3GTPI

Backtracked rna polymerase ii complex with 24mer rna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtpI02
3I4NI 3HOYI 3S1QI 3S1MI 1N2FA 4QTUA 1NUIA 3VMHA 1TFIA 1DL6A 1ZB9A 2E2HI 2NVYI 3VMIA 3GTMI 3LUSA 1ZB8A 4A3JI 3VB9A 3PO2I 4A3GI 3I4MI 1PFTA 4BXXI 1I6HI 1TWAI 3GTMS 1TWFI 3HOXI 3HOZI 4A3LI 4NB9A 4NBAA 4BBSI 5C3EI 1SFOI 1I3QI 2AKLA 1Y1VI 3PO3I 1LQLA 4BY1I 3ESWA 4A3BI 3S1NI 4MH4A 1WW9A 4NBFA 5FLMI 1RO4A 2HF1A 1VLAA 1X3WA 3CQZI 3FKII 2F4OA 2F4MA 3PO3S 4X6AI 5CM2M 4BBRI 1TWHI 1RLYA 3GTJI 2P3YA 1L1OC 4A3FI 5C4JI 4Y7NI 3HOVI 4A3MI 3H0GI 4NBBA 2E2JI 3EERA 3RZDI 3S15I 3S17I 3Q87A 2JS4A 2DE5A 4A93I 4NBEA 2DE6A 4A3KI 2J6AA 2R92I 3GTPI 5C4XI 1X3ZA 4NBDA 3GCFA 3K7AI 4Y52I 4A3II 3GTQI 1USPB 3M4OI 4NBHA 2YU9I 3GTOI 4NB8A 2JA8I 2JR6A 2R7ZI 1TWCI 1WCMI 1R9TI 3H3VJ 2BJOA 4NBCA 5IP7I 4A3DI 4XX2A 3GTGI 3U50C 3VMGA 1USPA 2B63I 2JNYA 3HOUI 3RZOI 3HOWI 3GKQA 2KPIA 3M3YI 3S2DI 1Y1VS 2NVQI 3I07A 2JA5I 2VUMI 3S1RI 3GTLI 1Y1WI 4A3CI 5C44I 2NVXI 3D6WA 2RBLA 1QYPA 4BY7I 1ML8A 2JA7I 5IP9I 1YUAA 1TWGI 4NBGA 4QTTA 3S14I 3S16I 1I50I 2K5RA 2PK7A 2NVTI 3GTKI 2E2II 2DE7A 3S2HI 4NOZA 1K83I 4A3EI 2R93I 2JA6I
chains in the Genus database with same CATH superfamily
3CMEZ 1Q862 1DL6A 2V8KA 4DQYB 2VPXA 2RPRA 1ZB8A 1KQSZ 3CC4Z 1M1K2 1VQ4Z 3CPWZ 4E31A 1VQ91 3KIFA 2QR1B 5C3EI 1M1K1 3PO3I 2I3CA 4EWCA 3ESWA 4NBFA 1RO4A 3BG0B 2HF1A 3CCUZ 1X3WA 3CQZI 3FKII 3MZLB 1RO2A 2O4HA 1VQ51 3CC21 4X6AI 1S7MA 1L1OC 4A3FI 5A2Qb 2KI7B 3H0GI 4DGLA 2RHBA 4RVDA 3S15I 2VF1A 1KC82 1VQ5Z 3G4SZ 3Q87A 3NDJA 2JS4A 2DE5A 2DE6A 4NBEA 4CL1A 3J80b 2R92I 1YJ91 4NBDA 3VTNA 1YUKA 3I551 1K732 1KQSY 3GTQI 3IX0A 2EGTA 2OTLZ 4NB8A 3QWUA 1TWCI 3CCRZ 1YI21 1R9TI 3CC41 4RVFA 4E2YA 1VQNZ 4S1TA 4E2ZA 1YIT1 1WIIA 4MONA 2M6NA 2O53A 5T6BA 3S2DI 2JUBA 2OTL1 3MONA 2JIPA 4A3CI 2NVXI 3JAMb 2PMZA 2RBLA 1ML8A 3CD61 2NAPA 3CCE1 5IT9f 1Q822 2NVTI 4MD7A 5T64A 1Q812 2DE7A 2G2KA 3S2HI 5T67A 2LEXA 2GTIA 2QLVB 4E32A 2JIQA 3OW2Z 2ZAEB 3S1MI 1NUIA 1TFIA 1Q16A 4TNUA 2E2HI 1M901 1KC81 1QVFZ 2IZ3A 1YJN1 4NFRA 4A3JI 3CCVZ 3CD6Z 5D1OA 2JIOA 1PFTA 1I6HI 3IFUA 3I56Z 3F3FC 4NBAA 3CCS1 4BBSI 1SFOI 4MD8A 4BY1I 1YJNZ 1K8A2 3S1NI 3IF8A 3CCV1 1VLAA 2F4OA 