3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
2R92I 2DE7A 3GTKI 3GTMI 2AKLA 2NVXI 2JR6A 3HOXI 1Y1VI 4A3FI 4NBAA 1ML8A 1TWAI 1L1OC 3K7AI 3U50C 5IP9I 2P3YA 4Y52I 4QTTA 3S1NI 3GTGI 1TFIA 3HOYI 3S16I 4NBHA 1I3QI 4NBBA 3M3YI 4A3LI 1Y1VS 2DE5A 3S2DI 1TWHI 3GTMS 2DMEA 3I07A 1SFOI 4BY7I 3LUSA 3S14I 5C4XI 4A93I 4BXXI 4NBGA 1N2FA 2F4MA 4NB9A 2R93I 1PFTA 3RZOI 4BBRI 1X3WA 4A3II 1WW9A 2JNYA 4BY1I 3CQZI 1QYPA 2JS4A 4QTUA 1K83I 3I4NI 3GTLI 3I4MI 3VMGA 4A3EI 3PO3I 4NOZA 4A3BI 3PO2I 3GCFA 2VUMI 1I50I 4NBCA 3VMIA 2KPIA 2JA7I 2PK7A 3VB9A 3RZDI 2JA5I 1TWGI 3Q87A 3GKQA 3S1MI 2NVYI 1ZB8A 2JA6I 3ESWA 4NBFA 2B63I 3FKII 4A3CI 4A3GI 4X6AI 1RO4A 1RLYA 3S1QI 1TWCI 3GTJI 3S1RI 1X3ZA 4NBEA 4Y7NI 1NUIA 2YU9I 2DE6A 5C44I 2E2HI 4NB8A 2RBLA 1I6HI 5CM2M 1ZB9A 1ENWA 4NBDA 2NVQI 3HOUI 1WCMI 4BXXX 3VMHA 4A3JI 3S17I 3HOZI 1LQLA 3H0GI 3NDQA 1YUAA 2NVTI 4A3DI 2JA8I 3D6WA 2E2JI 4BY1X 1Y1WI 2E2II 2R7ZI 2K5RA 4BBSI 2BJOA 3EERA 5IP7I 2F4OA 3H3VJ 4BY7X 4XX2A 1R9TI 1DL6A 1VLAA 1USPA 2HF1A 2J6AA 3HOWI 3M4OI 3S2HI 4A3MI 3S15I 3PO3S 5C3EI 4MH4A 1USPB 5FLMI 2LW4A 3GTOI 3HOVI 5C4JI 3GTQI 3GTPI 1TWFI 4A3KI
chains in the Genus database with same CATH superfamily
2W9FA 4EOLB 1Y8CA 1VQ61 1YJW1 4F7SB 1AISB 1H1QB 5IDNB 1FDOA 3NDIA 3HOXI 1YIJ1 1KD12 3BLHB 3HO8A 2ZPHB 3BHTB 3DDPB 1ML8A 1TWAI 2I3CA 1JSUB 3FQQA 1M902 3U50C 1OIUB 1H4LD 5IDPB 1RQFA 2P3YA 1P9NA 2QR1B 3WVEB 3CD6Z 4CFVB 1QVGY 1K9M2 3GTGI 2IN3A 1TD6A 3O0GD 3CCJZ 3HOYI 4YOOA 1JJ2Z 2QKDA 3CCUZ 4KRCB 3CC4Z 4A3LI 3S2DI 4BY7I 3LUSA 2QRCB 4BCGB 5D1OA 4NB9A 1H27B 1QLBA 3G33B 2WPAB 4BY1I 2Q4ZA 1WW9A 1M1K2 4OR5B 1N8R2 2DPPB 3X28B 3I4MI 5D1OB 1OL2B 4CFMB 4EOMB 2KI7B 3PO3I 3GCFA 1I50I 4BCHB 1PKDB 5LL6f 4ELJA 2G2KA 2VPYA 4E32A 3QYHB 3M03A 4BCJB 4JX6A 1NJI1 2D0QB 1S72Z 2LFUA 1O9KA 2PM9A 3IR7A 4JX4A 1UGQB 4OB1B 3G71Z 1VQ41 3ESWA 3QHWB 4F7NB 5T67A 3FKII 1H28B 4X6AI 5DQWA 4DK1A 1VQL1 2DD5B 4AKGA 1VQ51 3TW6A 3EJ1B 2ZZDB 3VKGA 1TWCI 3S1QI 3G711 3S1RI 1X3ZA 3QHRB 1FINB 1QXFA 1FVVB 2PK2A 1UNGD 3EIDB 4II5B 2RT9A 1K732 1RO2A 1NUIA 3I56Z 5I5ZB 1OI9B 4YC3B 4YOSA 4G6LB 5AN9F 1Q821 1M901 1Q812 2EGTA 3CCU1 4IMYB 2DXCB 1ENWA 3CCV1 2C5NB 3HKZA 1YJ91 1FDIA 3I561 2NVQI 3HOUI 2PK9B 3QWLA 3B57A 5FLXf 2WIPB 1Q861 1YIT1 1XO2A 1YUAA 3CCLZ 1W98B 3CCSZ 5HVYB 5D1PA 4BBSI 3QZ5B 3QYEA 2F4OA 1YUKA 4XX2A 1DL6A 2JIRA 2HF1A 2UZBB 2UZLB 2AHJB 2OOYB 5IHYA 1VINA 2W9ZA 3QYBA 2C6TB 3CMAZ 4MRIA 3NH5A 4EOKB 1GH6B 5FGKB 3QXEB 1TWFI 2V45A 1Q811 3IFUA 2CZ6B 2ZPGB 4BCNB 2VF1A 2V22B 3JAMb 2IZ3A 4BCMD 4Y72B 4ROEA 2M6NA 3J81b 1KC82 1N8R1 4BCIB 2NVXI 1UGPB 1Y1VI 2UZDB 3MZLB 2QEX1 1W2BZ 3MZKB 4HGZA 3K7AI 5IP9I 1VQO1 5IT9b 1VQ8Z 1VQN1 1YJN1 3S1NI 2DXBB 2W03A 1TFIA 2WIHB 1V29B 4F6UB 1UGSB 3S16I 3KIFA 4RVHA 1JKWA 2QQ8A 2BKZB 2ZPBB 4NBBA 2RPRA 1Y1VS 2UZEB 2DE5A 2WB1A 4F6WB 3DOGB 2DMEA 1URCB 3QYGB 1YI21 4A93I 3HBLA 4S1TA 4BCPB 1AD6A 1SIWA 1PFTA 4BCFB 2X1NB 