA 2C66A 4IA5A 1NHPA 2B7SA 3NG7X 1RSGA 4H4TA 1JOAA 3UTFA 2V60A 4H4UA 1PJ5A 4B66A 4B63A 1DOEA 4CRTA 1FECA 3CPHG 3UTGA 4NTEA 2FBWA 3DJEA 3QSEA 5DBJA 1E1MA 4H4VA 4BK1A 2CFYA 2WOWA 4DSGA 3AE9A 3AE8A 3NN0X 2GR2A 3IWAA 3KA7A 3GYJA 2GMHA 1TDEA 4A7AA 2PYXA 3ITJA 3P4RA 4YWOA 2BS3A 3CNTA 2YR4A 4BURA 1GRAA 3AXBA 3AYIA 3ALJA 2APGA 1XHCA 3ALMA 4OPCA 1KSUA 1DODA 3KLJA 2VZ2A 4YSHA 4REKA 2YG4A 1F8WA 1S2QA 2YM1A 4H4YA 4Z2RA 3BHKA 5HYMA 5L46A 1NHRA 3H8LA 4JNQA 3VRBA 1ZY8A 3AEFA 1CL0A 1YQ4A 4X9MA 2B76A 2AQJA 3AEDA 2GAHB 1PJ6A 3AD7B 1OJTA 3AE1A 1Q1RA 3DGHA 3DK9A 4LA1A 4A6NA 2Y6RA 2DKHA 1BGJA 2VVLG 2YLTA 3DGZA 1PS9A 3GDNA 1GERA 3AEBA 4CNJA 1CBOA 3NN6X 1H81A 3UCLA 3AD9B 4J34A 1XDIA 4K22A 2PHHA 3AYLA 3CPIG 4OPIA 1BF3A 1X31B 3COXA 4XXGA 4NTDA 2X8HA 4B69A 2YG7A 3OC4A 1DOCA 3P9UA 1L9DA 2YLSA 4FK1A 2ZZCA 4TLXA 3UOZA 1CJ3A 3GD4A 4JY2A 1RP0A 3E1TA 2YVFA 5EB5A 5EOWA 1RYIA 5BULA 3SFDA 3RP8A 4CCRA 2XFUA 2XLSA 5IQ4A 3VR9A 2BCGG 3IF9A 2X3NA 1IUUA 3NTDA 1ZP0A 2GR0A 3NRNA 3ZYXA 3QVRA 4CY6A 1IUTA 2CULA 3UOXA 3PVCA 4U2LA 4ADWA 2R4JA 4DGKA 2VOUA 1DOBA 1PXAA 4GCMA 4OPGA 4RG4A 3AWIA 5C2TA 2YR6A 5JCNA 1NAAA 3AEAA 1B5QA 2ZZ0A 3UKHA 4YKFA 1S3BA 3SFEA 3KD9A 2YLZA 3DMEA 3LXDA 4N9XA 4B64A 4XWRA 4NZHA 4YTNA 3P4PA 4TM3A 2X8CA 3QVPA 1CC4A 4PABA 3K7QX 3DJJA 3OZ2A 4EMIA 3UKKA 4X9NA 3UTEA 2YLRA 3Q6JA 1MO9A 4C3YA 1YQ3A 4D03A 4K2XA 4C74A 4YTPA 4Z26A 3NLCA 1EL5A 2WETA 3ICSA 4OPUA 1QJDA 1Z6LA 1JRYA 4BJZA 1F8SA 1GTHA 2JB1A 4TM4A 2WQYA 2Q0KA 3K7MX 4NEWA 1GT8A 1GESA 3CNDA 1TRBA 3CTYA 2R0CA 2I0ZA 2FJEA 2OAMA 2BCPA 2X50A 4YXDA 3HZLA 1LVLA 2B9YA 3IC9A 4H50A 4A79A 1KNPA 2W0HA 2GQFA 1IUWA 2XLTA 1GSNA 2GF3A 4J56A 1CC6A 2FJDA 2BACA 2IVEA 4J57A 2NPXA 4OCGA 1F3PA 1GXFA 2C76A 2BS4A 2ACZA 4B65A 1CJ2A 1FEAA 2GR3A 3ADAB 4B67A 2C72A 1CJCA 1M64A 1PBBA 4DNAA 4EQRA 2GRTA 3RNMA 1LQTA 1L9EA 3S61A 4BK2A 4EQSA 3ISHA 3I6DA 4FDCB 2RABA 2EQ7A 5EB4A 4O5UA 1ONFA 3ALLA 1K4QA 3KU9A 4LU6A 1IUVA 1OJ9A 4AOSA 4OVIA 2ZBWA 3DJGX 3GWFA 3P4QA 4JY3A 5KWFA 2VRMA 2A87A 2WP5A 1EL9A 3AEGA 1GV4A 1GRHA 4TM0A 4OPDA 4H2NA 3CGDA 2O9ZA 3P4SA 1LV0A 1N4WA 2BC0A 2BC1A 3GD3A 2JAEA 1GRTA 1GEUA 2XCGA 2V5ZA 3C96A 3NKSA 3UP4A 2Z5YA 5HY5A 4Z44A 5KRQA 3Q9TA 1Q1WA 1CJ4A 2C70A 2WP9A 1V59A 4Z2UA 3CGEA 3C4NA 4J36A 2WDVA 1H82A 3BNMA 4U8JA 4I59A 3GRSA 5FMHA 2V3BA 3EPTA 1NHSA 3ICRA 4CNKA 4YSZA 1D4EA 4H4XA 4K5SA 4UDRA 1B4VA 4ZCDA 2WESA 4TLZA 4YKGA 1Y56A 5GRTA 3REDA 3NYEA 1GREA 4U8KA 2XVIA 1PBCA 1NG4A 1S3EA 2R45A 4M52A 1K0LA 2GVCA 1YY5A 4UDPA 3R9UA 4BV6A 1K0JA 5BUKA 3FG2P 4X4JA 4A6NB 4ZN0A 3GRTA 2GV8A 2YQUA 4U8PA 1JNRA 1COYA 1PXBA 1BWCA 1XPQA
chains in the Genus database with same CATH superfamily
3NK2X 1BGNA 3CNSA 3KPKA 3V3NA 3SZFA 1IJHA 1ZOYA 2EQ9A 1OJCA 2H89A 5KMSA 4WX1A 1OJAA 1ZDLA 4G6GA 4KPRA 4ICYA 4WCTA 3CGCA 2C4CA 2X8GA 5KXJA 1FL2A 3SY4A 2GEWA 4EIPA 1Y0PA 2XLRA 2OLNA 2BABA 4U2TA 4GDEA 2YAUA 2BXRA 3G3EA 4H4SA 3EF6A 3QFAA 2YLWA 1REOA 4ECHA 2YR5A 1DJNA 3VR8A 4YSXA 1UKVG 2XFPA 4YJDA 2YG3A 3UKFA 3AE4A 4IV9A 3T14A 5JCMA 5IPYA 1P2EA 2XFQA 2XYOA 2ZZBA 4U2SA 2B9XA 4E0VA 4YJFB 1P2HA 4TM1A 3KVEA 1VRQB 4K5RA 5KVIA 2IVDA 4D04A 2GMJA 4U8LA 5CQFA 1D5TA 2WU5A 3AE2A 1D4CA 3SGLA 4GUVA 1QLBA 2XLUA 3LZXA 5FS9A 4A9WA 1D4DA 4Z24A 4YJHB 2YG5A 2E5VA 4UP3A 3I3LA 2JK6A 4FX9A 3ICTA 3W4KA 4U8MA 3W4JA 4B1BA 4RSLA 1H83A 2BK3A 3JSKA 1DJQA 3HYWA 4CCQA 4YTMA 3UKQA 4USRA 2BXSA 1AN9A 2GAGB 2GB0A 2JB3A 4EQXA 1JRXA 3QFBA 1M6IA 2HQMA 2GR1A 5LV9A 3B6DA 4A65A 1ZK7A 3C4AA 3RHAA 3GWDA 5U63A 3GMCA 3GSIA 1GPEA 2XDOA 3BNUA 3CMMA 5BRTA 4IA6A 4GR1A 2C67A 3AD8B 2VVMA 3NGCX 3KPFA 4K8DA 1DNCA 3UKLA 2F5ZA 5M10A 1D7LA 1E1KA 5KOXA 2Z5XA 2VQ7A 3UKPA 1PBDA 3EAOA 3AE7A 3V3OA 3M13A 3DA1A 1E39A 4IVOB 3LOVA 1W4XA 3LZWA 4CY8A 5J60A 2YVJA 4BK3A 1GOSA 5HXIA 2FJBA 3ATQA 1KIFA 1O95A 1L0VA 2XVFA 1DXLA 4C77A 1GALA 1LPFA 3O0HA 4NEVA 2WU2A 3T0KA 3NNEA 1N4UA 5HHFA 5EBKA 2GQWA 2C65A 5FS7A 4JNAA 4A5LA 1NEKA 3BHFA 3BI5A 3UOVA 2RGHA 1CC2A 1E7PA 2ARDA 2Q6UA 2BA9A 1BZLA 2YWLA 1GRBA 5KVHA 1E6EA 1VG9A 3QJ4A 3DH9A 1C0KA 2E4GA 4AP3A 2E49A 2BYBA 2WPEA 3NK1X 2V3AA 4APNA 2OLOA 4JN9A 3RP6A 4GDPA 3AB1A 1XANA 1D7YA 1KDGA 1KNRA 3BI4A 4P9SA 2R9ZA 5U25A 1OJDA 1Q9IA 1TDFA 1H84A 3NHOX 2YLXA 3L1RA 2QA1A 5IQ1A 1IUXA 1C0IA 2J3NA 4H4PA 1HYUA 1N1PA 4AT0A 1NPXA 1TDOA 2CDUA 3FBSA 4OPLA 4RG3A 1TDKA 3D1CA 3S5WA 3DK8A 2Q7VA 2EQ8A 4Z2TA 1LTXR 3CNPA 2V6OA 3LB8A 3CGBA 3M0OA 2XFOA 3K7TA 1TDNA 1Y56B 3GYXA 4Y4LA 3FIMB 5CKUA 5ER0A 1NDAA 2QAEA 2YVGA 2WDQA 3KKJA 4EIQA 3PO7A 3UOYA 1KF6A 2B7RA 4EM4A 3NIXA 4EM3A 2A89A 1EL8A 1GTEA 1SEZA 2CVJA 4CBQA 5KOWA 1GETA 1CF3A 1LQUA 1E1LA 1ZMDA 3NH3X 4H2RA 2X99A 3M12A 5GSNA 5BVAA 3LADA 5M0ZA 5J7XA 3F8RA 4EMWA 1PXCA 1GRFA 3AEEA 1K0IA 1TYPA 2BK4A 1GRGA 3ABVA 4H4ZA 1FEBA 2WPFA 3SX6A 2E1MA 1F8RA 2B9WA 4H4QA 3QSMA 2NVKX 2IIDA 2DKIA 4HB9A 4PAAA 1JNZA 2RGJA 4FK1C 1QO8A 1NENA 3DJDA 3CPJG 4ZCCA 2C73A 2JKCA 2OA1A 4JQ9A 1JRZA 3CNJA 2WBAA 3II4A 4H2QA 4USQA 3AE6A 3SM8A 1L9CA 5TR3A 3PS9A 4YSYA 5U1OA 3UKAA 1EVIA 2XVJA 4H7UA 1LJ1A 1H6VA 1F6MA 1ZMCA 4JDRA 5FS8A 1PN0A 1VG0A 3LJPA 1H86A 4IVMB 1GNDA 1C0LA 1BKWA 3V76A 1AOGA 1N4VA 2XVHA 3F8PA 4HA6A 4O5QA 4I58A 1O94A 1YKJA 1PBEA 4AP1A 3AE5A 1B8SA 4C3XA 3IHMA 1EBDA 1YQZA 4DSHA 2FJAA 3SQPA 4J2WA 3NYCA 5FS6A 2C64A 4Y4MA 1MOKA 3SXIA 3ZDNA 4GF7A 2YM2A 3GYIA 1FOHA 3K30A 4AT2A 1IUSA 4H4WA 2JB2A 2C75A 2XVEA 1FCDA 2WOIA 2WDRA 2XLPA 3F8DA 2WPCA 2YG6A 3B3RA 4BJYA 3VQRA 4K7ZA 2R0PA 3P1WA 2DU8A 1PJ7A 3NTAA 2BS2A 