2AYDA 2F4MA 3PO3S 2LFUA 3NDIA 1P9NA 2P3YA 1KD11 4HH4A 1JWHC 2YADA 3NH8A 1M902 1VQ41 3J80f 2QA41 1VQKZ 3CXCZ 1Q811 5C4XI 3KIHA 5LL6f 1Y8CA 3K7AI 4A3II 1VQ8Z 1VQK1 4Y52I 3M4OI 4NBHA 2OOXB 4RS4A 2JR6A 5AN9F 4NBCA 5IP7I 1Z02A 3GTGI 1VQN1 1RQFA 2OOYB 1X0TA 3VMGA 1USPA 3J7A4 5FLXf 2V8JA 2QA4Z 1YITZ 1K9M2 2KPIA 3G4S1 3M3YI 2Q4ZA 1VQ71 3S1RI 1Y1WI 1JJ2Z 2V45A 4RVGA 4BY7I 2JA7I 3JAMf 1YJWZ 2QRCB 1YJ9Z 2JIRA 3S16I 3GTKI 3G711 2IV2X 1Q861 1WZNA 1K83I 4A3EI 3IR7A 2R93I 3S1QI 1KD12 1N2FA 4QTUA 1SIWA 1ZB9A 1WJ2A 2WB1A 1NJI1 3VMIA 1W2BY 2RIQA 3LUSA 2E9HA 3G71Z 1AA6A 1FDOA 3EEDA 3VB9A 3PO2I 3I4MI 4BXXI 1TWFI 3HOXI 3CCL1 3HOZI 1QF8A 3F3PC 1YHQZ 3NFZA 3NH5A 1Y1VI 4A3BI 2VUGA 4MH4A 2IZ4A 3CCEZ 1QVGY 3P5JB 1VQL1 3CCM1 5CM2M 4BBRI 3CCR1 1YI2Z 1RLYA 3GTJI 3OW2Y 5C4JI 4Y7NI 3HOVI 4A3MI 2VPZA 4NBBA 3I55Z 3CCLZ 4DK1A 4NH1C 2QEX1 3CMA1 2VPWA 3CCQZ 3S17I 1VQLZ 5FLXb 2M48A 4A93I 1Q7Y2 3TE5B 1N8R2 2OTJZ 1S72Z 3GCFA 1W2BZ 3CCSZ 3GTOI 2W03A 1KRLA 1WCMI 2Q51A 1VQO1 3U50C 3CCU1 2B63I 2JNYA 1VQM1 1VQ61 3RZOI 2RT9A 1QVGZ 1Z03A 3I07A 2JA5I 2VUMI 1QXFA 3HKZA 5C44I 3CPWY 3D6WA 5IP9I 3CXCY 1YUAA 4NBGA 3S14I 1VQ6Z 2QKDA 4RVHA 3D2LA 2E2II 1Z01A 3CME1 4NOZA 3I561 4E33A 3J81b 2JA6I 5D1OB 3I4NI 3HOYI 4AYBA 1RNIA 3CC7Z 2JMOA 3VMHA 3FQMA 3GTMI 2NVYI 2OZKA 2K3RA 4A3GI 1JJ2Y 2QEXZ 3CMAZ 1TWAI 2V3VA 4A3LI 4NB9A 1ZH1A 1I3QI 2AKLA 1VQPZ 2E7ZA 3G6EZ 1LQLA 2P28A 2GTHA 1WW9A 5FLMI 1Q821 1K9M1 1VQOZ 1YJW1 1TWHI 2H85A 2VPYA 1NP6A 4E2WA 3D9XA 1S721 1Q7Y1 1K731 2E2JI 2LIYA 3EERA 4MRIA 3RZDI 2QRDB 3CCJ1 1YIJ1 4MD9A 4A3KI 3CCQ1 2J6AA 2WAQA 3GTPI 3TDHB 1X3ZA 3CCJZ 1YIJZ 1USPB 5IT9b 2YU9I 1VQ7Z 4HGYA 2JA8I 2R7ZI 3MZKB 2JIMA 1K8A1 3H3VJ 2BJOA 4A3DI 3CCMZ 4XX2A 3HOUI 2OTJ1 4RV9A 1VQMZ 1FDIA 3CC2Z 2Y0SA 4HGZA 1NJI2 3GKQA 3J81f 3HOWI 3BG1B 1QVFY 1Y1VS 2NVQI 3GTLI 2HU9A 3G6E1 1VQ81 3NH4A 3T4NB 5A2Qf 5D1PA 1QYPA 4E30A 4E2XA 2W04A 2R6MA 2GU2A 1TWGI 3FQQA 4QTTA 2V8IA 4MXUA 1I50I 2K5RA 2PK7A 1N8R1 1VQP1 2PM9A 1RO0A 2QREB 3CC71 3GTMS 1VQ9Z 1YHQ1
chains in the Genus database with same CATH topology