3RZOI 5EFQB 2QA4Z 2W2HA 1Q862 2QDYB 1VQKZ 4ROCA 4QTUA 1K83I 3I4NI 1TFBA 3BG5A 3GTLI 4EOSB 4NOZA 3BHVB 3CCR1 2VUMI 2CZ7B 4NBCA 3VMIA 3CC71 1VQ4Z 3QZ9B 2JA7I 5LMKB 2I40B 1UGRB 2R7GA 2JA5I 1OGUB 2VPWA 1VQ9Z 3Q87A 3S1MI 1JWHC 1K8A2 3TW7A 4JX5A 1ZB8A 4BCND 2GTIA 2RHBA 2PHGA 3MIAB 2B63I 1KQSZ 2QEXZ 3CC21 4BCKB 4BCOB 1WZNA 1RLYA 2LIYA 2UUEB 4EC9B 3CXCY 4A3KI 2IVXA 1OKVB 4NBEA 1E7PA 4HNVA 3CCE1 4HGYA 4RV9A 2CZ1B 3KHIA 4F7LB 4MXUA 1OIYB 5C44I 3HB9A 1VQ81 2E2HI 1VQNZ 4RVFA 5FLXb 4KRDB 2WMAB 4HNUA 2YADA 3CCEZ 2OTLZ 2KR6A 4ELLA 2C5OB 4NBDA 2WEVB 4EOJB 4A3JI 4EONB 1VQPZ 1Z03A 3H0GI 3IF8A 3NDQA 3WVDB 4MONA 4E33A 4RODA 2JA8I 4BBRM 4OB0B 4BCMB 3LQ5B 2QLVB 1WJ2A 4BY7X 2LEXA 2JIQA 1QVFZ 1USPA 2G77A 4OB3B 1X0TA 4A3MI 3PO3S 3BLQB 3D9XA 3VYGB 3BG9A 1C9BA 3GTOI 3HOVI 3BLRB 5C4JI 3GTQI 3X20B 3GTPI 3KIHA 4E31A 3F3PC 2EUFA 3K7AM 3A8HB 3GTKI 2CZ0B 3GTMI 4HNTA 1FKMA 3HZJA 5HQ0B 5BNJB 2VUGA 1H25B 4NBAA 1VQ6Z 1L1OC 1OL1B 3CPWY 4AI6A 5LQFB 2C4GB 1KXUA 4HLQA 2OTJZ 1KQSY 1WIIA 2P28A 3CCVZ 5IF1B 1E9HB 1K731 4QSHA 3EEDA 3DJBA 1IREB 1QVFY 5T64A 1P5EB 4AKIA 1KC81 2V3VA 1VQP1 4CXAB 5ICPB 3HHTB 1Z02A 3GTMS 3CCMZ 1SFOI 2JUBA 1GUXB 4ZGJB 5CEIB 1G3NC 2JMOA 2IW9B 5HBJB 1N2FA 3CCRZ 2R93I 3TNIB 1QVGZ 4HL4A 2QRDB 4E30A 1X3WA 2VPXA 3CCM1 2JNYA 4A3II 1GUXA 2H85A 3CQZI 1H1RB 1Q7Y2 4NC6A 5HBHB 1Q16A 1RO0A 3VMGA 3H4CA 1VQMZ 1ZP2A 2HU9A 1H1PB 4CL1A 2PK7A 3BG1B 3TN8B 4HH4A 1H1SB 3FQMA 4MIMA 4EORB 2CCHB 3GKQA 2Y0SA 1YHQZ 2NVYI 4E2WA 4NBFA 1KD11 1YIJZ 4A3GI 5HNBB 4M6VA 1RO4A 3MI9B 3VYHB 1YJWZ 2WJ9A 1VQOZ 2GU2A 2BS3A 3CD61 1JSTB 4MD8A 4Y7NI 5A2Qf 1NJI2 2V8JA 3X25B 3CC2Z 4F7JB 2E7ZA 1VQLZ 2JIMA 2QF7A 2DE6A 4NSTB 2RBLA 1I6HI 2ZAEB 1ZB9A 1YITZ 3A8GB 3TE5B 3D2LA 2DD4B 2QREB 3IX0A 2B9RA 3VMHA 1OKWB 3HOZI 1LQLA 5ACBA 3NH8A 3A8LB 4MD9A 3J7A4 4E2ZA 3D6WA 1Y1WI 3MY5B 2K5RA 1Q822 3EERA 2C5XB 1VQ71 3G4SZ 3H3VJ 4ZGDB 2RIQA 1VLAA 3CCL1 2J6AA 4RVDA 3HOWI 3S2HI 3S15I 2JIPA 4FM4B 3J81f 3TNWB 1JJ2Y 4MH4A 4E2YA 2W96A 2LW4A 4CFUB 2I53A 5FLMI 4NH1C 4NFRA 3TDHB 2WAQA 4UN0A 2W04A 4CFXB 2IW6B 4OB2B 3I55Z 3A8OB 2W99A 4TTHA 2R92I 1RNIA 2DE7A 1YJNZ 3BG3A 2AKLA 4AKHA 2JR6A 2OOXB 1Q7Y1 4A3FI 3CMA1 1K9M1 4E2XA 2V8KA 4LOCA 3CCJ1 2AYDA 3I551 3X26B 1F5QB 4OGRB 3T4NB 3NFZA 4Y52I 5CYIB 5L2WB 4YOZA 3QWUA 4QTTA 2M48A 2Q51A 2PMIB 4MD7A 1YI2Z 4I3ZB 4DGLA 2WHBB 4NBHA 3BHUB 1I3QI 3M3YI 1TWHI 2CCIB 2QFZA 4EOPB 3I07A 3RGFB 5C4XI 1VQK1 4EOQB 3S14I 2IV2X 4BXXI 5A2Qb 1K8A1 3CCQ1 2IW8B 4NBGA 1VQM1 2F4MA 3MONA 4RVGA 1GY3B 3G6E1 5DQVA 4BBRI 4BCQD 1AHJB 3CPWZ 1QYPA 3CCS1 2JS4A 3NH4A 2IZ4A 5EJCA 4A3EI 4CFUD 4A3BI 1S7MA 3PO2I 3G4S1 2KPIA 2R6MA 3CME1 4DQYB 3VB9A 3A8MB 2QA41 3RZDI 2E9HA 2V8IA 2WFYB 1TWGI 1D3UB 5IT9f 2KMGA 2F2CA 1VQ5Z 1UNLD 4ZGEB 2JA6I 1Z01A 1ZH1A 2NAPA 3J80f 2BS2A 2VPZA 4EWCA 4A3CI 4EOOB 1H26B 4F6SB 2G9XB 1O9KB 2GTHA 1AA6A 3J80b 1YHQ1 4Z6YA 3GTJI 3OW2Z 3EOCB 4CFWB 2OZKA 3X24B 3DTOA 3VKHA 