1ZOVA 3SZCA 4UDQA 3H8IA 3CIRA 3VRDB 4J31A 4YT0A 2UZZA 1E1NA 3CN8A 2VRLA 1ELIA 3DK4A 3T37A 3GDPA 1PDHA 3ZNQA 1KFYA 2C7GA 4MJWA 4U8NA 4Z25A 1NG3A 3UTHA 3T2KA 3URHA 1VDCA 2EQ6A 4XWZA 2VQBA 2H88A 3NT6A 3VRAA 2R4EA 2JBVA 3EANA 3AYJA 3D8XA 1ZKQA 3IHGA 2WP6A 4C5OA 3ATRA 3G5RA 3GMBA 5C3JA 1NHQA 1MXTA 1PBFA 4QFCA 4EMJA 4AOXA 4EQWA 5JCLA 3FMWA 1B37A 3AE3A 2Q0LA 2WHDA 2WS3A 3UP5A 3WE0A 1H7XA 4G73A 3NK0X 4H4RA 1PHHA 2RGOA 1VQWA 2AAQA 4G6HA 4KX6A 3HYXA 4U8IA 1JU2A 2C3DA 3T31A 2OALA 4B68A 1S2YA 5JCKA 4OPTA 4NNJA 1CHUA 4H2PA 3G5QA 1EL7A 2AR8A 1ZX9A 2VVLA 2GH5A 2R0GA 2TMDA 4Y4NA 2WOVA 3SYIA 2QA2A 1KSSA 2V61A 4II3A 4NTCA 3T2ZA 2WEUA 3H4KA 3NYFA 2Y6QA 4J33A 4LIIA 4A99A 2E82A 3QSSA 2BK5A 2XFNA 3BI2A 4II2A 2A8XA 4GRTA 3G5SA 2C3CA 1TYTA 3AECA 4Z43A 1H7WA 2E48A 3L8KA 2QCUA 2R46A 4U8OA 1JEHA 3RP7A 3FPZA 1O5WA 5JCIA 2TPRA 2C66A 4IA5A 1NHPA 2B7SA 4YJGA 3NG7X 1RSGA 4H4TA 4GAVA 1JOAA 3UTFA 2V60A 4H4UA 1PJ5A 4B66A 4B63A 1DOEA 4CRTA 1FECA 3CPHG 3UTGA 4NTEA 3DJEA 2FBWA 3QSEA 4BK1A 1E1MA 4H4VA 5DBJA 2CFYA 2WOWA 4DSGA 3AE9A 3AE8A 3NN0X 2GR2A 3IWAA 3KA7A 3GYJA 2GMHA 1TDEA 4G9KA 4A7AA 2PYXA 3ITJA 3P4RA 4YWOA 2BS3A 3CNTA 2YR4A 4BURA 1GRAA 3AXBA 3AYIA 3ALJA 4QFDA 1XHCA 3ALMA 2APGA 1KSUA 1DODA 3KLJA 2VZ2A 4YSHA 4OPCA 4REKA 2YG4A 1F8WA 1S2QA 2YM1A 4H4YA 4Z2RA 3BHKA 5HYMA 3W4IA 5L46A 1NHRA 3H8LA 4JNQA 3VRBA 1ZY8A 3AEFA 1CL0A 1YQ4A 4X9MA 2B76A 2AQJA 3AEDA 2GAHB 1PJ6A 3AD7B 1OJTA 3AE1A 1Q1RA 3DGHA 3DK9A 4LA1A 4A6NA 2Y6RA 1BGJA 2DKHA 2VVLG 2YLTA 3DGZA 1PS9A 3GDNA 1DAOA 5KMRA 1GERA 3AEBA 4CNJA 1CBOA 3NN6X 1H81A 3UCLA 3AD9B 4J34A 1XDIA 4K22A 2PHHA 3AYLA 3CPIG 4OPIA 1BF3A 1X31B 3COXA 1C0PA 4NTDA 3ZNPA 4XXGA 2X8HA 4B69A 2YG7A 3OC4A 1DOCA 3P9UA 1L9DA 2YLSA 4FK1A 2ZZCA 4TLXA 3SZ0A 3UOZA 1CJ3A 3GD4A 4JY2A 1RP0A 3E1TA 2YVFA 5EB5A 5EOWA 1RYIA 5BULA 3SFDA 3RP8A 3HYVA 5KMQA 4CCRA 2XFUA 2XLSA 5IQ4A 3VR9A 2BCGG 3IF9A 2X3NA 1IUUA 3NTDA 1ZP0A 2GR0A 3NRNA 3ZYXA 3QVRA 4CY6A 1IUTA 2CULA 3UOXA 3CUKA 3PVCA 4U2LA 4ADWA 1VE9A 2R4JA 4YJFA 2VOUA 4DGKA 1DOBA 1PXAA 4GCMA 4OPGA 4RG4A 3AWIA 5C2TA 2YR6A 5JCNA 1NAAA 3AEAA 3ZNNA 1B5QA 2ZZ0A 3UKHA 3SZWA 5KNLA 4YKFA 1S3BA 4YJHA 3SFEA 3KD9A 2YLZA 3DMEA 3LXDA 4N9XA 4B64A 4XWRA 4NZHA 4YTNA 3P4PA 4TM3A 2X8CA 3QVPA 1CC4A 4PABA 3K7QX 3OZ2A 3DJJA 4EMIA 3UKKA 4X9NA 3UTEA 2YLRA 3Q6JA 1MO9A 4C3YA 1YQ3A 4D03A 4K2XA 4C74A 4YTPA 4Z26A 3NLCA 1EL5A 4NWZA 2WETA 3ICSA 4OPUA 1QJDA 1Z6LA 1JRYA 4BJZA 1F8SA 1GTHA 2JB1A 4TM4A 2WQYA 2Q0KA 3K7MX 4NEWA 1GT8A 1GESA 3CNDA 1TRBA 3CTYA 2R0CA 2I0ZA 2FJEA 2OAMA 2BCPA 2X50A 4YXDA 3HZLA 1LVLA 2B9YA 3IC9A 4H50A 4A79A 1KNPA 2W0HA 2GQFA 1IUWA 2XLTA 1GSNA 2GF3A 4J56A 1CC6A 2FJDA 2BACA 2IVEA 4J57A 2NPXA 4OCGA 1F3PA 1GXFA 1DDOA 2C76A 2BS4A 2ACZA 4B65A 2BRAA 1CJ2A 3ADAB 1FEAA 2GR3A 4B67A 2C72A 1CJCA 1M64A 1PBBA 2BRYA 4DNAA 4EQRA 2GRTA 3RNMA 1LQTA 1L9EA 4BK2A 3S61A 4EQSA 3ISHA 3I6DA 4FDCB 2RABA 2EQ7A 3T2YA 5EB4A 4O5UA 1ONFA 3ALLA 1K4QA 3KU9A 4LU6A 1IUVA 1OJ9A 4AOSA 4YJGB 2ZBWA 3DJGX 3GWFA 3P4QA 4JY3A 4OVIA 5KWFA 2VRMA 2E4AA 2A87A 2WP5A 1EL9A 3AEGA 1GV4A 1GRHA 4TM0A 4OPDA 4H2NA 3CGDA 2O9ZA 3P4SA 1LV0A 1N4WA 2BC0A 2BC1A 3GD3A 2JAEA 1GRTA 1GEUA 2XCGA 2V5ZA 3C96A 3NKSA 3UP4A 2Z5YA 5HY5A 4Z44A 5KRQA 3Q9TA 1Q1WA 1CJ4A 2C70A 2WP9A 1V59A 4Z2UA 3CGEA 3C4NA 4J36A 2WDVA 1H82A 5KMPA 3BNMA 4U8JA 3ZNOA 3GRSA 4I59A 5FMHA 2V3BA 3EPTA 4GAPA 1NHSA 3ICRA 4CNKA 4YSZA 1D4EA 4H4XA 4G74A 4K5SA 4UDRA 1B4VA 4ZCDA 2WESA 4TLZA 4YKGA 1Y56A 5GRTA 3REDA 3NYEA 1GREA 4U8KA 2XVIA 1PBCA 1NG4A 2R45A 1S3EA 4M52A 1K0LA 2GVCA 1YY5A 4UDPA 3R9UA 4BV6A 1K0JA 5BUKA 3FG2P 4X4JA 4A6NB 3WGTA 4ZN0A 3GRTA 2GV8A 2YQUA 4U8PA 1JNRA 1COYA 1PXBA 1BWCA 1XPQA
chains in the Genus database with same CATH topology
3NK2X 1BGNA 3CNSA 3KPKA 3V3NA 3SZFA 1IJHA 1ZOYA 2EQ9A 1OJCA 2H89A 5KMSA 4WX1A 1OJAA 1ZDLA 4G6GA 4KPRA 4ICYA 4WCTA 3CGCA 2C4CA 2X8GA 5KXJA 1FL2A 3SY4A 2GEWA 4EIPA 1Y0PA 2XLRA 2OLNA 2BABA 4U2TA 4GDEA 2YAUA 2BXRA 4H4SA 3EF6A 3QFAA 2YLWA 1REOA 4ECHA 2YR5A 1DJNA 3VR8A 4YSXA 1UKVG 2XFPA 2YG3A 3UKFA 3AE4A 4IV9A 3T14A 5JCMA 5IPYA 1P2EA 2XFQA 2XYOA 2ZZBA 4U2SA 2B9XA 4E0VA 1P2HA 4TM1A 3KVEA 1VRQB 4K5RA 5KVIA 2IVDA 4D04A 2GMJA 4U8LA 5CQFA 1D5TA 2WU5A 3AE2A 1D4CA 4GUVA 3SGLA 1QLBA 2XLUA 3LZXA 5FS9A 4A9WA 1D4DA 4Z24A 2YG5A 2E5VA 4UP3A 3I3LA 2JK6A 4FX9A 3ICTA 4U8MA 4B1BA 1H83A 2BK3A 3JSKA 4RSLA 1DJQA 3HYWA 4CCQA 4YTMA 3UKQA 4USRA 2BXSA 2GAGB 2GB0A 2JB3A 4EQXA 1JRXA 3QFBA 1M6IA 2HQMA 2GR1A 5LV9A 3B6DA 4A65A 1ZK7A 3C4AA 3RHAA 3GWDA 5U63A 3GMCA 1GPEA 3GSIA 2XDOA 3BNUA 3CMMA 5BRTA 4IA6A 4GR1A 2C67A 3AD8B 2VVMA 3NGCX 3KPFA 4K8DA 1DNCA 3UKLA 2F5ZA 5M10A 1D7LA 1E1KA 5KOXA 2Z5XA 2VQ7A 3UKPA 1PBDA 3EAOA 3AE7A 3V3OA 1E39A 3DA1A 3M13A 4IVOB 3LOVA 1W4XA 3LZWA 4CY8A 5J60A 2YVJA 4BK3A 1GOSA 5HXIA 2FJBA 3ATQA 1O95A 1L0VA 2XVFA 1DXLA 4C77A 1GALA 1LPFA 3O0HA 4NEVA 2WU2A 3T0KA 3NNEA 1N4UA 5HHFA 5EBKA 2GQWA 2C65A 5FS7A 4JNAA 4A5LA 1NEKA 3BHFA 3BI5A 3UOVA 2RGHA 1CC2A 1E7PA 2ARDA 2Q6UA 2BA9A 1BZLA 2YWLA 1GRBA 5KVHA 1E6EA 1VG9A 3QJ4A 3DH9A 2E4GA 4AP3A 2BYBA 2WPEA 3NK1X 2V3AA 4APNA 2OLOA 4JN9A 3RP6A 4GDPA 3AB1A 1XANA 1D7YA 1KDGA 1KNRA 3BI4A 4P9SA 2R9ZA 5U25A 1OJDA 1Q9IA 1TDFA 1H84A 3NHOX 2YLXA 3L1RA 2QA1A 5IQ1A 1IUXA 2J3NA 4H4PA 1HYUA 1N1PA 4AT0A 1NPXA 1TDOA 2CDUA 3FBSA 4OPLA 4RG3A 1TDKA 3D1CA 3S5WA 3DK8A 2Q7VA 2EQ8A 4Z2TA 1LTXR 3CNPA 2V6OA 3LB8A 3CGBA 3M0OA 2XFOA 3K7TA 1TDNA 1Y56B 3GYXA 4Y4LA 3FIMB 5CKUA 5ER0A 1NDAA 2QAEA 2YVGA 2WDQA 