3CMEZ 1Q862 1DL6A 2V8KA 4DQYB 2RPRA 1ZB8A 1KQSZ 3CC4Z 1M1K2 1VQ4Z 3CPWZ 4E31A 1VQ91 3KIFA 2QR1B 5C3EI 1M1K1 3PO3I 2I3CA 4EWCA 3ESWA 4NBFA 1RO4A 3BG0B 2HF1A 3CCUZ 1X3WA 3CQZI 3FKII 3MZLB 1RO2A 2O4HA 1VQ51 3CC21 4X6AI 1S7MA 1L1OC 4A3FI 2KI7B 5A2Qb 3H0GI 4DGLA 2RHBA 4RVDA 3S15I 2VF1A 1KC82 1VQ5Z 3G4SZ 3Q87A 3NDJA 2JS4A 2DE5A 2DE6A 4NBEA 4CL1A 3J80b 2R92I 1YJ91 4NBDA 3VTNA 1YUKA 3I551 1K732 1KQSY 3GTQI 3IX0A 2EGTA 2OTLZ 4NB8A 3QWUA 1TWCI 3CCRZ 1YI21 1R9TI 3CC41 4RVFA 4E2YA 1VQNZ 4S1TA 4E2ZA 1YIT1 1WIIA 4MONA 2M6NA 2O53A 5T6BA 3S2DI 2JUBA 2OTL1 3MONA 4A3CI 2NVXI 3JAMb 2PMZA 2RBLA 1ML8A 3CD61 3CCE1 5IT9f 1Q822 2NVTI 4MD7A 5T64A 1Q812 2DE7A 2G2KA 3S2HI 5T67A 2GTIA 2QLVB 4E32A 3OW2Z 2ZAEB 3S1MI 1NUIA 1TFIA 4TNUA 2E2HI 1M901 1KC81 1QVFZ 2IZ3A 1YJN1 4NFRA 4A3JI 3CCVZ 3CD6Z 5D1OA 1PFTA 1I6HI 3IFUA 3I56Z 3F3FC 4NBAA 3CCS1 4BBSI 1SFOI 4MD8A 4BY1I 1YJNZ 1K8A2 3S1NI 3IF8A 3CCV1 1VLAA 2F4OA 2F4MA 3PO3S 2LFUA 3NDIA 1P9NA 2P3YA 1KD11 4HH4A 1JWHC 2YADA 3NH8A 1M902 1VQ41 3J80f 2QA41 1VQKZ 3CXCZ 1Q811 5C4XI 3KIHA 5LL6f 3K7AI 4Y52I 4A3II 1VQ8Z 1VQK1 3M4OI 4NBHA 2OOXB 4RS4A 2JR6A 5AN9F 4NBCA 5IP7I 1Z02A 3GTGI 1VQN1 1RQFA 2OOYB 1X0TA 3VMGA 1USPA 3J7A4 5FLXf 2V8JA 2QA4Z 1YITZ 1K9M2 2KPIA 3G4S1 3M3YI 2Q4ZA 1VQ71 3S1RI 1Y1WI 1JJ2Z 4RVGA 4BY7I 2JA7I 3JAMf 1YJWZ 2QRCB 1YJ9Z 3S16I 3GTKI 3G711 1Q861 1K83I 4A3EI 2R93I 3S1QI 1KD12 1N2FA 4QTUA 1ZB9A 1NJI1 2WB1A 3VMIA 1W2BY 2RIQA 3LUSA 2E9HA 3G71Z 3EEDA 3VB9A 3PO2I 3I4MI 4BXXI 1TWFI 3HOXI 3CCL1 3HOZI 1QF8A 3F3PC 1YHQZ 3NFZA 3NH5A 1Y1VI 4A3BI 2VUGA 4MH4A 2IZ4A 3CCEZ 1QVGY 3P5JB 1VQL1 3CCM1 5CM2M 4BBRI 3CCR1 1YI2Z 1RLYA 3GTJI 3OW2Y 5C4JI 4Y7NI 3HOVI 4A3MI 4NBBA 3I55Z 3CCLZ 4DK1A 4NH1C 2QEX1 3CMA1 3CCQZ 3S17I 1VQLZ 5FLXb 2M48A 4A93I 1Q7Y2 3TE5B 1N8R2 2OTJZ 1S72Z 3GCFA 1W2BZ 3CCSZ 3GTOI 2W03A 1KRLA 1WCMI 2Q51A 1VQO1 3U50C 3CCU1 2B63I 2JNYA 1VQM1 1VQ61 3RZOI 2RT9A 1QVGZ 1Z03A 3I07A 2JA5I 2VUMI 3HKZA 5C44I 3CPWY 3D6WA 5IP9I 3CXCY 1YUAA 4NBGA 3S14I 1VQ6Z 2QKDA 4RVHA 2E2II 1Z01A 3CME1 4NOZA 3I561 4E33A 3J81b 2JA6I 5D1OB 3I4NI 3HOYI 4AYBA 1RNIA 3CC7Z 2JMOA 3VMHA 3FQMA 3GTMI 2NVYI 2OZKA 2K3RA 4A3GI 1JJ2Y 2QEXZ 3CMAZ 1TWAI 4A3LI 4NB9A 1ZH1A 1I3QI 2AKLA 1VQPZ 3G6EZ 1LQLA 2P28A 2GTHA 1WW9A 5FLMI 1Q821 1K9M1 1VQOZ 1YJW1 1TWHI 2H85A 1NP6A 4E2WA 3D9XA 1S721 1Q7Y1 1K731 