1YJ9Z 4EC8B 2OTL1 3F5XB 2YU9I 2QGSA 4NB8A 2OTJ1 3P5JB 5CM2M 1NP6A 2ZPIB 4TNUA 5HBEB 3NDJA 2O4HA 2CJMB 1N4MA 2BS4A 4RS4A 1WCMI 4BXXX 2ZPEB 4MFEA 2BPMB 2PMZA 4BCQB 1QF8A 3CXCZ 1QMZB 3S17I 3CC41 1M1K1 2ZPFB 2NVTI 4A3DI 2C5VB 2E2JI 3BG0B 4AYBA 4BY1X 3F3FC 3CCQZ 2PJQA 2E2II 1W2BY 4EOIB 2R7ZI 2BJOA 4MFDA 5IP7I 3VTNA 3G6EZ 2K3RA 2ZCFB 1R9TI 1VYWB 1H24B 3DDQB 3OW2Y 3DL1A 1KRLA 3M4OI 1VQ91 4FX3B 3JAMf 4BBSM 1VOLA 4CFNB 1BU2A 2JIOA 5C3EI 2JGZB 1VQ7Z 3POMA 3CMEZ 3CC7Z 1JOWA 1USPB 2O53A 3MY1B 2QDJA 5T6BA 2CYZB 2WMBB 2WXVB 4CRLB 1UNHD 1S721 4F70B 3TNHB
chains in the Genus database with same CATH topology
1VQ61 1YJW1 3NDIA 3HOXI 1YIJ1 1KD12 1ML8A 1TWAI 2I3CA 3FQQA 1M902 3U50C 2P3YA 1RQFA 1P9NA 2QR1B 3CD6Z 1QVGY 1K9M2 3GTGI 3CCJZ 3HOYI 1JJ2Z 2QKDA 3CCUZ 3CC4Z 4A3LI 3S2DI 4BY7I 3LUSA 2QRCB 5D1OA 4NB9A 4BY1I 2Q4ZA 1WW9A 1M1K2 1N8R2 3I4MI 5D1OB 3PO3I 2KI7B 3GCFA 1I50I 5LL6f 2G2KA 4E32A 1NJI1 1S72Z 2LFUA 2PM9A 1VQ41 3G71Z 3ESWA 5T67A 3FKII 4X6AI 4DK1A 1VQL1 1VQ51 3S1QI 1TWCI 3G711 3S1RI 1X3ZA 1K732 2RT9A 1RO2A 1NUIA 3I56Z 5AN9F 1Q821 1M901 1Q812 2EGTA 3CCU1 1ENWA 3CCV1 1YJ91 3HKZA 3I561 2NVQI 3HOUI 5FLXf 1Q861 1YIT1 1YUAA 3CCLZ 3CCSZ 5D1PA 4BBSI 2F4OA 1YUKA 4XX2A 1DL6A 2HF1A 2OOYB 3CMAZ 4MRIA 3NH5A 1TWFI 1Q811 3IFUA 2VF1A 3JAMb 2IZ3A 2M6NA 1KC82 3J81b 1N8R1 2NVXI 1Y1VI 2QEX1 3MZLB 1W2BZ 3MZKB 4HGZA 3K7AI 5IP9I 1VQO1 5IT9b 1VQ8Z 1VQN1 1YJN1 3S1NI 2W03A 1TFIA 3S16I 3KIFA 4RVHA 4NBBA 2RPRA 1Y1VS 2DE5A 2WB1A 2DMEA 1YI21 4A93I 4S1TA 1PFTA 3RZOI 2QA4Z 1Q862 1VQKZ 4QTUA 1K83I 3I4NI 3GTLI 4NOZA 3CCR1 2VUMI 4NBCA 3VMIA 3CC71 1VQ4Z 2JA7I 2JA5I 1VQ9Z 3Q87A 3S1MI 1JWHC 1K8A2 1ZB8A 2GTIA 2RHBA 2B63I 1KQSZ 2QEXZ 3CC21 1RLYA 2LIYA 3CXCY 4NBEA 3CCE1 4HGYA 4RV9A 4MXUA 5C44I 2E2HI 1VQ81 1VQNZ 4RVFA 5FLXb 2YADA 3CCEZ 2OTLZ 4NBDA 4A3JI 1VQPZ 1Z03A 3H0GI 3IF8A 3NDQA 4MONA 4E33A 2JA8I 2QLVB 4BY7X 1QVFZ 1USPA 1X0TA 4A3MI 3PO3S 3D9XA 3GTOI 3HOVI 5C4JI 3GTQI 3GTPI 3KIHA 4E31A 3F3PC 3GTKI 3GTMI 2VUGA 4NBAA 1VQ6Z 1L1OC 3CPWY 2OTJZ 1KQSY 1WIIA 2P28A 3CCVZ 1K731 3EEDA 1QVFY 5T64A 1KC81 1VQP1 1Z02A 3GTMS 3CCMZ 1SFOI 2JUBA 2JMOA 1N2FA 3CCRZ 2R93I 1QVGZ 2QRDB 4E30A 1X3WA 3CCM1 4A3II 2JNYA 2H85A 3CQZI 1Q7Y2 3VMGA 1RO0A 1VQMZ 2HU9A 4CL1A 2PK7A 3BG1B 4HH4A 3FQMA 3GKQA 2Y0SA 1YHQZ 2NVYI 4E2WA 4NBFA 1KD11 1YIJZ 4A3GI 1RO4A 1YJWZ 1VQOZ 2GU2A 3CD61 4MD8A 4Y7NI 5A2Qf 1NJI2 2V8JA 3CC2Z 1VQLZ 2DE6A 2RBLA 1I6HI 2ZAEB 1ZB9A 1YITZ 3TE5B 3IX0A 2QREB 3VMHA 3HOZI 1LQLA 3NH8A 4MD9A 3J7A4 4E2ZA 3D6WA 1Y1WI 2K5RA 1Q822 3EERA 1VQ71 3G4SZ 3H3VJ 2RIQA 1VLAA 3CCL1 2J6AA 4RVDA 3HOWI 3S2HI 3S15I 3J81f 1JJ2Y 4MH4A 4E2YA 5FLMI 2LW4A 4NH1C 3TDHB 2WAQA 2W04A 3I55Z 2R92I 1RNIA 2DE7A 1YJNZ 2AKLA 1Q7Y1 2JR6A 2OOXB 3CMA1 4A3FI 1K9M1 4E2XA 2V8KA 3CCJ1 3I551 3T4NB 3NFZA 4Y52I 4QTTA 3QWUA 2M48A 2Q51A 4MD7A 1YI2Z 4DGLA 4NBHA 1I3QI 3M3YI 1TWHI 3I07A 3S14I 5C4XI 1VQK1 4BXXI 5A2Qb 1K8A1 3CCQ1 