3KKJA 4EIQA 3PO7A 3UOYA 1KF6A 2B7RA 4EM4A 3NIXA 4EM3A 2A89A 1EL8A 1GTEA 1SEZA 2CVJA 4CBQA 5KOWA 1GETA 1CF3A 1LQUA 1E1LA 1ZMDA 3NH3X 4H2RA 2X99A 3M12A 5GSNA 5BVAA 3LADA 5M0ZA 5J7XA 3F8RA 4EMWA 1GRFA 1PXCA 3AEEA 1K0IA 1TYPA 2BK4A 1GRGA 3ABVA 4H4ZA 1FEBA 2WPFA 3SX6A 2E1MA 1F8RA 2B9WA 4H4QA 3QSMA 2NVKX 2IIDA 2DKIA 4HB9A 4PAAA 1JNZA 2RGJA 4FK1C 1QO8A 1NENA 3CPJG 3DJDA 4ZCCA 2C73A 2JKCA 2OA1A 4JQ9A 1JRZA 3CNJA 2WBAA 3II4A 4H2QA 4USQA 3AE6A 3SM8A 1L9CA 5TR3A 3PS9A 4YSYA 5U1OA 3UKAA 2XVJA 4H7UA 1LJ1A 1H6VA 1F6MA 1ZMCA 4JDRA 5FS8A 1PN0A 1VG0A 3LJPA 1H86A 4IVMB 1GNDA 1BKWA 3V76A 1AOGA 1N4VA 2XVHA 3F8PA 4HA6A 4O5QA 4I58A 1O94A 1YKJA 1PBEA 4AP1A 3AE5A 1B8SA 4C3XA 3IHMA 1EBDA 1YQZA 4DSHA 2FJAA 3SQPA 4J2WA 3NYCA 5FS6A 2C64A 4Y4MA 1MOKA 3SXIA 3ZDNA 4GF7A 2YM2A 3GYIA 1FOHA 3K30A 4AT2A 1IUSA 4H4WA 2JB2A 2C75A 2XVEA 1FCDA 2WOIA 2WDRA 2XLPA 3F8DA 2WPCA 2YG6A 3B3RA 4BJYA 4K7ZA 3VQRA 2R0PA 3P1WA 3NTAA 1PJ7A 2BS2A 1ZOVA 3SZCA 4UDQA 3H8IA 3CIRA 3VRDB 4J31A 4YT0A 1E1NA 2UZZA 3CN8A 2VRLA 1ELIA 3DK4A 3T37A 3GDPA 1PDHA 1KFYA 2C7GA 4MJWA 4U8NA 4Z25A 1NG3A 3UTHA 3T2KA 3URHA 1VDCA 2EQ6A 2VQBA 4XWZA 2H88A 3NT6A 3VRAA 2R4EA 2JBVA 3EANA 3AYJA 3D8XA 1ZKQA 3IHGA 2WP6A 4C5OA 3ATRA 3G5RA 3GMBA 5C3JA 1NHQA 1MXTA 1PBFA 4EMJA 4AOXA 4EQWA 5JCLA 3FMWA 1B37A 3AE3A 2Q0LA 2WHDA 2WS3A 3UP5A 3WE0A 1H7XA 4G73A 3NK0X 4H4RA 1PHHA 1VQWA 2AAQA 2RGOA 4G6HA 4KX6A 3HYXA 4U8IA 1JU2A 2C3DA 3T31A 2OALA 4B68A 1S2YA 5JCKA 4OPTA 4NNJA 1CHUA 4H2PA 3G5QA 1EL7A 2AR8A 1ZX9A 2VVLA 2GH5A 2R0GA 2TMDA 4Y4NA 2WOVA 3SYIA 2QA2A 1KSSA 2V61A 4II3A 4NTCA 3T2ZA 2WEUA 3H4KA 3NYFA 2Y6QA 4J33A 4LIIA 4A99A 4II2A 2BK5A 2XFNA 3QSSA 3BI2A 2A8XA 4GRTA 3G5SA 2C3CA 1TYTA 3AECA 4Z43A 1H7WA 3L8KA 2QCUA 2R46A 4U8OA 1JEHA 3RP7A 3FPZA 1O5WA 5JCIA 2TPRA 2C66A 4IA5A 1NHPA 2B7SA 3NG7X 1RSGA 4H4TA 4GAVA 1JOAA 3UTFA 2V60A 4H4UA 1PJ5A 4B66A 4B63A 1DOEA 4CRTA 1FECA 3CPHG 3UTGA 4NTEA 2FBWA 3DJEA 3QSEA 4BK1A 1E1MA 4H4VA 5DBJA 2CFYA 2WOWA 4DSGA 3AE9A 3AE8A 3NN0X 2GR2A 3IWAA 3KA7A 3GYJA 2GMHA 1TDEA 4G9KA 4A7AA 2PYXA 3ITJA 3P4RA 4YWOA 2BS3A 3CNTA 2YR4A 4BURA 1GRAA 3AXBA 3AYIA 3ALJA 2APGA 1XHCA 3ALMA 4OPCA 1KSUA 1DODA 3KLJA 2VZ2A 4YSHA 4REKA 2YG4A 1F8WA 1S2QA 2YM1A 4H4YA 4Z2RA 3BHKA 5HYMA 5L46A 1NHRA 3H8LA 4JNQA 3VRBA 1ZY8A 3AEFA 1CL0A 1YQ4A 4X9MA 2B76A 2AQJA 3AEDA 2GAHB 1PJ6A 3AD7B 1OJTA 3AE1A 1Q1RA 3DGHA 3DK9A 4LA1A 4A6NA 2Y6RA 2DKHA 1BGJA 2VVLG 2YLTA 3DGZA 1PS9A 3GDNA 5KMRA 1GERA 3AEBA 4CNJA 1CBOA 3NN6X 1H81A 3UCLA 3AD9B 4J34A 1XDIA 4K22A 2PHHA 3AYLA 3CPIG 4OPIA 1BF3A 1X31B 3COXA 4XXGA 4NTDA 2X8HA 4B69A 2YG7A 3OC4A 1DOCA 3P9UA 1L9DA 2YLSA 4FK1A 2ZZCA 4TLXA 3SZ0A 3UOZA 1CJ3A 3GD4A 4JY2A 1RP0A 3E1TA 2YVFA 5EB5A 5EOWA 1RYIA 5BULA 3SFDA 3RP8A 3HYVA 5KMQA 4CCRA 2XFUA 2XLSA 5IQ4A 3VR9A 2BCGG 3IF9A 2X3NA 1IUUA 3NTDA 1ZP0A 2GR0A 3NRNA 3ZYXA 3QVRA 4CY6A 1IUTA 2CULA 3UOXA 3PVCA 4U2LA 4ADWA 2R4JA 4DGKA 2VOUA 1DOBA 1PXAA 4GCMA 4OPGA 4RG4A 3AWIA 5C2TA 2YR6A 5JCNA 1NAAA 3AEAA 1B5QA 2ZZ0A 3UKHA 3SZWA 5KNLA 4YKFA 1S3BA 3SFEA 3KD9A 2YLZA 3DMEA 3LXDA 4N9XA 4B64A 4XWRA 4NZHA 4YTNA 3P4PA 4TM3A 2X8CA 3QVPA 1CC4A 4PABA 3K7QX 3DJJA 3OZ2A 4EMIA 3UKKA 4X9NA 3UTEA 2YLRA 3Q6JA 1MO9A 4C3YA 1YQ3A 4D03A 4K2XA 4C74A 4YTPA 4Z26A 3NLCA 1EL5A 4NWZA 2WETA 3ICSA 4OPUA 1QJDA 1Z6LA 1JRYA 4BJZA 1F8SA 1GTHA 2JB1A 4TM4A 2WQYA 2Q0KA 3K7MX 4NEWA 1GT8A 1GESA 3CNDA 1TRBA 3CTYA 2R0CA 2I0ZA 2FJEA 2OAMA 2BCPA 2X50A 4YXDA 3HZLA 1LVLA 2B9YA 3IC9A 4H50A 4A79A 1KNPA 2W0HA 2GQFA 1IUWA 2XLTA 1GSNA 2GF3A 4J56A 1CC6A 2FJDA 2BACA 2IVEA 4J57A 2NPXA 4OCGA 1F3PA 1GXFA 2C76A 2BS4A 2ACZA 4B65A 2BRAA 1CJ2A 1FEAA 2GR3A 3ADAB 4B67A 2C72A 1CJCA 1M64A 1PBBA 2BRYA 4DNAA 4EQRA 2GRTA 3RNMA 1LQTA 1L9EA 4BK2A 3S61A 4EQSA 3ISHA 3I6DA 4FDCB 2RABA 2EQ7A 3T2YA 5EB4A 4O5UA 1ONFA 3ALLA 1K4QA 3KU9A 4LU6A 1IUVA 1OJ9A 4AOSA 4OVIA 2ZBWA 3DJGX 3GWFA 3P4QA 4JY3A 5KWFA 2VRMA 2A87A 2WP5A 1EL9A 3AEGA 1GV4A 1GRHA 4TM0A 4OPDA 4H2NA 3CGDA 2O9ZA 3P4SA 1LV0A 1N4WA 2BC0A 2BC1A 3GD3A 2JAEA 1GRTA 1GEUA 2XCGA 2V5ZA 3C96A 3NKSA 3UP4A 2Z5YA 5HY5A 4Z44A 5KRQA 3Q9TA 1Q1WA 1CJ4A 2C70A 2WP9A 1V59A 4Z2UA 3CGEA 3C4NA 4J36A 2WDVA 1H82A 5KMPA 3BNMA 4U8JA 4I59A 3GRSA 5FMHA 2V3BA 3EPTA 4GAPA 1NHSA 3ICRA 4CNKA 4YSZA 1D4EA 4H4XA 4G74A 4K5SA 4UDRA 1B4VA 4ZCDA 2WESA 4TLZA 4YKGA 1Y56A 5GRTA 3REDA 3NYEA 1GREA 4U8KA 2XVIA 1PBCA 1NG4A 1S3EA 2R45A 4M52A 1K0LA 2GVCA 1YY5A 4UDPA 3R9UA 4BV6A 1K0JA 5BUKA 3FG2P 4X4JA 4A6NB 4ZN0A 3GRTA 2GV8A 2YQUA 4U8PA 1JNRA 1COYA 1PXBA 1BWCA 1XPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK2 X;  1BGN A;  3CNS A;  3V3N A;  1IJH A;  1ZOY A;  2EQ9 A;  1OJC A;  2H89 A;  4WX1 A;  1OJA A;  1ZDL A;  4KPR A;  4ICY A;  4WCT A;  3CGC A;  2X8G A;  5KXJ A;  1FL2 A;  2GEW A;  4EIP A;  1Y0P A;  2XLR A;  2OLN A;  2BAB A;  4U2T A;  4GDE A;  2YAU A;  2BXR A;  4H4S A;  3EF6 A;  3QFA A;  2YLW A;  1REO A;  4ECH A;  2YR5 A;  1DJN A;  3VR8 A;  4YSX A;  1UKV G;  2XFP A;  2YG3 A;  3UKF A;  3AE4 A;  4IV9 A;  5JCM A;  5IPY A;  1P2E A;  2XFQ A;  2XYO A;  2ZZB A;  4U2S A;  2B9X A;  4E0V A;  1P2H A;  4TM1 A;  3KVE A;  1VRQ B;  4K5R A;  5KVI A;  2IVD A;  4D04 A;  2GMJ A;  4U8L A;  5CQF A;  1D5T A;  2WU5 A;  3AE2 A;  1D4C A;  4GUV A;  3SGL A;  1QLB A;  2XLU A;  3LZX A;  5FS9 A;  4A9W A;  1D4D A;  4Z24 A;  2YG5 A;  2E5V A;  4UP3 A;  3I3L A;  2JK6 A;  4FX9 A;  3ICT A;  4U8M A;  4B1B A;  1H83 A;  2BK3 A;  3JSK A;  4RSL A;  1DJQ A;  4CCQ A;  4YTM A;  