2E2JI 2LIYA 3EERA 4MRIA 3RZDI 2QRDB 3CCJ1 1YIJ1 4MD9A 4A3KI 3CCQ1 2J6AA 2WAQA 3GTPI 3TDHB 1X3ZA 3CCJZ 1YIJZ 1USPB 5IT9b 2YU9I 1VQ7Z 4HGYA 2JA8I 2R7ZI 3MZKB 1K8A1 3H3VJ 2BJOA 4A3DI 3CCMZ 4XX2A 3HOUI 2OTJ1 4RV9A 1VQMZ 3CC2Z 2Y0SA 4HGZA 1NJI2 3GKQA 3J81f 3HOWI 3BG1B 1QVFY 1Y1VS 2NVQI 3GTLI 2HU9A 3G6E1 1VQ81 3NH4A 3T4NB 5A2Qf 5D1PA 1QYPA 4E30A 4E2XA 2W04A 2R6MA 2GU2A 1TWGI 3FQQA 4QTTA 2V8IA 4MXUA 1I50I 2K5RA 2PK7A 1N8R1 1VQP1 2PM9A 1RO0A 2QREB 3CC71 3GTMS 1VQ9Z 1YHQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N I;  3HOY I;  3S1Q I;  3S1M I;  1N2F A;  4QTU A;  1NUI A;  3VMH A;  1TFI A;  1DL6 A;  1ZB9 A;  2E2H I;  2NVY I;  3VMI A;  3GTM I;  3LUS A;  1ZB8 A;  4A3J I;  3VB9 A;  3PO2 I;  4A3G I;  3I4M I;  1PFT A;  4BXX I;  1I6H I;  1TWA I;  3GTM S;  1TWF I;  3HOX I;  3HOZ I;  4A3L I;  4NB9 A;  4NBA A;  4BBS I;  5C3E I;  1SFO I;  1I3Q I;  2AKL A;  1Y1V I;  3PO3 I;  1LQL A;  4BY1 I;  3ESW A;  4A3B I;  3S1N I;  4MH4 A;  1WW9 A;  4NBF A;  5FLM I;  1RO4 A;  2HF1 A;  1VLA A;  1X3W A;  3CQZ I;  3FKI I;  2F4O A;  2F4M A;  3PO3 S;  4X6A I;  5CM2 M;  4BBR I;  1TWH I;  1RLY A;  3GTJ I;  2P3Y A;  1L1O C;  4A3F I;  5C4J I;  4Y7N I;  3HOV I;  4A3M I;  3H0G I;  4NBB A;  2E2J I;  3EER A;  3RZD I;  3S15 I;  3S17 I;  3Q87 A;  2JS4 A;  2DE5 A;  4A93 I;  4NBE A;  2DE6 A;  4A3K I;  2J6A A;  2R92 I;  3GTP I;  5C4X I;  1X3Z A;  4NBD A;  3GCF A;  3K7A I;  4Y52 I;  4A3I I;  3GTQ I;  1USP B;  3M4O I;  4NBH A;  2YU9 I;  3GTO I;  4NB8 A;  2JA8 I;  2JR6 A;  2R7Z I;  1TWC I;  1WCM I;  1R9T I;  3H3V J;  2BJO A;  4NBC A;  5IP7 I;  4A3D I;  4XX2 A;  3GTG I;  3U50 C;  3VMG A;  1USP A;  2B63 I;  2JNY A;  3HOU I;  3RZO I;  3HOW I;  3GKQ A;  2KPI A;  3M3Y I;  3S2D I;  1Y1V S;  2NVQ I;  3I07 A;  2JA5 I;  2VUM I;  3S1R I;  3GTL I;  1Y1W I;  4A3C I;  5C44 I;  2NVX I;  3D6W A;  2RBL A;  1QYP A;  4BY7 I;  1ML8 A;  2JA7 I;  5IP9 I;  1YUA A;  1TWG I;  4NBG A;  4QTT A;  3S14 I;  3S16 I;  1I50 I;  2K5R A;  2PK7 A;  2NVT I;  3GTK I;  2E2I I;  2DE7 A;  3S2H I;  4NOZ A;  1K83 I;  4A3E I;  2R93 I;  2JA6 I; 
#chains in the Genus database with same CATH topology