4NBGA 1VQM1 2F4MA 3MONA 4RVGA 3G6E1 4BBRI 3CPWZ 1QYPA 3CCS1 2JS4A 3NH4A 2IZ4A 4A3EI 4A3BI 1S7MA 3PO2I 3G4S1 2KPIA 2R6MA 3CME1 4DQYB 3VB9A 2QA41 3RZDI 2E9HA 2V8IA 1TWGI 5IT9f 1VQ5Z 2JA6I 1ZH1A 1Z01A 3J80f 4EWCA 4A3CI 2GTHA 3J80b 1YHQ1 3GTJI 3OW2Z 2OZKA 1YJ9Z 2OTL1 2YU9I 4NB8A 2OTJ1 3P5JB 5CM2M 1NP6A 4TNUA 3NDJA 2O4HA 4RS4A 1WCMI 4BXXX 3CXCZ 2PMZA 1QF8A 3S17I 3CC41 1M1K1 2NVTI 4A3DI 2E2JI 3BG0B 4AYBA 4BY1X 3F3FC 3CCQZ 2E2II 1W2BY 2R7ZI 2BJOA 5IP7I 3VTNA 3G6EZ 2K3RA 1R9TI 3OW2Y 3M4OI 1KRLA 1VQ91 3JAMf 5C3EI 1VQ7Z 3CMEZ 3CC7Z 1USPB 2O53A 5T6BA 4A3KI 1S721 4NFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 I;  2DE7 A;  3GTK I;  3GTM I;  2AKL A;  2NVX I;  2JR6 A;  3HOX I;  1Y1V I;  4A3F I;  4NBA A;  1ML8 A;  1TWA I;  1L1O C;  3K7A I;  3U50 C;  5IP9 I;  2P3Y A;  4Y52 I;  4QTT A;  3S1N I;  3GTG I;  1TFI A;  3HOY I;  3S16 I;  4NBH A;  1I3Q I;  4NBB A;  3M3Y I;  4A3L I;  1Y1V S;  2DE5 A;  3S2D I;  1TWH I;  3GTM S;  2DME A;  3I07 A;  1SFO I;  4BY7 I;  3LUS A;  3S14 I;  5C4X I;  4A93 I;  4BXX I;  4NBG A;  1N2F A;  2F4M A;  4NB9 A;  2R93 I;  1PFT A;  3RZO I;  4BBR I;  1X3W A;  4A3I I;  1WW9 A;  2JNY A;  4BY1 I;  3CQZ I;  1QYP A;  2JS4 A;  4QTU A;  1K83 I;  3I4N I;  3GTL I;  3I4M I;  3VMG A;  4A3E I;  3PO3 I;  4NOZ A;  4A3B I;  3PO2 I;  3GCF A;  2VUM I;  1I50 I;  4NBC A;  3VMI A;  2KPI A;  2JA7 I;  2PK7 A;  3VB9 A;  3RZD I;  2JA5 I;  1TWG I;  3Q87 A;  3GKQ A;  3S1M I;  2NVY I;  1ZB8 A;  2JA6 I;  3ESW A;  4NBF A;  2B63 I;  3FKI I;  4A3C I;  4A3G I;  4X6A I;  1RO4 A;  1RLY A;  3S1Q I;  1TWC I;  3GTJ I;  3S1R I;  1X3Z A;  4NBE A;  4Y7N I;  1NUI A;  2YU9 I;  2DE6 A;  5C44 I;  2E2H I;  4NB8 A;  2RBL A;  1I6H I;  5CM2 M;  1ZB9 A;  1ENW A;  4NBD A;  2NVQ I;  3HOU I;  1WCM I;  4BXX X;  3VMH A;  4A3J I;  3S17 I;  3HOZ I;  1LQL A;  3H0G I;  3NDQ A;  1YUA A;  2NVT I;  4A3D I;  2JA8 I;  3D6W A;  2E2J I;  4BY1 X;  1Y1W I;  2E2I I;  2R7Z I;  2K5R A;  4BBS I;  2BJO A;  3EER A;  5IP7 I;  2F4O A;  3H3V J;  4BY7 X;  4XX2 A;  1R9T I;  1DL6 A;  1VLA A;  1USP A;  2HF1 A;  2J6A A;  3HOW I;  3M4O I;  3S2H I;  4A3M I;  3S15 I;  3PO3 S;  5C3E I;  4MH4 A;  1USP B;  5FLM I;  2LW4 A;  3GTO I;  3HOV I;  5C4J I;  3GTQ I;  3GTP I;  1TWF I;  4A3K I; 
#chains in the Genus database with same CATH topology
 2W9F A;  4EOL B;  1Y8C A;  1VQ6 1;  1YJW 1;  4F7S B;  1AIS B;  1H1Q B;  5IDN B;  1FDO A;  3NDI A;  3HOX I;  1YIJ 1;  1KD1 2;  3BLH B;  3HO8 A;  2ZPH B;  3BHT B;  3DDP B;  1ML8 A;  1TWA I;  2I3C A;  1JSU B;  3FQQ A;  1M90 2;  3U50 C;  1OIU B;  1H4L D;  5IDP B;  1RQF A;  2P3Y A;  1P9N A;  2QR1 B;  3WVE B;  3CD6 Z;  4CFV B;  1QVG Y;  1K9M 2;  3GTG I;  2IN3 A;  1TD6 A;  3O0G D;  3CCJ Z;  3HOY I;  4YOO A;  1JJ2 Z;  2QKD A;  3CCU Z;  4KRC B;  3CC4 Z;  4A3L I;  3S2D I;  4BY7 I;  3LUS A;  2QRC B;  4BCG B;  5D1O A;  4NB9 A;  1H27 B;  1QLB A;  3G33 