3UKQ A;  4USR A;  2BXS A;  2GAG B;  2GB0 A;  2JB3 A;  4EQX A;  1JRX A;  3QFB A;  1M6I A;  2HQM A;  2GR1 A;  5LV9 A;  3B6D A;  4A65 A;  1ZK7 A;  3C4A A;  3RHA A;  3GWD A;  5U63 A;  3GMC A;  1GPE A;  3GSI A;  2XDO A;  3BNU A;  5BRT A;  4IA6 A;  4GR1 A;  2C67 A;  3AD8 B;  2VVM A;  3NGC X;  3KPF A;  4K8D A;  1DNC A;  3UKL A;  2F5Z A;  5M10 A;  1D7L A;  1E1K A;  5KOX A;  2Z5X A;  2VQ7 A;  3UKP A;  1PBD A;  3EAO A;  3AE7 A;  3V3O A;  1E39 A;  3DA1 A;  3M13 A;  4IVO B;  3LOV A;  1W4X A;  3LZW A;  4CY8 A;  5J60 A;  2YVJ A;  4BK3 A;  1GOS A;  5HXI A;  2FJB A;  3ATQ A;  1O95 A;  1L0V A;  2XVF A;  1DXL A;  4C77 A;  1GAL A;  1LPF A;  3O0H A;  4NEV A;  2WU2 A;  3NNE A;  1N4U A;  5HHF A;  5EBK A;  2GQW A;  2C65 A;  5FS7 A;  4JNA A;  4A5L A;  1NEK A;  3BHF A;  3BI5 A;  3UOV A;  2RGH A;  1CC2 A;  1E7P A;  2ARD A;  2Q6U A;  2BA9 A;  1BZL A;  2YWL A;  1GRB A;  5KVH A;  1E6E A;  1VG9 A;  3QJ4 A;  3DH9 A;  2E4G A;  4AP3 A;  2BYB A;  2WPE A;  3NK1 X;  2V3A A;  4APN A;  2OLO A;  4JN9 A;  4GDP A;  3RP6 A;  3AB1 A;  1XAN A;  1D7Y A;  1KDG A;  1KNR A;  3BI4 A;  4P9S A;  2R9Z A;  5U25 A;  1OJD A;  1Q9I A;  1TDF A;  1H84 A;  3NHO X;  2YLX A;  3L1R A;  2QA1 A;  5IQ1 A;  1IUX A;  2J3N A;  4H4P A;  1HYU A;  1N1P A;  4AT0 A;  1NPX A;  1TDO A;  2CDU A;  3FBS A;  4OPL A;  4RG3 A;  1TDK A;  3D1C A;  3S5W A;  3DK8 A;  2Q7V A;  2EQ8 A;  4Z2T A;  1LTX R;  3CNP A;  2V6O A;  3LB8 A;  3CGB A;  3M0O A;  2XFO A;  3K7T A;  1TDN A;  1Y56 B;  4Y4L A;  3FIM B;  5CKU A;  5ER0 A;  1NDA A;  2QAE A;  2YVG A;  2WDQ A;  3KKJ A;  4EIQ A;  3PO7 A;  3UOY A;  1KF6 A;  2B7R A;  4EM4 A;  3NIX A;  4EM3 A;  2A89 A;  1EL8 A;  1GTE A;  1SEZ A;  2CVJ A;  4CBQ A;  5KOW A;  1GET A;  1CF3 A;  1LQU A;  1E1L A;  1ZMD A;  3NH3 X;  4H2R A;  2X99 A;  3M12 A;  5GSN A;  5BVA A;  3LAD A;  5M0Z A;  5J7X A;  3F8R A;  4EMW A;  1GRF A;  1PXC A;  3AEE A;  1K0I A;  1TYP A;  2BK4 A;  1GRG A;  3ABV A;  4H4Z A;  1FEB A;  2WPF A;  2E1M A;  1F8R A;  2B9W A;  4H4Q A;  3QSM A;  2NVK X;  2IID A;  2DKI A;  4HB9 A;  4PAA A;  1JNZ A;  2RGJ A;  4FK1 C;  1QO8 A;  1NEN A;  3CPJ G;  3DJD A;  4ZCC A;  2C73 A;  2JKC A;  2OA1 A;  4JQ9 A;  1JRZ A;  3CNJ A;  2WBA A;  3II4 A;  4H2Q A;  4USQ A;  3AE6 A;  3SM8 A;  1L9C A;  5TR3 A;  3PS9 A;  4YSY A;  5U1O A;  3UKA A;  2XVJ A;  4H7U A;  1LJ1 A;  1H6V A;  1F6M A;  1ZMC A;  4JDR A;  5FS8 A;  1PN0 A;  1VG0 A;  3LJP A;  1H86 A;  4IVM B;  1GND A;  1BKW A;  3V76 A;  1AOG A;  1N4V A;  2XVH A;  3F8P A;  4HA6 A;  4O5Q A;  4I58 A;  1O94 A;  1YKJ A;  1PBE A;  4AP1 A;  3AE5 A;  1B8S A;  4C3X A;  3IHM A;  1EBD A;  1YQZ A;  4DSH A;  2FJA A;  3SQP A;  4J2W A;  3NYC A;  5FS6 A;  2C64 A;  4Y4M A;  1MOK A;  3ZDN A;  4GF7 A;  2YM2 A;  3GYI A;  1FOH A;  3K30 A;  4AT2 A;  1IUS A;  4H4W A;  2JB2 A;  2C75 A;  2XVE A;  1FCD A;  2WOI A;  2WDR A;  2XLP A;  3F8D A;  2WPC A;  2YG6 A;  3B3R A;  4BJY A;  4K7Z A;  3VQR A;  2R0P A;  3P1W A;  3NTA A;  1PJ7 A;  2BS2 A;  1ZOV A;  4UDQ A;  3H8I A;  3CIR A;  3VRD B;  4J31 A;  4YT0 A;  1E1N A;  2UZZ A;  3CN8 A;  2VRL A;  1ELI A;  3DK4 A;  3T37 A;  3GDP A;  1PDH A;  1KFY A;  2C7G A;  4MJW A;  4U8N A;  4Z25 A;  1NG3 A;  3UTH A;  3URH A;  1VDC A;  2EQ6 A;  2VQB A;  4XWZ A;  2H88 A;  3NT6 A;  3VRA A;  2R4E A;  2JBV A;  3EAN A;  3AYJ A;  3D8X A;  1ZKQ A;  3IHG A;  2WP6 A;  4C5O A;  3ATR A;  3G5R A;  3GMB A;  5C3J A;  1NHQ A;  1MXT A;  1PBF A;  4EMJ A;  4AOX A;  4EQW A;  5JCL A;  3FMW A;  1B37 A;  3AE3 A;  2Q0L A;  2WHD A;  2WS3 A;  3UP5 A;  3WE0 A;  1H7X A;  3NK0 X;  4H4R A;  1PHH A;  1VQW A;  2AAQ A;  2RGO A;  4KX6 A;  4U8I A;  1JU2 A;  2C3D A;  4B68 A;  2OAL A;  1S2Y A;  5JCK A;  4OPT A;  1CHU A;  4H2P A;  3G5Q A;  1EL7 A;  2AR8 A;  1ZX9 A;  2VVL A;  2GH5 A;  2R0G A;  2TMD A;  4Y4N A;  2WOV A;  2QA2 A;  1KSS A;  2V61 A;  4NTC A;  2WEU A;  3H4K A;  3NYF A;  2Y6Q A;  4J33 A;  4LII A;  4A99 A;  2BK5 A;  2XFN A;  3QSS A;  3BI2 A;  2A8X A;  4GRT A;  3G5S A;  2C3C A;  1TYT A;  3AEC A;  4Z43 A;  1H7W A;  3L8K A;  2QCU A;  2R46 A;  4U8O A;  1JEH A;  3RP7 A;  3FPZ A;  1O5W A;  5JCI A;  2TPR A;  2C66 A;  4IA5 A;  1NHP A;  2B7S A;  3NG7 X;  1RSG A;  4H4T A;  1JOA A;  3UTF A;  2V60 A;  4H4U A;  1PJ5 A;  4B66 A;  4B63 A;  1DOE A;  4CRT A;  1FEC A;  3CPH G;  3UTG A;  4NTE A;  2FBW A;  3DJE A;  3QSE A;  5DBJ A;  1E1M A;  4H4V A;  4BK1 A;  2CFY A;  2WOW A;  4DSG A;  3AE9 A;  3AE8 A;  3NN0 X;  2GR2 A;  3IWA A;  3KA7 A;  3GYJ A;  2GMH A;  1TDE A;  4A7A A;  2PYX A;  3ITJ A;  3P4R A;  4YWO A;  2BS3 A;  3CNT A;  2YR4 A;  4BUR A;  1GRA A;  3AXB A;  3AYI A;  3ALJ A;  2APG A;  1XHC A;  3ALM A;  4OPC A;  1KSU A;  1DOD A;  3KLJ A;  2VZ2 A;  4YSH A;  4REK A;  2YG4 A;  1F8W A;  1S2Q A;  2YM1 A;  4H4Y A;  4Z2R A;  3BHK A;  5HYM A;  5L46 A;  1NHR A;  3H8L A;  4JNQ A;  3VRB A;  1ZY8 A;  3AEF A;  1CL0 A;  1YQ4 A;  4X9M A;  2B76 A;  2AQJ A;  3AED A;  2GAH B;  1PJ6 A;  3AD7 B;  1OJT A;  3AE1 A;  1Q1R A;  3DGH A;  3DK9 A;  4LA1 A;  4A6N A;  2Y6R A;  2DKH A;  1BGJ A;  2VVL G;  2YLT A;  3DGZ A;  1PS9 A;  3GDN A;  1GER A;  3AEB A;  4CNJ A;  1CBO A;  3NN6 X;  1H81 A;  3UCL A;  3AD9 B;  4J34 A;  1XDI A;  4K22 A;  2PHH A;  3AYL A;  3CPI G;  4OPI A;  1BF3 A;  1X31 B;  3COX A;  4XXG A;  4NTD A;  2X8H A;  4B69 A;  2YG7 A;  3OC4 A;  1DOC A;  3P9U A;  1L9D A;  2YLS A;  4FK1 A;  2ZZC A;  4TLX A;  3UOZ A;  1CJ3 A;  3GD4 A;  4JY2 