 3CME Z;  1Q86 2;  1DL6 A;  2V8K A;  4DQY B;  2VPX A;  2RPR A;  1ZB8 A;  1KQS Z;  3CC4 Z;  1M1K 2;  1VQ4 Z;  3CPW Z;  4E31 A;  1VQ9 1;  3KIF A;  2QR1 B;  5C3E I;  1M1K 1;  3PO3 I;  2I3C A;  4EWC A;  3ESW A;  4NBF A;  1RO4 A;  3BG0 B;  2HF1 A;  3CCU Z;  1X3W A;  3CQZ I;  3FKI I;  3MZL B;  1RO2 A;  2O4H A;  1VQ5 1;  3CC2 1;  4X6A I;  1S7M A;  1L1O C;  4A3F I;  5A2Q b;  2KI7 B;  3H0G I;  4DGL A;  2RHB A;  4RVD A;  3S15 I;  2VF1 A;  1KC8 2;  1VQ5 Z;  3G4S Z;  3Q87 A;  3NDJ A;  2JS4 A;  2DE5 A;  2DE6 A;  4NBE A;  4CL1 A;  3J80 b;  2R92 I;  1YJ9 1;  4NBD A;  3VTN A;  1YUK A;  3I55 1;  1K73 2;  1KQS Y;  3GTQ I;  3IX0 A;  2EGT A;  2OTL Z;  4NB8 A;  3QWU A;  1TWC I;  3CCR Z;  1YI2 1;  1R9T I;  3CC4 1;  4RVF A;  4E2Y A;  1VQN Z;  4S1T A;  4E2Z A;  1YIT 1;  1WII A;  4MON A;  2M6N A;  2O53 A;  5T6B A;  3S2D I;  2JUB A;  2OTL 1;  3MON A;  2JIP A;  4A3C I;  2NVX I;  3JAM b;  2PMZ A;  2RBL A;  1ML8 A;  3CD6 1;  2NAP A;  3CCE 1;  5IT9 f;  1Q82 2;  2NVT I;  4MD7 A;  5T64 A;  1Q81 2;  2DE7 A;  2G2K A;  3S2H I;  5T67 A;  2LEX A;  2GTI A;  2QLV B;  4E32 A;  2JIQ A;  3OW2 Z;  2ZAE B;  3S1M I;  1NUI A;  1TFI A;  1Q16 A;  4TNU A;  2E2H I;  1M90 1;  1KC8 1;  1QVF Z;  2IZ3 A;  1YJN 1;  4NFR A;  4A3J I;  3CCV Z;  3CD6 Z;  5D1O A;  2JIO A;  1PFT A;  1I6H I;  3IFU A;  3I56 Z;  3F3F C;  4NBA A;  3CCS 1;  4BBS I;  1SFO I;  4MD8 A;  4BY1 I;  1YJN Z;  1K8A 2;  3S1N I;  3IF8 A;  3CCV 1;  1VLA A;  2F4O A;  2AYD A;  2F4M A;  3PO3 S;  2LFU A;  3NDI A;  1P9N A;  2P3Y A;  1KD1 1;  4HH4 A;  1JWH C;  2YAD A;  3NH8 A;  1M90 2;  1VQ4 1;  3J80 f;  2QA4 1;  1VQK Z;  3CXC Z;  1Q81 1;  5C4X I;  3KIH A;  5LL6 f;  1Y8C A;  3K7A I;  4A3I I;  1VQ8 Z;  1VQK 1;  4Y52 I;  3M4O I;  4NBH A;  2OOX B;  4RS4 A;  2JR6 A;  5AN9 F;  4NBC A;  5IP7 I;  1Z02 A;  3GTG I;  1VQN 1;  1RQF A;  2OOY B;  1X0T A;  3VMG A;  1USP A;  3J7A 4;  5FLX f;  2V8J A;  2QA4 Z;  1YIT Z;  1K9M 2;  2KPI A;  3G4S 1;  3M3Y I;  2Q4Z A;  1VQ7 1;  3S1R I;  1Y1W I;  1JJ2 Z;  2V45 A;  4RVG A;  4BY7 I;  2JA7 I;  3JAM f;  1YJW Z;  2QRC B;  1YJ9 Z;  2JIR A;  3S16 I;  3GTK I;  3G71 1;  2IV2 X;  1Q86 1;  1WZN A;  1K83 I;  4A3E I;  3IR7 A;  2R93 I;  3S1Q I;  1KD1 2;  1N2F A;  4QTU