B;  2WPA B;  4BY1 I;  2Q4Z A;  1WW9 A;  1M1K 2;  4OR5 B;  1N8R 2;  2DPP B;  3X28 B;  3I4M I;  5D1O B;  1OL2 B;  4CFM B;  4EOM B;  2KI7 B;  3PO3 I;  3GCF A;  1I50 I;  4BCH B;  1PKD B;  5LL6 f;  4ELJ A;  2G2K A;  2VPY A;  4E32 A;  3QYH B;  3M03 A;  4BCJ B;  4JX6 A;  1NJI 1;  2D0Q B;  1S72 Z;  2LFU A;  1O9K A;  2PM9 A;  3IR7 A;  4JX4 A;  1UGQ B;  4OB1 B;  3G71 Z;  1VQ4 1;  3ESW A;  3QHW B;  4F7N B;  5T67 A;  3FKI I;  1H28 B;  4X6A I;  5DQW A;  4DK1 A;  1VQL 1;  2DD5 B;  4AKG A;  1VQ5 1;  3TW6 A;  3EJ1 B;  2ZZD B;  3VKG A;  1TWC I;  3S1Q I;  3G71 1;  3S1R I;  1X3Z A;  3QHR B;  1FIN B;  1QXF A;  1FVV B;  2PK2 A;  1UNG D;  3EID B;  4II5 B;  2RT9 A;  1K73 2;  1RO2 A;  1NUI A;  3I56 Z;  5I5Z B;  1OI9 B;  4YC3 B;  4YOS A;  4G6L B;  5AN9 F;  1Q82 1;  1M90 1;  1Q81 2;  2EGT A;  3CCU 1;  4IMY B;  2DXC B;  1ENW A;  3CCV 1;  2C5N B;  3HKZ A;  1YJ9 1;  1FDI A;  3I56 1;  2NVQ I;  3HOU I;  2PK9 B;  3QWL A;  3B57 A;  5FLX f;  2WIP B;  1Q86 1;  1YIT 1;  1XO2 A;  1YUA A;  3CCL Z;  1W98 B;  3CCS Z;  5HVY B;  5D1P A;  4BBS I;  3QZ5 B;  3QYE A;  2F4O A;  1YUK A;  4XX2 A;  1DL6 A;  2JIR A;  2HF1 A;  2UZB B;  2UZL B;  2AHJ B;  2OOY B;  5IHY A;  1VIN A;  2W9Z A;  3QYB A;  2C6T B;  3CMA Z;  4MRI A;  3NH5 A;  4EOK B;  1GH6 B;  5FGK B;  3QXE B;  1TWF I;  2V45 A;  1Q81 1;  3IFU A;  2CZ6 B;  2ZPG B;  4BCN B;  2VF1 A;  2V22 B;  3JAM b;  2IZ3 A;  4BCM D;  4Y72 B;  4ROE A;  2M6N A;  3J81 b;  1KC8 2;  1N8R 1;  4BCI B;  2NVX I;  1UGP B;  1Y1V I;  2UZD B;  3MZL B;  2QEX 1;  1W2B Z;  3MZK B;  4HGZ A;  3K7A I;  5IP9 I;  1VQO 1;  5IT9 b;  1VQ8 Z;  1VQN 1;  1YJN 1;  3S1N I;  2DXB B;  2W03 A;  1TFI A;  2WIH B;  1V29 B;  4F6U B;  1UGS B;  3S16 I;  3KIF A;  4RVH A;  1JKW A;  2QQ8 A;  2BKZ B;  2ZPB B;  4NBB A;  2RPR A;  1Y1V S;  2UZE B;  2DE5 A;  2WB1 A;  4F6W B;  3DOG B;  2DME A;  1URC B;  3QYG B;  1YI2 1;  4A93 I;  3HBL A;  4S1T A;  4BCP B;  1AD6 A;  1SIW A;  1PFT A;  4BCF B;  2X1N B;  3RZO I;  5EFQ B;  2QA4 Z;  2W2H A;  1Q86 2;  2QDY B;  1VQK Z;  4ROC A;  4QTU A;  1K83 I;  3I4N I;  1TFB A;  3BG5 A;  3GTL I;  4EOS B;  4NOZ A;  3BHV B;  3CCR 1;  2VUM I;  2CZ7 B;  4NBC A;  3VMI A;  3CC7 1;  1VQ4 Z;  3QZ9 B;  2JA7 I;  5LMK B;  2I40 B;  1UGR B;  2R7G A;  2JA5 I;  1OGU B;  2VPW A;  1VQ9 Z;  3Q87 A;  3S1M I;  1JWH C;  1K8A 2;  3TW7 A;  4JX5 A;  1ZB8 A;  4BCN D;  2GTI A;  2RHB A;  2PHG A;  3MIA B;  2B63 I;  1KQS Z;  2QEX Z;  3CC2 1;  4BCK B;  4BCO B;  1WZN A;  1RLY A;  2LIY A;  2UUE B;  4EC9 B;  3CXC Y;  4A3K I;  2IVX A;  1OKV B;  4NBE A;  1E7P A;  4HNV A;  3CCE 1;  4HGY A;  4RV9 A;  2CZ1 B;  3KHI A;  4F7L B;  4MXU A;  1OIY B;  5C44 I;  3HB9 A;  1VQ8 1;  2E2H I;  1VQN Z;  4RVF A;  5FLX b;  4KRD B;  2WMA B;  4HNU A;  2YAD A;  3CCE Z;  2OTL Z;  2KR6 A;  4ELL A;  2C5O B;  4NBD A;  2WEV B;  4EOJ B;  4A3J I;  4EON B;  1VQP Z;  1Z03 A;  3H0G I;  3IF8 A;  