A;  1RP0 A;  3E1T A;  2YVF A;  5EB5 A;  5EOW A;  1RYI A;  5BUL A;  3SFD A;  3RP8 A;  4CCR A;  2XFU A;  2XLS A;  5IQ4 A;  3VR9 A;  2BCG G;  3IF9 A;  2X3N A;  1IUU A;  3NTD A;  1ZP0 A;  2GR0 A;  3NRN A;  3ZYX A;  3QVR A;  4CY6 A;  1IUT A;  2CUL A;  3UOX A;  3PVC A;  4U2L A;  4ADW A;  2R4J A;  4DGK A;  2VOU A;  1DOB A;  1PXA A;  4GCM A;  4OPG A;  4RG4 A;  3AWI A;  5C2T A;  2YR6 A;  5JCN A;  1NAA A;  3AEA A;  1B5Q A;  2ZZ0 A;  3UKH A;  4YKF A;  1S3B A;  3SFE A;  3KD9 A;  2YLZ A;  3DME A;  3LXD A;  4N9X A;  4B64 A;  4XWR A;  4NZH A;  4YTN A;  3P4P A;  4TM3 A;  2X8C A;  3QVP A;  1CC4 A;  4PAB A;  3K7Q X;  3DJJ A;  3OZ2 A;  4EMI A;  3UKK A;  4X9N A;  3UTE A;  2YLR A;  3Q6J A;  1MO9 A;  4C3Y A;  1YQ3 A;  4D03 A;  4K2X A;  4C74 A;  4YTP A;  4Z26 A;  3NLC A;  1EL5 A;  2WET A;  3ICS A;  4OPU A;  1QJD A;  1Z6L A;  1JRY A;  4BJZ A;  1F8S A;  1GTH A;  2JB1 A;  4TM4 A;  2WQY A;  2Q0K A;  3K7M X;  4NEW A;  1GT8 A;  1GES A;  3CND A;  1TRB A;  3CTY A;  2R0C A;  2I0Z A;  2FJE A;  2OAM A;  2BCP A;  2X50 A;  4YXD A;  3HZL A;  1LVL A;  2B9Y A;  3IC9 A;  4H50 A;  4A79 A;  1KNP A;  2W0H A;  2GQF A;  1IUW A;  2XLT A;  1GSN A;  2GF3 A;  4J56 A;  1CC6 A;  2FJD A;  2BAC A;  2IVE A;  4J57 A;  2NPX A;  4OCG A;  1F3P A;  1GXF A;  2C76 A;  2BS4 A;  2ACZ A;  4B65 A;  1CJ2 A;  1FEA A;  2GR3 A;  3ADA B;  4B67 A;  2C72 A;  1CJC A;  1M64 A;  1PBB A;  4DNA A;  4EQR A;  2GRT A;  3RNM A;  1LQT A;  1L9E A;  3S61 A;  4BK2 A;  4EQS A;  3ISH A;  3I6D A;  4FDC B;  2RAB A;  2EQ7 A;  5EB4 A;  4O5U A;  1ONF A;  3ALL A;  1K4Q A;  3KU9 A;  4LU6 A;  1IUV A;  1OJ9 A;  4AOS A;  4OVI A;  2ZBW A;  3DJG X;  3GWF A;  3P4Q A;  4JY3 A;  5KWF A;  2VRM A;  2A87 A;  2WP5 A;  1EL9 A;  3AEG A;  1GV4 A;  1GRH A;  4TM0 A;  4OPD A;  4H2N A;  3CGD A;  2O9Z A;  3P4S A;  1LV0 A;  1N4W A;  2BC0 A;  2BC1 A;  3GD3 A;  2JAE A;  1GRT A;  1GEU A;  2XCG A;  2V5Z A;  3C96 A;  3NKS A;  3UP4 A;  2Z5Y A;  5HY5 A;  4Z44 A;  5KRQ A;  3Q9T A;  1Q1W A;  1CJ4 A;  2C70 A;  2WP9 A;  1V59 A;  4Z2U A;  3CGE A;  3C4N A;  4J36 A;  2WDV A;  1H82 A;  3BNM A;  4U8J A;  4I59 A;  3GRS A;  5FMH A;  2V3B A;  3EPT A;  1NHS A;  3ICR A;  4CNK A;  4YSZ A;  1D4E A;  4H4X A;  4K5S A;  4UDR A;  1B4V A;  4ZCD A;  2WES A;  4TLZ A;  4YKG A;  1Y56 A;  5GRT A;  3RED A;  3NYE A;  1GRE A;  4U8K A;  2XVI A;  1PBC A;  1NG4 A;  1S3E A;  2R45 A;  4M52 A;  1K0L A;  2GVC A;  1YY5 A;  4UDP A;  3R9U A;  4BV6 A;  1K0J A;  5BUK A;  3FG2 P;  4X4J A;  4A6N B;  4ZN0 A;  3GRT A;  2GV8 A;  2YQU A;  4U8P A;  1JNR A;  1COY A;  1PXB A;  1BWC A;  1XPQ A; 
#chains in the Genus database with same CATH topology
 3NK2 X;  1BGN A;  3CNS A;  3KPK A;  3V3N A;  3SZF A;  1IJH A;  1ZOY A;  2EQ9 A;  1OJC A;  2H89 A;  5KMS A;  4WX1 A;  1OJA A;  1ZDL A;  4G6G A;  4KPR A;  4ICY A;  4WCT A;  3CGC A;  2C4C A;  2X8G A;  5KXJ A;  1FL2 A;  3SY4 A;  2GEW A;  4EIP A;  1Y0P A;  2XLR A;  2OLN A;  2BAB A;  4U2T A;  4GDE A;  2YAU A;  2BXR A;  3G3E A;  4H4S A;  3EF6 A;  3QFA A;  2YLW A;  1REO A;  4ECH A;  2YR5 A;  1DJN A;  3VR8 A;  4YSX A;  1UKV G;  2XFP A;  4YJD A;  2YG3 A;  3UKF A;  3AE4 A;  4IV9 A;  3T14 A;  5JCM A;  5IPY A;  1P2E A;  2XFQ A;  2XYO A;  2ZZB A;  4U2S A;  2B9X A;  4E0V A;  4YJF B;  1P2H A;  4TM1 A;  3KVE A;  1VRQ B;  4K5R A;  5KVI A;  2IVD A;  4D04 A;  2GMJ A;  4U8L A;  5CQF A;  1D5T A;  2WU5 A;  3AE2 A;  1D4C A;  3SGL A;  4GUV A;  1QLB A;  2XLU A;  3LZX A;  5FS9 A;  4A9W A;  1D4D A;  4Z24 A;  4YJH B;  2YG5 A;  2E5V A;  4UP3 A;  3I3L A;  2JK6 A;  4FX9 A;  3ICT A;  3W4K A;  4U8M A;  3W4J A;  4B1B A;  4RSL A;  1H83 A;  2BK3 A;  3JSK A;  1DJQ A;  3HYW A;  4CCQ A;  4YTM A;  3UKQ A;  4USR A;  2BXS A;  1AN9 A;  2GAG B;  2GB0 A;  2JB3 A;  4EQX A;  1JRX A;  3QFB A;  1M6I A;  2HQM A;  2GR1 A;  5LV9 A;  3B6D A;  4A65 A;  1ZK7 A;  3C4A A;  3RHA A;  3GWD A;  5U63 A;  3GMC A;  3GSI A;  1GPE A;  2XDO A;  3BNU A;  3CMM A;  5BRT A;  4IA6 A;  4GR1 A;  2C67 A;  3AD8 B;  2VVM A;  3NGC X;  3KPF A;  4K8D A;  1DNC A;  3UKL A;  2F5Z A;  5M10 A;  1D7L A;  1E1K A;  5KOX A;  2Z5X A;  2VQ7 A;  3UKP A;  1PBD A;  3EAO A;  3AE7 A;  3V3O A;  3M13 A;  3DA1 A;  1E39 A;  4IVO B;  3LOV A;  1W4X A;  3LZW A;  4CY8 A;  5J60 A;  2YVJ A;  4BK3 A;  1GOS A;  5HXI A;  2FJB A;  3ATQ A;  1KIF A;  1O95 A;  1L0V A;  2XVF A;  1DXL A;  4C77 A;  1GAL A;  1LPF A;  3O0H A;  4NEV A;  2WU2 A;  3T0K A;  3NNE A;  1N4U A;  5HHF A;  5EBK A;  2GQW A;  2C65 A;  5FS7 A;  4JNA A;  4A5L A;  1NEK A;  3BHF A;  3BI5 A;  3UOV A;  2RGH A;  1CC2 A;  1E7P A;  2ARD A;  2Q6U A;  2BA9 A;  1BZL A;  2YWL A;  1GRB A;  5KVH A;  1E6E A;  1VG9 A;  3QJ4 A;  3DH9 A;  1C0K A;  2E4G A;  4AP3 A;  2E49 A;  2BYB A;  2WPE A;  3NK1 X;  2V3A A;  4APN A;  2OLO A;  4JN9 A;  3RP6 A;  4GDP A;  3AB1 A;  1XAN A;  1D7Y A;  1KDG A;  1KNR A;  3BI4 A;  4P9S A;  2R9Z A;  5U25 A;  1OJD A;  1Q9I A;  1TDF A;  1H84 A;  3NHO X;  2YLX A;  3L1R A;  2QA1 A;  5IQ1 A;  1IUX A;  1C0I A;  2J3N A;  4H4P A;  1HYU A;  1N1P A;  4AT0 A;  1NPX A;  1TDO A;  2CDU A;  3FBS A;  4OPL A;  4RG3 A;  1TDK A;  3D1C A;  3S5W A;  3DK8 A;  2Q7V A;  2EQ8 A;  4Z2T A;  1LTX R;  3CNP A;  2V6O A;  3LB8 A;  3CGB A;  3M0O A;  2XFO A;  3K7T A;  1TDN A;  1Y56 B;  3GYX A;  4Y4L A;  3FIM B;  5CKU A;  5ER0 A;  1NDA A;  2QAE A;  2YVG A;  2WDQ A;  3KKJ A;  4EIQ A;  3PO7 A;  3UOY A;  1KF6 A;  2B7R A;  4EM4 A;  3NIX A;  