A;  1SIW A;  1ZB9 A;  1WJ2 A;  2WB1 A;  1NJI 1;  3VMI A;  1W2B Y;  2RIQ A;  3LUS A;  2E9H A;  3G71 Z;  1AA6 A;  1FDO A;  3EED A;  3VB9 A;  3PO2 I;  3I4M I;  4BXX I;  1TWF I;  3HOX I;  3CCL 1;  3HOZ I;  1QF8 A;  3F3P C;  1YHQ Z;  3NFZ A;  3NH5 A;  1Y1V I;  4A3B I;  2VUG A;  4MH4 A;  2IZ4 A;  3CCE Z;  1QVG Y;  3P5J B;  1VQL 1;  3CCM 1;  5CM2 M;  4BBR I;  3CCR 1;  1YI2 Z;  1RLY A;  3GTJ I;  3OW2 Y;  5C4J I;  4Y7N I;  3HOV I;  4A3M I;  2VPZ A;  4NBB A;  3I55 Z;  3CCL Z;  4DK1 A;  4NH1 C;  2QEX 1;  3CMA 1;  2VPW A;  3CCQ Z;  3S17 I;  1VQL Z;  5FLX b;  2M48 A;  4A93 I;  1Q7Y 2;  3TE5 B;  1N8R 2;  2OTJ Z;  1S72 Z;  3GCF A;  1W2B Z;  3CCS Z;  3GTO I;  2W03 A;  1KRL A;  1WCM I;  2Q51 A;  1VQO 1;  3U50 C;  3CCU 1;  2B63 I;  2JNY A;  1VQM 1;  1VQ6 1;  3RZO I;  2RT9 A;  1QVG Z;  1Z03 A;  3I07 A;  2JA5 I;  2VUM I;  1QXF A;  3HKZ A;  5C44 I;  3CPW Y;  3D6W A;  5IP9 I;  3CXC Y;  1YUA A;  4NBG A;  3S14 I;  1VQ6 Z;  2QKD A;  4RVH A;  3D2L A;  2E2I I;  1Z01 A;  3CME 1;  4NOZ A;  3I56 1;  4E33 A;  3J81 b;  2JA6 I;  5D1O B;  3I4N I;  3HOY I;  4AYB A;  1RNI A;  3CC7 Z;  2JMO A;  3VMH A;  3FQM A;  3GTM I;  2NVY I;  2OZK A;  2K3R A;  4A3G I;  1JJ2 Y;  2QEX Z;  3CMA Z;  1TWA I;  2V3V A;  4A3L I;  4NB9 A;  1ZH1 A;  1I3Q I;  2AKL A;  1VQP Z;  2E7Z A;  3G6E Z;  1LQL A;  2P28 A;  2GTH A;  1WW9 A;  5FLM I;  1Q82 1;  1K9M 1;  1VQO Z;  1YJW 1;  1TWH I;  2H85 A;  2VPY A;  1NP6 A;  4E2W A;  3D9X A;  1S72 1;  1Q7Y 1;  1K73 1;  2E2J I;  2LIY A;  3EER A;  4MRI A;  3RZD I;  2QRD B;  3CCJ 1;  1YIJ 1;  4MD9 A;  4A3K I;  3CCQ 1;  2J6A A;  2WAQ A;  3GTP I;  3TDH B;  1X3Z A;  3CCJ Z;  1YIJ Z;  1USP B;  5IT9 b;  2YU9 I;  1VQ7 Z;  4HGY A;  2JA8 I;  2R7Z I;  3MZK B;  2JIM A;  1K8A 1;  3H3V J;  2BJO A;  4A3D I;  3CCM Z;  4XX2 A;  3HOU I;  2OTJ 1;  4RV9 A;  1VQM Z;  1FDI A;  3CC2 Z;  2Y0S A;  4HGZ A;  1NJI 2;  3GKQ A;  3J81 f;  3HOW I;  3BG1 B;  1QVF Y;  1Y1V S;  2NVQ I;  3GTL I;  2HU9 A;  3G6E 1;  1VQ8 1;  3NH4 A;  3T4N B;  5A2Q f;  5D1P A;  1QYP A;  4E30 A;  4E2X A;  2W04 A;  2R6M A;  2GU2 A;  1TWG I;  3FQQ A;  4QTT A;  2V8I A;  4MXU A;  1I50 I;  2K5R A;  2PK7 A;  1N8R 1;  1VQP 1;  2PM9 A;  1RO0 A;  2QRE B;  3CC7 1;  3GTM S;  1VQ9 Z;  1YHQ 1; 