3NDQ A;  3WVD B;  4MON A;  4E33 A;  4ROD A;  2JA8 I;  4BBR M;  4OB0 B;  4BCM B;  3LQ5 B;  2QLV B;  1WJ2 A;  4BY7 X;  2LEX A;  2JIQ A;  1QVF Z;  1USP A;  2G77 A;  4OB3 B;  1X0T A;  4A3M I;  3PO3 S;  3BLQ B;  3D9X A;  3VYG B;  3BG9 A;  1C9B A;  3GTO I;  3HOV I;  3BLR B;  5C4J I;  3GTQ I;  3X20 B;  3GTP I;  3KIH A;  4E31 A;  3F3P C;  2EUF A;  3K7A M;  3A8H B;  3GTK I;  2CZ0 B;  3GTM I;  4HNT A;  1FKM A;  3HZJ A;  5HQ0 B;  5BNJ B;  2VUG A;  1H25 B;  4NBA A;  1VQ6 Z;  1L1O C;  1OL1 B;  3CPW Y;  4AI6 A;  5LQF B;  2C4G B;  1KXU A;  4HLQ A;  2OTJ Z;  1KQS Y;  1WII A;  2P28 A;  3CCV Z;  5IF1 B;  1E9H B;  1K73 1;  4QSH A;  3EED A;  3DJB A;  1IRE B;  1QVF Y;  5T64 A;  1P5E B;  4AKI A;  1KC8 1;  2V3V A;  1VQP 1;  4CXA B;  5ICP B;  3HHT B;  1Z02 A;  3GTM S;  3CCM Z;  1SFO I;  2JUB A;  1GUX B;  4ZGJ B;  5CEI B;  1G3N C;  2JMO A;  2IW9 B;  5HBJ B;  1N2F A;  3CCR Z;  2R93 I;  3TNI B;  1QVG Z;  4HL4 A;  2QRD B;  4E30 A;  1X3W A;  2VPX A;  3CCM 1;  2JNY A;  4A3I I;  1GUX A;  2H85 A;  3CQZ I;  1H1R B;  1Q7Y 2;  4NC6 A;  5HBH B;  1Q16 A;  1RO0 A;  3VMG A;  3H4C A;  1VQM Z;  1ZP2 A;  2HU9 A;  1H1P B;  4CL1 A;  2PK7 A;  3BG1 B;  3TN8 B;  4HH4 A;  1H1S B;  3FQM A;  4MIM A;  4EOR B;  2CCH B;  3GKQ A;  2Y0S A;  1YHQ Z;  2NVY I;  4E2W A;  4NBF A;  1KD1 1;  1YIJ Z;  4A3G I;  5HNB B;  4M6V A;  1RO4 A;  3MI9 B;  3VYH B;  1YJW Z;  2WJ9 A;  1VQO Z;  2GU2 A;  2BS3 A;  3CD6 1;  1JST B;  4MD8 A;  4Y7N I;  5A2Q f;  1NJI 2;  2V8J A;  3X25 B;  3CC2 Z;  4F7J B;  2E7Z A;  1VQL Z;  2JIM A;  2QF7 A;  2DE6 A;  4NST B;  2RBL A;  1I6H I;  2ZAE B;  1ZB9 A;  1YIT Z;  3A8G B;  3TE5 B;  3D2L A;  2DD4 B;  2QRE B;  3IX0 A;  2B9R A;  3VMH A;  1OKW B;  3HOZ I;  1LQL A;  5ACB A;  3NH8 A;  3A8L B;  4MD9 A;  3J7A 4;  4E2Z A;  3D6W A;  1Y1W I;  3MY5 B;  2K5R A;  1Q82 2;  3EER A;  2C5X B;  1VQ7 1;  3G4S Z;  3H3V J;  4ZGD B;  2RIQ A;  1VLA A;  3CCL 1;  2J6A A;  4RVD A;  3HOW I;  3S2H I;  3S15 I;  2JIP A;  4FM4 B;  3J81 f;  3TNW B;  1JJ2 Y;  4MH4 A;  4E2Y A;  2W96 A;  2LW4 A;  4CFU B;  2I53 A;  5FLM I;  4NH1 C;  4NFR A;  3TDH B;  2WAQ A;  4UN0 A;  2W04 A;  4CFX B;  2IW6 B;  4OB2 B;  3I55 Z;  3A8O B;  2W99 A;  4TTH A;  2R92 I;  1RNI A;  2DE7 A;  1YJN Z;  3BG3 A;  2AKL A;  4AKH A;  2JR6 A;  2OOX B;  1Q7Y 1;  4A3F I;  3CMA 1;  1K9M 1;  4E2X A;  2V8K A;  4LOC A;  3CCJ 1;  2AYD A;  3I55 1;  3X26 B;  1F5Q B;  4OGR B;  3T4N B;  3NFZ A;  4Y52 I;  5CYI B;  5L2W B;  4YOZ A;  3QWU A;  4QTT A;  2M48 A;  2Q51 A;  2PMI B;  4MD7 A;  1YI2 Z;  4I3Z B;  4DGL A;  2WHB B;  4NBH A;  3BHU B;  1I3Q I;  3M3Y I;  1TWH I;  2CCI B;  2QFZ A;  4EOP B;  3I07 A;  3RGF B;  5C4X I;  1VQK 1;  4EOQ B;  3S14 I;  2IV2 X;  4BXX I;  5A2Q b;  1K8A 1;  3CCQ 1;  2IW8 B;  4NBG A;  1VQM 1;  2F4M A;  3MON A;  4RVG A;  1GY3 B;  3G6E 1;  5DQV A;  4BBR I;  4BCQ D;  1AHJ B;  3CPW Z;  1QYP A;  3CCS 1;  2JS4 