4EM3 A;  2A89 A;  1EL8 A;  1GTE A;  1SEZ A;  2CVJ A;  4CBQ A;  5KOW A;  1GET A;  1CF3 A;  1LQU A;  1E1L A;  1ZMD A;  3NH3 X;  4H2R A;  2X99 A;  3M12 A;  5GSN A;  5BVA A;  3LAD A;  5M0Z A;  5J7X A;  3F8R A;  4EMW A;  1PXC A;  1GRF A;  3AEE A;  1K0I A;  1TYP A;  2BK4 A;  1GRG A;  3ABV A;  4H4Z A;  1FEB A;  2WPF A;  3SX6 A;  2E1M A;  1F8R A;  2B9W A;  4H4Q A;  3QSM A;  2NVK X;  2IID A;  2DKI A;  4HB9 A;  4PAA A;  1JNZ A;  2RGJ A;  4FK1 C;  1QO8 A;  1NEN A;  3DJD A;  3CPJ G;  4ZCC A;  2C73 A;  2JKC A;  2OA1 A;  4JQ9 A;  1JRZ A;  3CNJ A;  2WBA A;  3II4 A;  4H2Q A;  4USQ A;  3AE6 A;  3SM8 A;  1L9C A;  5TR3 A;  3PS9 A;  4YSY A;  5U1O A;  3UKA A;  1EVI A;  2XVJ A;  4H7U A;  1LJ1 A;  1H6V A;  1F6M A;  1ZMC A;  4JDR A;  5FS8 A;  1PN0 A;  1VG0 A;  3LJP A;  1H86 A;  4IVM B;  1GND A;  1C0L A;  1BKW A;  3V76 A;  1AOG A;  1N4V A;  2XVH A;  3F8P A;  4HA6 A;  4O5Q A;  4I58 A;  1O94 A;  1YKJ A;  1PBE A;  4AP1 A;  3AE5 A;  1B8S A;  4C3X A;  3IHM A;  1EBD A;  1YQZ A;  4DSH A;  2FJA A;  3SQP A;  4J2W A;  3NYC A;  5FS6 A;  2C64 A;  4Y4M A;  1MOK A;  3SXI A;  3ZDN A;  4GF7 A;  2YM2 A;  3GYI A;  1FOH A;  3K30 A;  4AT2 A;  1IUS A;  4H4W A;  2JB2 A;  2C75 A;  2XVE A;  1FCD A;  2WOI A;  2WDR A;  2XLP A;  3F8D A;  2WPC A;  2YG6 A;  3B3R A;  4BJY A;  3VQR A;  4K7Z A;  2R0P A;  3P1W A;  2DU8 A;  1PJ7 A;  3NTA A;  2BS2 A;  1ZOV A;  3SZC A;  4UDQ A;  3H8I A;  3CIR A;  3VRD B;  4J31 A;  4YT0 A;  2UZZ A;  1E1N A;  3CN8 A;  2VRL A;  1ELI A;  3DK4 A;  3T37 A;  3GDP A;  1PDH A;  3ZNQ A;  1KFY A;  2C7G A;  4MJW A;  4U8N A;  4Z25 A;  1NG3 A;  3UTH A;  3T2K A;  3URH A;  1VDC A;  2EQ6 A;  4XWZ A;  2VQB A;  2H88 A;  3NT6 A;  3VRA A;  2R4E A;  2JBV A;  3EAN A;  3AYJ A;  3D8X A;  1ZKQ A;  3IHG A;  2WP6 A;  4C5O A;  3ATR A;  3G5R A;  3GMB A;  5C3J A;  1NHQ A;  1MXT A;  1PBF A;  4QFC A;  4EMJ A;  4AOX A;  4EQW A;  5JCL A;  3FMW A;  1B37 A;  3AE3 A;  2Q0L A;  2WHD A;  2WS3 A;  3UP5 A;  3WE0 A;  1H7X A;  4G73 A;  3NK0 X;  4H4R A;  1PHH A;  2RGO A;  1VQW A;  2AAQ A;  4G6H A;  4KX6 A;  3HYX A;  4U8I A;  1JU2 A;  2C3D A;  3T31 A;  2OAL A;  4B68 A;  1S2Y A;  5JCK A;  4OPT A;  4NNJ A;  1CHU A;  4H2P A;  3G5Q A;  1EL7 A;  2AR8 A;  1ZX9 A;  2VVL A;  2GH5 A;  2R0G A;  2TMD A;  4Y4N A;  2WOV A;  3SYI A;  2QA2 A;  1KSS A;  2V61 A;  4II3 A;  4NTC A;  3T2Z A;  2WEU A;  3H4K A;  3NYF A;  2Y6Q A;  4J33 A;  4LII A;  4A99 A;  2E82 A;  3QSS A;  2BK5 A;  2XFN A;  3BI2 A;  4II2 A;  2A8X A;  4GRT A;  3G5S A;  2C3C A;  1TYT A;  3AEC A;  4Z43 A;  1H7W A;  2E48 A;  3L8K A;  2QCU A;  2R46 A;  4U8O A;  1JEH A;  3RP7 A;  3FPZ A;  1O5W A;  5JCI A;  2TPR A;  2C66 A;  4IA5 A;  1NHP A;  2B7S A;  4YJG A;  3NG7 X;  1RSG A;  4H4T A;  4GAV A;  1JOA A;  3UTF A;  2V60 A;  4H4U A;  1PJ5 A;  4B66 A;  4B63 A;  1DOE A;  4CRT A;  1FEC A;  3CPH G;  3UTG A;  4NTE A;  3DJE A;  2FBW A;  3QSE A;  4BK1 A;  1E1M A;  4H4V A;  5DBJ A;  2CFY A;  2WOW A;  4DSG A;  3AE9 A;  3AE8 A;  3NN0 X;  2GR2 A;  3IWA A;  3KA7 A;  3GYJ A;  2GMH A;  1TDE A;  4G9K A;  4A7A A;  2PYX A;  3ITJ A;  3P4R A;  4YWO A;  2BS3 A;  3CNT A;  2YR4 A;  4BUR A;  1GRA A;  3AXB A;  3AYI A;  3ALJ A;  4QFD A;  1XHC A;  3ALM A;  2APG A;  1KSU A;  1DOD A;  3KLJ A;  2VZ2 A;  4YSH A;  4OPC A;  4REK A;  2YG4 A;  1F8W A;  1S2Q A;  2YM1 A;  4H4Y A;  4Z2R A;  3BHK A;  5HYM A;  3W4I A;  5L46 A;  1NHR A;  3H8L A;  4JNQ A;  3VRB A;  1ZY8 A;  3AEF A;  1CL0 A;  1YQ4 A;  4X9M A;  2B76 A;  2AQJ A;  3AED A;  2GAH B;  1PJ6 A;  3AD7 B;  1OJT A;  3AE1 A;  1Q1R A;  3DGH A;  3DK9 A;  4LA1 A;  4A6N A;  2Y6R A;  1BGJ A;  2DKH A;  2VVL G;  2YLT A;  3DGZ A;  1PS9 A;  3GDN A;  1DAO A;  5KMR A;  1GER A;  3AEB A;  4CNJ A;  1CBO A;  3NN6 X;  1H81 A;  3UCL A;  3AD9 B;  4J34 A;  1XDI A;  4K22 A;  2PHH A;  3AYL A;  3CPI G;  4OPI A;  1BF3 A;  1X31 B;  3COX A;  1C0P A;  4NTD A;  3ZNP A;  4XXG A;  2X8H A;  4B69 A;  2YG7 A;  3OC4 A;  1DOC A;  3P9U A;  1L9D A;  2YLS A;  4FK1 A;  2ZZC A;  4TLX A;  3SZ0 A;  3UOZ A;  1CJ3 A;  3GD4 A;  4JY2 A;  1RP0 A;  3E1T A;  2YVF A;  5EB5 A;  5EOW A;  1RYI A;  5BUL A;  3SFD A;  3RP8 A;  3HYV A;  5KMQ A;  4CCR A;  2XFU A;  2XLS A;  5IQ4 A;  3VR9 A;  2BCG G;  3IF9 A;  2X3N A;  1IUU A;  3NTD A;  1ZP0 A;  2GR0 A;  3NRN A;  3ZYX A;  3QVR A;  4CY6 A;  1IUT A;  2CUL A;  3UOX A;  3CUK A;  3PVC A;  4U2L A;  4ADW A;  1VE9 A;  2R4J A;  4YJF A;  2VOU A;  4DGK A;  1DOB A;  1PXA A;  4GCM A;  4OPG A;  4RG4 A;  3AWI A;  5C2T A;  2YR6 A;  5JCN A;  1NAA A;  3AEA A;  3ZNN A;  1B5Q A;  2ZZ0 A;  3UKH A;  3SZW A;  5KNL A;  4YKF A;  1S3B A;  4YJH A;  3SFE A;  3KD9 A;  2YLZ A;  3DME A;  3LXD A;  4N9X A;  4B64 A;  4XWR A;  4NZH A;  4YTN A;  3P4P A;  4TM3 A;  2X8C A;  3QVP A;  1CC4 A;  4PAB A;  3K7Q X;  3OZ2 A;  3DJJ A;  4EMI A;  3UKK A;  4X9N A;  3UTE A;  2YLR A;  3Q6J A;  1MO9 A;  4C3Y A;  1YQ3 A;  4D03 A;  4K2X A;  4C74 A;  4YTP A;  4Z26 A;  3NLC A;  1EL5 A;  4NWZ A;  2WET A;  3ICS A;  4OPU A;  1QJD A;  1Z6L A;  1JRY A;  4BJZ A;  1F8S A;  1GTH A;  2JB1 A;  4TM4 A;  2WQY A;  2Q0K A;  3K7M X;  4NEW A;  1GT8 A;  1GES A;  3CND A;  1TRB A;  3CTY A;  2R0C A;  2I0Z A;  2FJE A;  2OAM A;  2BCP A;  2X50 A;  4YXD A;  3HZL A;  1LVL A;  2B9Y A;  3IC9 A;  4H50 A;  4A79 A;  1KNP A;  2W0H A;  2GQF A;  1IUW A;  2XLT A;  1GSN A;  2GF3 A;  4J56 A;  1CC6 A;  2FJD A;  2BAC A;  2IVE A;  4J57 A;  2NPX A;  4OCG A;  1F3P