#chains in the Genus database with same CATH homology
 3CME Z;  1Q86 2;  1DL6 A;  2V8K A;  4DQY B;  2RPR A;  1ZB8 A;  1KQS Z;  3CC4 Z;  1M1K 2;  1VQ4 Z;  3CPW Z;  4E31 A;  1VQ9 1;  3KIF A;  2QR1 B;  5C3E I;  1M1K 1;  3PO3 I;  2I3C A;  4EWC A;  3ESW A;  4NBF A;  1RO4 A;  3BG0 B;  2HF1 A;  3CCU Z;  1X3W A;  3CQZ I;  3FKI I;  3MZL B;  1RO2 A;  2O4H A;  1VQ5 1;  3CC2 1;  4X6A I;  1S7M A;  1L1O C;  4A3F I;  2KI7 B;  5A2Q b;  3H0G I;  4DGL A;  2RHB A;  4RVD A;  3S15 I;  2VF1 A;  1KC8 2;  1VQ5 Z;  3G4S Z;  3Q87 A;  3NDJ A;  2JS4 A;  2DE5 A;  2DE6 A;  4NBE A;  4CL1 A;  3J80 b;  2R92 I;  1YJ9 1;  4NBD A;  3VTN A;  1YUK A;  3I55 1;  1K73 2;  1KQS Y;  3GTQ I;  3IX0 A;  2EGT A;  2OTL Z;  4NB8 A;  3QWU A;  1TWC I;  3CCR Z;  1YI2 1;  1R9T I;  3CC4 1;  4RVF A;  4E2Y A;  1VQN Z;  4S1T A;  4E2Z A;  1YIT 1;  1WII A;  4MON A;  2M6N A;  2O53 A;  5T6B A;  3S2D I;  2JUB A;  2OTL 1;  3MON A;  4A3C I;  2NVX I;  3JAM b;  2PMZ A;  2RBL A;  1ML8 A;  3CD6 1;  3CCE 1;  5IT9 f;  1Q82 2;  2NVT I;  4MD7 A;  5T64 A;  1Q81 2;  2DE7 A;  2G2K A;  3S2H I;  5T67 A;  2GTI A;  2QLV B;  4E32 A;  3OW2 Z;  2ZAE B;  3S1M I;  1NUI A;  1TFI A;  4TNU A;  2E2H I;  1M90 1;  1KC8 1;  1QVF Z;  2IZ3 A;  1YJN 1;  4NFR A;  4A3J I;  3CCV Z;  3CD6 Z;  5D1O A;  1PFT A;  1I6H I;  3IFU A;  3I56 Z;  3F3F C;  4NBA A;  3CCS 1;  4BBS I;  1SFO I;  4MD8 A;  4BY1 I;  1YJN Z;  1K8A 2;  3S1N I;  3IF8 A;  3CCV 1;  1VLA A;  2F4O A;  2F4M A;  3PO3 S;  2LFU A;  3NDI A;  1P9N A;  2P3Y A;  1KD1 1;  4HH4 A;  1JWH C;  2YAD A;  3NH8 A;  1M90 2;  1VQ4 1;  3J80 f;  2QA4 1;  1VQK Z;  3CXC Z;  1Q81 1;  5C4X I;  3KIH A;  5LL6 f;  3K7A I;  4Y52 I;  4A3I I;  1VQ8 Z;  1VQK 1;  3M4O I;  4NBH A;  2OOX B;  4RS4 A;  2JR6 A;  5AN9 F;  4NBC A;  5IP7 I;  1Z02 A;  3GTG I;  1VQN 1;  1RQF A;  2OOY B;  1X0T A;  3VMG A;  1USP A;  3J7A 4;  5FLX f;  2V8J A;  2QA4 Z;  1YIT Z;  1K9M 2;  2KPI A;  3G4S 1;  3M3Y I;  2Q4Z A;  1VQ7 1;  3S1R I;  1Y1W I;  1JJ2 Z;  4RVG A;  4BY7 I;  2JA7 I;  3JAM f;  1YJW Z;  2QRC B;  1YJ9 Z;  3S16 I;  3GTK I;  3G71 1;  1Q86 1;  1K83 I;  4A3E I;  2R93 I;  3S1Q I;  1KD1 2;  