A;  3NH4 A;  2IZ4 A;  5EJC A;  4A3E I;  4CFU D;  4A3B I;  1S7M A;  3PO2 I;  3G4S 1;  2KPI A;  2R6M A;  3CME 1;  4DQY B;  3VB9 A;  3A8M B;  2QA4 1;  3RZD I;  2E9H A;  2V8I A;  2WFY B;  1TWG I;  1D3U B;  5IT9 f;  2KMG A;  2F2C A;  1VQ5 Z;  1UNL D;  4ZGE B;  2JA6 I;  1Z01 A;  1ZH1 A;  2NAP A;  3J80 f;  2BS2 A;  2VPZ A;  4EWC A;  4A3C I;  4EOO B;  1H26 B;  4F6S B;  2G9X B;  1O9K B;  2GTH A;  1AA6 A;  3J80 b;  1YHQ 1;  4Z6Y A;  3GTJ I;  3OW2 Z;  3EOC B;  4CFW B;  2OZK A;  3X24 B;  3DTO A;  3VKH A;  1YJ9 Z;  4EC8 B;  2OTL 1;  3F5X B;  2YU9 I;  2QGS A;  4NB8 A;  2OTJ 1;  3P5J B;  5CM2 M;  1NP6 A;  2ZPI B;  4TNU A;  5HBE B;  3NDJ A;  2O4H A;  2CJM B;  1N4M A;  2BS4 A;  4RS4 A;  1WCM I;  4BXX X;  2ZPE B;  4MFE A;  2BPM B;  2PMZ A;  4BCQ B;  1QF8 A;  3CXC Z;  1QMZ B;  3S17 I;  3CC4 1;  1M1K 1;  2ZPF B;  2NVT I;  4A3D I;  2C5V B;  2E2J I;  3BG0 B;  4AYB A;  4BY1 X;  3F3F C;  3CCQ Z;  2PJQ A;  2E2I I;  1W2B Y;  4EOI B;  2R7Z I;  2BJO A;  4MFD A;  5IP7 I;  3VTN A;  3G6E Z;  2K3R A;  2ZCF B;  1R9T I;  1VYW B;  1H24 B;  3DDQ B;  3OW2 Y;  3DL1 A;  1KRL A;  3M4O I;  1VQ9 1;  4FX3 B;  3JAM f;  4BBS M;  1VOL A;  4CFN B;  1BU2 A;  2JIO A;  5C3E I;  2JGZ B;  1VQ7 Z;  3POM A;  3CME Z;  3CC7 Z;  1JOW A;  1USP B;  2O53 A;  3MY1 B;  2QDJ A;  5T6B A;  2CYZ B;  2WMB B;  2WXV B;  4CRL B;  1UNH D;  1S72 1;  4F70 B;  3TNH B; 
#chains in the Genus database with same CATH homology
 1VQ6 1;  1YJW 1;  3NDI A;  3HOX I;  1YIJ 1;  1KD1 2;  1ML8 A;  1TWA I;  2I3C A;  3FQQ A;  1M90 2;  3U50 C;  2P3Y A;  1RQF A;  1P9N A;  2QR1 B;  3CD6 Z;  1QVG Y;  1K9M 2;  3GTG I;  3CCJ Z;  3HOY I;  1JJ2 Z;  2QKD A;  3CCU Z;  3CC4 Z;  4A3L I;  3S2D I;  4BY7 I;  3LUS A;  2QRC B;  5D1O A;  4NB9 A;  4BY1 I;  2Q4Z A;  1WW9 A;  1M1K 2;  1N8R 2;  3I4M I;  5D1O B;  3PO3 I;  2KI7 B;  3GCF A;  1I50 I;  5LL6 f;  2G2K A;  4E32 A;  1NJI 1;  1S72 Z;  2LFU A;  2PM9 A;  1VQ4 1;  3G71 Z;  3ESW A;  5T67 A;  3FKI I;  4X6A I;  4DK1 A;  1VQL 1;  1VQ5 1;  3S1Q I;  1TWC I;  3G71 1;  3S1R I;  1X3Z A;  1K73 2;  2RT9 A;  1RO2 A;  1NUI A;  3I56 Z;  5AN9 F;  1Q82 1;  1M90 1;  1Q81 2;  2EGT A;  3CCU 1;  1ENW A;  3CCV 1;  1YJ9 1;  3HKZ A;  3I56 1;  2NVQ I;  3HOU I;  5FLX f;  1Q86 1;  1YIT 1;  1YUA A;  3CCL Z;  3CCS Z;  5D1P A;  4BBS I;  2F4O A;  1YUK A;  4XX2 A;  1DL6 A;  2HF1 A;  2OOY B;  3CMA Z;  4MRI A;  3NH5 A;  1TWF I;  1Q81 1;  3IFU A;  2VF1 A;  3JAM b;  2IZ3 A;  2M6N A;  1KC8 2;  3J81 b;  1N8R 1;  2NVX I;  1Y1V I;  2QEX 1;  3MZL B;  1W2B Z;  3MZK B;  4HGZ A;  3K7A I;  5IP9 I;  1VQO 1;  5IT9 b;  1VQ8 Z;  1VQN 1;  1YJN 1;  3S1N I;  2W03 A;  1TFI A;  3S16 I;  3KIF A;  4RVH A;  4NBB A;  2RPR A;  1Y1V S;  2DE5 A;  2WB1 A;  2DME A;  1YI2 1;  4A93 I;  4S1T A;  1PFT A;  3RZO I;  2QA4 Z;  1Q86 2;  1VQK Z;  4QTU A;  1K83 I;  3I4N I;  3GTL I;  4NOZ A;  3CCR 1;  2VUM I;  4NBC A;  3VMI A;  