3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
5IP7I 1L1OC 4A3EI 2HF1A 2JS4A 5C4XI 1ML8A 4NBAA 3HOYI 2PK7A 2DE6A 4A3MI 2B63I 2JA5I 2F4MA 3HOZI 4A3DI 3CQZI 3HOUI 2RBLA 4NBBA 2KPIA 3VMGA 3S15I 1Y1VI 1DL6A 3S14I 4A3GI 2JR6A 5IP9I 3H0GI 3S2HI 3LUSA 4NBFA 3VMHA 4NBEA 3GTQI 3HOXI 4QTTA 4BBSI 3GTLI 4A3II 1USPB 3H3VJ 5CM2M 3GTKI 1ZB8A 2P3YA 3S1NI 3PO3I 1N2FA 4QTUA 3GTMI 2VUMI 3GTOI 2J6AA 3GTMS 2R7ZI 3S1QI 1VLAA 1I6HI 4NBHA 3PO3S 1WCMI 4A3FI 3M3YI 4A93I 2JA6I 3Q87A 2JNYA 4A3JI 1K83I 5C44I 1RLYA 3VMIA 3S1MI 2DE7A 1USPA 1TWHI 3S17I 1Y1VS 3K7AI 1R9TI 3RZOI 3GTPI 3S2DI 2R92I 1TWCI 4A3BI 2E2II 1TFIA 3ESWA 4NBDA 4NB9A 1I3QI 1LQLA 2NVYI 3FKII 3I4MI 3VB9A 3RZDI 5C3EI 2NVQI 3HOVI 1TWAI 4Y52I 4BY1I 2R93I 2F4OA 2NVXI 2NVTI 3D6WA 2DE5A 1WW9A 2E2JI 3HOWI 4NBCA 2AKLA 4NBGA 1X3ZA 3S1RI 1I50I 4NOZA 3I4NI 4A3KI 2E2HI 4BXXI 1X3WA 3S16I 3U50C 2JA7I 4XX2A 2YU9I 3GTGI 1SFOI 5C4JI 3M4OI 3GKQA 4NB8A 1QYPA 1PFTA 4MH4A 1Y1WI 4A3CI 3I07A 4A3LI 1NUIA 3PO2I 2BJOA 1RO4A 4X6AI 2K5RA 3EERA 1TWFI 2JA8I 4Y7NI 3GTJI 3GCFA 4BBRI 1ZB9A 1TWGI 5FLMI 1YUAA 4BY7I
chains in the Genus database with same CATH superfamily
2OOYB 3FQMA 1VQLZ 1VQOZ 2Q51A 2JS4A 2V45A 2VPYA 3IR7A 1QVFZ 2NAPA 3I551 3HKZA 3S15I 1Y1VI 3VMHA 4NBEA 1KC81 1KRLA 1KD11 3CCSZ 1S7MA 2RHBA 1FDIA 2I3CA 2LFUA 2P3YA 1WZNA 3S1NI 1S72Z 1N2FA 4QTUA 3IFUA 3TE5B 2QKDA 3MZLB 2R7ZI 4E2XA 3PO3S 2JA6I 3Q87A 1Q812 2R6MA 1Z01A 4EWCA 2VPXA 1K8A1 2Y0SA 1QVGZ 4MXUA 3P5JB 1M1K1 3CC41 3J81b 4MD9A 4NBDA 3VTNA 4NB9A 1I3QI 3G4SZ 1LQLA 2NVYI 3FKII 5C3EI 3JAMf 3CCQZ 1VQNZ 1VQM1 1Q821 4MD7A 3CCS1 4NH1C 2NVXI 2H85A 3D6WA 2E2JI 3IX0A 2AKLA 2JIOA 1VQP1 1W2BY 3CCJ1 2E2HI 4BXXI 3GTGI 3CCL1 2W03A 4E31A 1FDOA 2VPZA 4A3CI 3I07A 4A3LI 4MRIA 1RO4A 1JWHC 3CMA1 5T64A 4DK1A 3GCFA 3NH8A 3G71Z 1ZB9A 5LL6f 1YI2Z 5FLMI 4BY7I 1QVFY 1YJW1 1K731 4DGLA 5IP7I 2HF1A 3J81f 2HU9A 2PK7A 