A;  1GXF A;  1DDO A;  2C76 A;  2BS4 A;  2ACZ A;  4B65 A;  2BRA A;  1CJ2 A;  3ADA B;  1FEA A;  2GR3 A;  4B67 A;  2C72 A;  1CJC A;  1M64 A;  1PBB A;  2BRY A;  4DNA A;  4EQR A;  2GRT A;  3RNM A;  1LQT A;  1L9E A;  4BK2 A;  3S61 A;  4EQS A;  3ISH A;  3I6D A;  4FDC B;  2RAB A;  2EQ7 A;  3T2Y A;  5EB4 A;  4O5U A;  1ONF A;  3ALL A;  1K4Q A;  3KU9 A;  4LU6 A;  1IUV A;  1OJ9 A;  4AOS A;  4YJG B;  2ZBW A;  3DJG X;  3GWF A;  3P4Q A;  4JY3 A;  4OVI A;  5KWF A;  2VRM A;  2E4A A;  2A87 A;  2WP5 A;  1EL9 A;  3AEG A;  1GV4 A;  1GRH A;  4TM0 A;  4OPD A;  4H2N A;  3CGD A;  2O9Z A;  3P4S A;  1LV0 A;  1N4W A;  2BC0 A;  2BC1 A;  3GD3 A;  2JAE A;  1GRT A;  1GEU A;  2XCG A;  2V5Z A;  3C96 A;  3NKS A;  3UP4 A;  2Z5Y A;  5HY5 A;  4Z44 A;  5KRQ A;  3Q9T A;  1Q1W A;  1CJ4 A;  2C70 A;  2WP9 A;  1V59 A;  4Z2U A;  3CGE A;  3C4N A;  4J36 A;  2WDV A;  1H82 A;  5KMP A;  3BNM A;  4U8J A;  3ZNO A;  3GRS A;  4I59 A;  5FMH A;  2V3B A;  3EPT A;  4GAP A;  1NHS A;  3ICR A;  4CNK A;  4YSZ A;  1D4E A;  4H4X A;  4G74 A;  4K5S A;  4UDR A;  1B4V A;  4ZCD A;  2WES A;  4TLZ A;  4YKG A;  1Y56 A;  5GRT A;  3RED A;  3NYE A;  1GRE A;  4U8K A;  2XVI A;  1PBC A;  1NG4 A;  2R45 A;  1S3E A;  4M52 A;  1K0L A;  2GVC A;  1YY5 A;  4UDP A;  3R9U A;  4BV6 A;  1K0J A;  5BUK A;  3FG2 P;  4X4J A;  4A6N B;  3WGT A;  4ZN0 A;  3GRT A;  2GV8 A;  2YQU A;  4U8P A;  1JNR A;  1COY A;  1PXB A;  1BWC A;  1XPQ A; 
#chains in the Genus database with same CATH homology
 3NK2 X;  1BGN A;  3CNS A;  3KPK A;  3V3N A;  3SZF A;  1IJH A;  1ZOY A;  2EQ9 A;  1OJC A;  2H89 A;  5KMS A;  4WX1 A;  1OJA A;  1ZDL A;  4G6G A;  4KPR A;  4ICY A;  4WCT A;  3CGC A;  2C4C A;  2X8G A;  5KXJ A;  1FL2 A;  3SY4 A;  2GEW A;  4EIP A;  1Y0P A;  2XLR A;  2OLN A;  2BAB A;  4U2T A;  4GDE A;  2YAU A;  2BXR A;  4H4S A;  3EF6 A;  3QFA A;  2YLW A;  1REO A;  4ECH A;  2YR5 A;  1DJN A;  3VR8 A;  4YSX A;  1UKV G;  2XFP A;  2YG3 A;  3UKF A;  3AE4 A;  4IV9 A;  3T14 A;  5JCM A;  5IPY A;  1P2E A;  2XFQ A;  2XYO A;  2ZZB A;  4U2S A;  2B9X A;  4E0V A;  1P2H A;  4TM1 A;  3KVE A;  1VRQ B;  4K5R A;  5KVI A;  2IVD A;  4D04 A;  2GMJ A;  4U8L A;  5CQF A;  1D5T A;  2WU5 A;  3AE2 A;  1D4C A;  4GUV A;  3SGL A;  1QLB A;  2XLU A;  3LZX A;  5FS9 A;  4A9W A;  1D4D A;  4Z24 A;  2YG5 A;  2E5V A;  4UP3 A;  3I3L A;  2JK6 A;  4FX9 A;  3ICT A;  4U8M A;  4B1B A;  1H83 A;  2BK3 A;  3JSK A;  4RSL A;  1DJQ A;  3HYW A;  4CCQ A;  4YTM A;  3UKQ A;  4USR A;  2BXS A;  2GAG B;  2GB0 A;  2JB3 A;  4EQX A;  1JRX A;  3QFB A;  1M6I A;  2HQM A;  2GR1 A;  5LV9 A;  3B6D A;  4A65 A;  1ZK7 A;  3C4A A;  3RHA A;  3GWD A;  5U63 A;  3GMC A;  1GPE A;  3GSI A;  2XDO A;  3BNU A;  3CMM A;  5BRT A;  4IA6 A;  4GR1 A;  2C67 A;  3AD8 B;  2VVM A;  3NGC X;  3KPF A;  4K8D A;  1DNC A;  3UKL A;  2F5Z A;  5M10 A;  1D7L A;  1E1K A;  5KOX A;  2Z5X A;  2VQ7 A;  3UKP A;  1PBD A;  3EAO A;  3AE7 A;  3V3O A;  1E39 A;  3DA1 A;  3M13 A;  4IVO B;  3LOV A;  1W4X A;  3LZW A;  4CY8 A;  5J60 A;  2YVJ A;  4BK3 A;  1GOS A;  5HXI A;  2FJB A;  3ATQ A;  1O95 A;  1L0V A;  2XVF A;  1DXL A;  4C77 A;  1GAL A;  1LPF A;  3O0H A;  4NEV A;  2WU2 A;  3T0K A;  3NNE A;  1N4U A;  5HHF A;  5EBK A;  2GQW A;  2C65 A;  5FS7 A;  4JNA A;  4A5L A;  1NEK A;  3BHF A;  3BI5 A;  3UOV A;  2RGH A;  1CC2 A;  1E7P A;  2ARD A;  2Q6U A;  2BA9 A;  1BZL A;  2YWL A;  1GRB A;  5KVH A;  1E6E A;  1VG9 A;  3QJ4 A;  3DH9 A;  2E4G A;  4AP3 A;  2BYB A;  2WPE A;  3NK1 X;  2V3A A;  4APN A;  2OLO A;  4JN9 A;  3RP6 A;  4GDP A;  3AB1 A;  1XAN A;  1D7Y A;  1KDG A;  1KNR A;  3BI4 A;  4P9S A;  2R9Z A;  5U25 A;  1OJD A;  1Q9I A;  1TDF A;  1H84 A;  3NHO X;  2YLX A;  3L1R A;  2QA1 A;  5IQ1 A;  1IUX A;  2J3N A;  4H4P A;  1HYU A;  1N1P A;  4AT0 A;  1NPX A;  1TDO A;  2CDU A;  3FBS A;  4OPL A;  4RG3 A;  1TDK A;  3D1C A;  3S5W A;  3DK8 A;  2Q7V A;  2EQ8 A;  4Z2T A;  1LTX R;  3CNP A;  2V6O A;  3LB8 A;  3CGB A;  3M0O A;  2XFO A;  3K7T A;  1TDN A;  1Y56 B;  3GYX A;  4Y4L A;  3FIM B;  5CKU A;  5ER0 A;  1NDA A;  2QAE A;  2YVG A;  2WDQ A;  3KKJ A;  4EIQ A;  3PO7 A;  3UOY A;  1KF6 A;  2B7R A;  4EM4 A;  3NIX A;  4EM3 A;  2A89 A;  1EL8 A;  1GTE A;  1SEZ A;  2CVJ A;  4CBQ A;  5KOW A;  1GET A;  1CF3 A;  1LQU A;  1E1L A;  1ZMD A;  3NH3 X;  4H2R A;  2X99 A;  3M12 A;  5GSN A;  5BVA A;  3LAD A;  5M0Z A;  5J7X A;  3F8R A;  4EMW A;  1GRF A;  1PXC A;  3AEE A;  1K0I A;  1TYP A;  2BK4 A;  1GRG A;  3ABV A;  4H4Z A;  1FEB A;  2WPF A;  3SX6 A;  2E1M A;  1F8R A;  2B9W A;  4H4Q A;  3QSM A;  2NVK X;  2IID A;  2DKI A;  4HB9 A;  4PAA A;  1JNZ A;  2RGJ A;  4FK1 C;  1QO8 A;  1NEN A;  3CPJ G;  3DJD A;  4ZCC A;  2C73 A;  2JKC A;  2OA1 A;  4JQ9 A;  1JRZ A;  3CNJ A;  2WBA A;  3II4 A;  4H2Q A;  4USQ A;  3AE6 A;  3SM8 A;  1L9C A;  5TR3 A;  3PS9 A;  4YSY A;  5U1O A;  3UKA A;  2XVJ A;  4H7U A;  1LJ1 A;  1H6V A;  1F6M A;  1ZMC A;  4JDR A;  5FS8 A;  1PN0 A;  1VG0 A;  3LJP A;  1H86 A;  4IVM B;  1GND A;  1BKW A;  3V76 A;  1AOG A;  1N4V A;  2XVH A;  3F8P A;  4HA6 A;  4O5Q A;  4I58 A;  1O94 A;  1YKJ A;  1PBE A;  4AP1 A;  3AE5 A;  1B8S A;  4C3X A;  3IHM A;  1EBD A;  1YQZ A;  4DSH A;  2FJA A;  3SQP A;  4J2W A;  3NYC A;  5FS6 A;  2C64 A;  4Y4M A;  1MOK A;  3SXI A;  3ZDN A;  4GF7 A;  2YM2 A;  3GYI A;  1FOH A;  3K30 A;  4AT2 A;  1IUS A;  4H4W A;  2JB2 A;  2C75 A;  2XVE A;  1FCD A;  2WOI A;  2WDR A;  2XLP A;  3F8D A;  2WPC A;  2YG6 A;  