3CC7 1;  1VQ4 Z;  2JA7 I;  2JA5 I;  1VQ9 Z;  3Q87 A;  3S1M I;  1JWH C;  1K8A 2;  1ZB8 A;  2GTI A;  2RHB A;  2B63 I;  1KQS Z;  2QEX Z;  3CC2 1;  1RLY A;  2LIY A;  3CXC Y;  4NBE A;  3CCE 1;  4HGY A;  4RV9 A;  4MXU A;  5C44 I;  2E2H I;  1VQ8 1;  1VQN Z;  4RVF A;  5FLX b;  2YAD A;  3CCE Z;  2OTL Z;  4NBD A;  4A3J I;  1VQP Z;  1Z03 A;  3H0G I;  3IF8 A;  3NDQ A;  4MON A;  4E33 A;  2JA8 I;  2QLV B;  4BY7 X;  1QVF Z;  1USP A;  1X0T A;  4A3M I;  3PO3 S;  3D9X A;  3GTO I;  3HOV I;  5C4J I;  3GTQ I;  3GTP I;  3KIH A;  4E31 A;  3F3P C;  3GTK I;  3GTM I;  2VUG A;  4NBA A;  1VQ6 Z;  1L1O C;  3CPW Y;  2OTJ Z;  1KQS Y;  1WII A;  2P28 A;  3CCV Z;  1K73 1;  3EED A;  1QVF Y;  5T64 A;  1KC8 1;  1VQP 1;  1Z02 A;  3GTM S;  3CCM Z;  1SFO I;  2JUB A;  2JMO A;  1N2F A;  3CCR Z;  2R93 I;  1QVG Z;  2QRD B;  4E30 A;  1X3W A;  3CCM 1;  4A3I I;  2JNY A;  2H85 A;  3CQZ I;  1Q7Y 2;  3VMG A;  1RO0 A;  1VQM Z;  2HU9 A;  4CL1 A;  2PK7 A;  3BG1 B;  4HH4 A;  3FQM A;  3GKQ A;  2Y0S A;  1YHQ Z;  2NVY I;  4E2W A;  4NBF A;  1KD1 1;  1YIJ Z;  4A3G I;  1RO4 A;  1YJW Z;  1VQO Z;  2GU2 A;  3CD6 1;  4MD8 A;  4Y7N I;  5A2Q f;  1NJI 2;  2V8J A;  3CC2 Z;  1VQL Z;  2DE6 A;  2RBL A;  1I6H I;  2ZAE B;  1ZB9 A;  1YIT Z;  3TE5 B;  3IX0 A;  2QRE B;  3VMH A;  3HOZ I;  1LQL A;  3NH8 A;  4MD9 A;  3J7A 4;  4E2Z A;  3D6W A;  1Y1W I;  2K5R A;  1Q82 2;  3EER A;  1VQ7 1;  3G4S Z;  3H3V J;  2RIQ A;  1VLA A;  3CCL 1;  2J6A A;  4RVD A;  3HOW I;  3S2H I;  3S15 I;  3J81 f;  1JJ2 Y;  4MH4 A;  4E2Y A;  5FLM I;  2LW4 A;  4NH1 C;  3TDH B;  2WAQ A;  2W04 A;  3I55 Z;  2R92 I;  1RNI A;  2DE7 A;  1YJN Z;  2AKL A;  1Q7Y 1;  2JR6 A;  2OOX B;  3CMA 1;  4A3F I;  1K9M 1;  4E2X A;  2V8K A;  3CCJ 1;  3I55 1;  3T4N B;  3NFZ A;  4Y52 I;  4QTT A;  3QWU A;  2M48 A;  2Q51 A;  4MD7 A;  1YI2 Z;  4DGL A;  4NBH A;  1I3Q I;  3M3Y I;  1TWH I;  3I07 A;  3S14 I;  5C4X I;  1VQK 1;  4BXX I;  5A2Q b;  1K8A 1;  3CCQ 1;  4NBG A;  1VQM 1;  2F4M A;  3MON A;  4RVG A;  3G6E 1;  4BBR I;  3CPW Z;  1QYP A;  3CCS 1;  2JS4 A;  3NH4 A;  2IZ4 A;  4A3E I;  4A3B I;  1S7M A;  3PO2 I;  3G4S 1;  2KPI A;  2R6M A;  3CME 1;  4DQY B;  3VB9 A;  2QA4 1;  3RZD I;  2E9H A;  2V8I A;  1TWG I;  5IT9 f;  1VQ5 Z;  2JA6 I;  1ZH1 A;  1Z01 A;  3J80 f;  4EWC A;  4A3C I;  2GTH A;  3J80 b;  1YHQ 1;  3GTJ I;  3OW2 Z;  2OZK A;  1YJ9 Z;  2OTL 1;  2YU9 I;  4NB8 A;  2OTJ 1;  3P5J B;  5CM2 M;  1NP6 A;  4TNU A;  3NDJ A;  2O4H A;  4RS4 A;  1WCM I;  4BXX X;  3CXC Z;  2PMZ A;  1QF8 A;  3S17 I;  3CC4 1;  1M1K 1;  2NVT I;  4A3D I;  2E2J I;  3BG0 B;  4AYB A;  4BY1 X;  3F3F C;  3CCQ Z;  2E2I I;  1W2B Y;  2R7Z I;  2BJO A;  5IP7 I;  3VTN A;  3G6E Z;  2K3R A;  1R9T I;  3OW2 Y;  3M4O I;  1KRL A;  1VQ9 1;  3JAM f;  5C3E I;  1VQ7 Z;  3CME Z;  3CC7 Z;  1USP B;  2O53 A;  5T6B A;  4A3K I;  1S72 1;  4NFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...