1N2F A;  4QTU A;  1ZB9 A;  1NJI 1;  2WB1 A;  3VMI A;  1W2B Y;  2RIQ A;  3LUS A;  2E9H A;  3G71 Z;  3EED A;  3VB9 A;  3PO2 I;  3I4M I;  4BXX I;  1TWF I;  3HOX I;  3CCL 1;  3HOZ I;  1QF8 A;  3F3P C;  1YHQ Z;  3NFZ A;  3NH5 A;  1Y1V I;  4A3B I;  2VUG A;  4MH4 A;  2IZ4 A;  3CCE Z;  1QVG Y;  3P5J B;  1VQL 1;  3CCM 1;  5CM2 M;  4BBR I;  3CCR 1;  1YI2 Z;  1RLY A;  3GTJ I;  3OW2 Y;  5C4J I;  4Y7N I;  3HOV I;  4A3M I;  4NBB A;  3I55 Z;  3CCL Z;  4DK1 A;  4NH1 C;  2QEX 1;  3CMA 1;  3CCQ Z;  3S17 I;  1VQL Z;  5FLX b;  2M48 A;  4A93 I;  1Q7Y 2;  3TE5 B;  1N8R 2;  2OTJ Z;  1S72 Z;  3GCF A;  1W2B Z;  3CCS Z;  3GTO I;  2W03 A;  1KRL A;  1WCM I;  2Q51 A;  1VQO 1;  3U50 C;  3CCU 1;  2B63 I;  2JNY A;  1VQM 1;  1VQ6 1;  3RZO I;  2RT9 A;  1QVG Z;  1Z03 A;  3I07 A;  2JA5 I;  2VUM I;  3HKZ A;  5C44 I;  3CPW Y;  3D6W A;  5IP9 I;  3CXC Y;  1YUA A;  4NBG A;  3S14 I;  1VQ6 Z;  2QKD A;  4RVH A;  2E2I I;  1Z01 A;  3CME 1;  4NOZ A;  3I56 1;  4E33 A;  3J81 b;  2JA6 I;  5D1O B;  3I4N I;  3HOY I;  4AYB A;  1RNI A;  3CC7 Z;  2JMO A;  3VMH A;  3FQM A;  3GTM I;  2NVY I;  2OZK A;  2K3R A;  4A3G I;  1JJ2 Y;  2QEX Z;  3CMA Z;  1TWA I;  4A3L I;  4NB9 A;  1ZH1 A;  1I3Q I;  2AKL A;  1VQP Z;  3G6E Z;  1LQL A;  2P28 A;  2GTH A;  1WW9 A;  5FLM I;  1Q82 1;  1K9M 1;  1VQO Z;  1YJW 1;  1TWH I;  2H85 A;  1NP6 A;  4E2W A;  3D9X A;  1S72 1;  1Q7Y 1;  1K73 1;  2E2J I;  2LIY A;  3EER A;  4MRI A;  3RZD I;  2QRD B;  3CCJ 1;  1YIJ 1;  4MD9 A;  4A3K I;  3CCQ 1;  2J6A A;  2WAQ A;  3GTP I;  3TDH B;  1X3Z A;  3CCJ Z;  1YIJ Z;  1USP B;  5IT9 b;  2YU9 I;  1VQ7 Z;  4HGY A;  2JA8 I;  2R7Z I;  3MZK B;  1K8A 1;  3H3V J;  2BJO A;  4A3D I;  3CCM Z;  4XX2 A;  3HOU I;  2OTJ 1;  4RV9 A;  1VQM Z;  3CC2 Z;  2Y0S A;  4HGZ A;  1NJI 2;  3GKQ A;  3J81 f;  3HOW I;  3BG1 B;  1QVF Y;  1Y1V S;  2NVQ I;  3GTL I;  2HU9 A;  3G6E 1;  1VQ8 1;  3NH4 A;  3T4N B;  5A2Q f;  5D1P A;  1QYP A;  4E30 A;  4E2X A;  2W04 A;  2R6M A;  2GU2 A;  1TWG I;  3FQQ A;  4QTT A;  2V8I A;  4MXU A;  1I50 I;  2K5R A;  2PK7 A;  1N8R 1;  1VQP 1;  2PM9 A;  1RO0 A;  2QRE B;  3CC7 1;  3GTM S;  1VQ9 Z;  1YHQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...