3B3R A;  4BJY A;  4K7Z A;  3VQR A;  2R0P A;  3P1W A;  3NTA A;  1PJ7 A;  2BS2 A;  1ZOV A;  3SZC A;  4UDQ A;  3H8I A;  3CIR A;  3VRD B;  4J31 A;  4YT0 A;  1E1N A;  2UZZ A;  3CN8 A;  2VRL A;  1ELI A;  3DK4 A;  3T37 A;  3GDP A;  1PDH A;  1KFY A;  2C7G A;  4MJW A;  4U8N A;  4Z25 A;  1NG3 A;  3UTH A;  3T2K A;  3URH A;  1VDC A;  2EQ6 A;  2VQB A;  4XWZ A;  2H88 A;  3NT6 A;  3VRA A;  2R4E A;  2JBV A;  3EAN A;  3AYJ A;  3D8X A;  1ZKQ A;  3IHG A;  2WP6 A;  4C5O A;  3ATR A;  3G5R A;  3GMB A;  5C3J A;  1NHQ A;  1MXT A;  1PBF A;  4EMJ A;  4AOX A;  4EQW A;  5JCL A;  3FMW A;  1B37 A;  3AE3 A;  2Q0L A;  2WHD A;  2WS3 A;  3UP5 A;  3WE0 A;  1H7X A;  4G73 A;  3NK0 X;  4H4R A;  1PHH A;  1VQW A;  2AAQ A;  2RGO A;  4G6H A;  4KX6 A;  3HYX A;  4U8I A;  1JU2 A;  2C3D A;  3T31 A;  2OAL A;  4B68 A;  1S2Y A;  5JCK A;  4OPT A;  4NNJ A;  1CHU A;  4H2P A;  3G5Q A;  1EL7 A;  2AR8 A;  1ZX9 A;  2VVL A;  2GH5 A;  2R0G A;  2TMD A;  4Y4N A;  2WOV A;  3SYI A;  2QA2 A;  1KSS A;  2V61 A;  4II3 A;  4NTC A;  3T2Z A;  2WEU A;  3H4K A;  3NYF A;  2Y6Q A;  4J33 A;  4LII A;  4A99 A;  4II2 A;  2BK5 A;  2XFN A;  3QSS A;  3BI2 A;  2A8X A;  4GRT A;  3G5S A;  2C3C A;  1TYT A;  3AEC A;  4Z43 A;  1H7W A;  3L8K A;  2QCU A;  2R46 A;  4U8O A;  1JEH A;  3RP7 A;  3FPZ A;  1O5W A;  5JCI A;  2TPR A;  2C66 A;  4IA5 A;  1NHP A;  2B7S A;  3NG7 X;  1RSG A;  4H4T A;  4GAV A;  1JOA A;  3UTF A;  2V60 A;  4H4U A;  1PJ5 A;  4B66 A;  4B63 A;  1DOE A;  4CRT A;  1FEC A;  3CPH G;  3UTG A;  4NTE A;  2FBW A;  3DJE A;  3QSE A;  4BK1 A;  1E1M A;  4H4V A;  5DBJ A;  2CFY A;  2WOW A;  4DSG A;  3AE9 A;  3AE8 A;  3NN0 X;  2GR2 A;  3IWA A;  3KA7 A;  3GYJ A;  2GMH A;  1TDE A;  4G9K A;  4A7A A;  2PYX A;  3ITJ A;  3P4R A;  4YWO A;  2BS3 A;  3CNT A;  2YR4 A;  4BUR A;  1GRA A;  3AXB A;  3AYI A;  3ALJ A;  2APG A;  1XHC A;  3ALM A;  4OPC A;  1KSU A;  1DOD A;  3KLJ A;  2VZ2 A;  4YSH A;  4REK A;  2YG4 A;  1F8W A;  1S2Q A;  2YM1 A;  4H4Y A;  4Z2R A;  3BHK A;  5HYM A;  5L46 A;  1NHR A;  3H8L A;  4JNQ A;  3VRB A;  1ZY8 A;  3AEF A;  1CL0 A;  1YQ4 A;  4X9M A;  2B76 A;  2AQJ A;  3AED A;  2GAH B;  1PJ6 A;  3AD7 B;  1OJT A;  3AE1 A;  1Q1R A;  3DGH A;  3DK9 A;  4LA1 A;  4A6N A;  2Y6R A;  2DKH A;  1BGJ A;  2VVL G;  2YLT A;  3DGZ A;  1PS9 A;  3GDN A;  5KMR A;  1GER A;  3AEB A;  4CNJ A;  1CBO A;  3NN6 X;  1H81 A;  3UCL A;  3AD9 B;  4J34 A;  1XDI A;  4K22 A;  2PHH A;  3AYL A;  3CPI G;  4OPI A;  1BF3 A;  1X31 B;  3COX A;  4XXG A;  4NTD A;  2X8H A;  4B69 A;  2YG7 A;  3OC4 A;  1DOC A;  3P9U A;  1L9D A;  2YLS A;  4FK1 A;  2ZZC A;  4TLX A;  3SZ0 A;  3UOZ A;  1CJ3 A;  3GD4 A;  4JY2 A;  1RP0 A;  3E1T A;  2YVF A;  5EB5 A;  5EOW A;  1RYI A;  5BUL A;  3SFD A;  3RP8 A;  3HYV A;  5KMQ A;  4CCR A;  2XFU A;  2XLS A;  5IQ4 A;  3VR9 A;  2BCG G;  3IF9 A;  2X3N A;  1IUU A;  3NTD A;  1ZP0 A;  2GR0 A;  3NRN A;  3ZYX A;  3QVR A;  4CY6 A;  1IUT A;  2CUL A;  3UOX A;  3PVC A;  4U2L A;  4ADW A;  2R4J A;  4DGK A;  2VOU A;  1DOB A;  1PXA A;  4GCM A;  4OPG A;  4RG4 A;  3AWI A;  5C2T A;  2YR6 A;  5JCN A;  1NAA A;  3AEA A;  1B5Q A;  2ZZ0 A;  3UKH A;  3SZW A;  5KNL A;  4YKF A;  1S3B A;  3SFE A;  3KD9 A;  2YLZ A;  3DME A;  3LXD A;  4N9X A;  4B64 A;  4XWR A;  4NZH A;  4YTN A;  3P4P A;  4TM3 A;  2X8C A;  3QVP A;  1CC4 A;  4PAB A;  3K7Q X;  3DJJ A;  3OZ2 A;  4EMI A;  3UKK A;  4X9N A;  3UTE A;  2YLR A;  3Q6J A;  1MO9 A;  4C3Y A;  1YQ3 A;  4D03 A;  4K2X A;  4C74 A;  4YTP A;  4Z26 A;  3NLC A;  1EL5 A;  4NWZ A;  2WET A;  3ICS A;  4OPU A;  1QJD A;  1Z6L A;  1JRY A;  4BJZ A;  1F8S A;  1GTH A;  2JB1 A;  4TM4 A;  2WQY A;  2Q0K A;  3K7M X;  4NEW A;  1GT8 A;  1GES A;  3CND A;  1TRB A;  3CTY A;  2R0C A;  2I0Z A;  2FJE A;  2OAM A;  2BCP A;  2X50 A;  4YXD A;  3HZL A;  1LVL A;  2B9Y A;  3IC9 A;  4H50 A;  4A79 A;  1KNP A;  2W0H A;  2GQF A;  1IUW A;  2XLT A;  1GSN A;  2GF3 A;  4J56 A;  1CC6 A;  2FJD A;  2BAC A;  2IVE A;  4J57 A;  2NPX A;  4OCG A;  1F3P A;  1GXF A;  2C76 A;  2BS4 A;  2ACZ A;  4B65 A;  2BRA A;  1CJ2 A;  1FEA A;  2GR3 A;  3ADA B;  4B67 A;  2C72 A;  1CJC A;  1M64 A;  1PBB A;  2BRY A;  4DNA A;  4EQR A;  2GRT A;  3RNM A;  1LQT A;  1L9E A;  4BK2 A;  3S61 A;  4EQS A;  3ISH A;  3I6D A;  4FDC B;  2RAB A;  2EQ7 A;  3T2Y A;  5EB4 A;  4O5U A;  1ONF A;  3ALL A;  1K4Q A;  3KU9 A;  4LU6 A;  1IUV A;  1OJ9 A;  4AOS A;  4OVI A;  2ZBW A;  3DJG X;  3GWF A;  3P4Q A;  4JY3 A;  5KWF A;  2VRM A;  2A87 A;  2WP5 A;  1EL9 A;  3AEG A;  1GV4 A;  1GRH A;  4TM0 A;  4OPD A;  4H2N A;  3CGD A;  2O9Z A;  3P4S A;  1LV0 A;  1N4W A;  2BC0 A;  2BC1 A;  3GD3 A;  2JAE A;  1GRT A;  1GEU A;  2XCG A;  2V5Z A;  3C96 A;  3NKS A;  3UP4 A;  2Z5Y A;  5HY5 A;  4Z44 A;  5KRQ A;  3Q9T A;  1Q1W A;  1CJ4 A;  2C70 A;  2WP9 A;  1V59 A;  4Z2U A;  3CGE A;  3C4N A;  4J36 A;  2WDV A;  1H82 A;  5KMP A;  3BNM A;  4U8J A;  4I59 A;  3GRS A;  5FMH A;  2V3B A;  3EPT A;  4GAP A;  1NHS A;  3ICR A;  4CNK A;  4YSZ A;  1D4E A;  4H4X A;  4G74 A;  4K5S A;  4UDR A;  1B4V A;  4ZCD A;  2WES A;  4TLZ A;  4YKG A;  1Y56 A;  5GRT A;  3RED A;  3NYE A;  1GRE A;  4U8K A;  2XVI A;  1PBC A;  1NG4 A;  1S3E A;  2R45 A;  4M52 A;  1K0L A;  2GVC A;  1YY5 A;  4UDP A;  3R9U A;  4BV6 A;  1K0J A;  5BUK A;  3FG2 P;  4X4J A;  4A6N B;  4ZN0 A;  3GRT A;  2GV8 A;  2YQU A;  4U8P A;  1JNR A;  1COY A;  1PXB A;  1BWC A;  1XPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...