2DE6A 4A3MI 2B63I 2JA5I 2F4MA 3NH5A 3CQZI 2RBLA 1VQL1 4E33A 3VMGA 1M902 1Z02A 1DL6A 3S14I 4A3GI 5IP9I 3D2LA 2KI7B 4QTTA 4BBSI 4A3II 1USPB 4HH4A 1VQ9Z 3FQQA 1Q861 1N8R1 1VQK1 3QWUA 2VUMI 2QRDB 2OTLZ 1VLAA 1Q862 3CMAZ 2JNYA 1P9NA 1VQ8Z 2LIYA 1VQ71 1K83I 2GTHA 5C44I 1RLYA 2DE7A 3CCV1 3CPWY 1TWHI 3S17I 1Y1VS 3K7AI 3RZOI 3GTPI 3CCMZ 2QA41 1YIJZ 1Q7Y1 2WB1A 4RV9A 1ZH1A 1YJ9Z 4RVHA 1VQ51 2GTIA 2OZKA 3I4MI 2P28A 2GU2A 4Y52I 1M901 1RQFA 2R93I 1SIWA 4MONA 3HOWI 4NBCA 1WIIA 1VQKZ 2JIPA 1KQSZ 4NOZA 3CCQ1 1VQN1 3I4NI 3S16I 5FLXb 4XX2A 2YU9I 1QVGY 3NDJA 1K9M1 1VQ6Z 4TNUA 3I56Z 4MH4A 2EGTA 3CMEZ 1Y1WI 1RO0A 1NUIA 3CC4Z 2BJOA 3CXCZ 2OTJ1 2K5RA 5T6BA 2JA8I 1YHQZ 3J7A4 3J80b 3G711 1AA6A 5D1OA 2QA4Z 1YUAA 3F3PC 1QXFA 2IZ4A 1RO2A 3CD61 1L1OC 5T67A 3CME1 1ML8A 4E2ZA 1VQ5Z 3HOYI 3CCEZ 3CC21 4A3DI 2JUBA 1M1K2 4NBBA 1Q822 4RS4A 2JR6A 1YJ91 3H0GI 3S2HI 4NBFA 5AN9F 2V3VA 5CM2M 3GTKI 1ZB8A 1S721 3PO3I 4RVGA 2E9HA 5D1OB 4E30A 3GTOI 2J6AA 3GTMS 3S1QI 4NBHA 2RT9A 1K8A2 3TDHB 3CCJZ 2E7ZA 1Q811 1KD12 3VMIA 4E2WA 2PM9A 1QF8A 2VPWA 4NFRA 2V8JA 3NDIA 3KIHA 1NP6A 4A3BI 2RPRA 2E2II 3ESWA 3CCR1 1VQ41 1YJN1 1RNIA 5D1PA 1KC82 3RZDI 4HGYA 5A2Qb 1KQSY 1TWAI 2PMZA 3HOVI 2QEX1 3I561 2V8KA 3OW2Y 3MZKB 4NBGA 1X3ZA 5A2Qf 3S1RI 1I50I 3I55Z 4A3KI 2JIQA 2JA7I 4CL1A 3NFZA 3CXCY 1SFOI 3CCE1 5C4JI 3CCLZ 2M48A 2O4HA 1PFTA 1WJ2A 1Y8CA 3G4S1 3PO2I 2VUGA 1YJWZ 2IV2X 1TWFI 4E32A 4Y7NI 3IF8A 3G6EZ 1YI21 1K9M2 4DQYB 2OTJZ 1VQ7Z 4A3EI 5C4XI 1VQ4Z 2WAQA 4NBAA 1YJNZ 3CC2Z 2O53A 3HOZI 4MD8A 3BG1B 3HOUI 3MONA 1YIT1 2KPIA 2W04A 4RVDA 2JIMA 3LUSA 3GTQI 2Q4ZA 3HOXI 3GTLI 1JJ2Z 2IZ3A 3H3VJ 3CCU1 1Q7Y2 2ZAEB 3GTMI 1YITZ 1NJI2 1JJ2Y 1I6HI 1X0TA 1WCMI 4A3FI 3M3YI 4A93I 3JAMb 3D9XA 4A3JI 2OOXB 3NH4A 1YUKA 3S1MI 3EEDA 1USPA 3CCVZ 4RVFA 1VQO1 1R9TI 1NJI1 3T4NB 3CCM1 4HGZA 1N8R2 3S2DI 2R92I 2QRCB 3CPWZ 1TWCI 2V8IA 1VQMZ 3OW2Z 1TFIA 1Q16A 3VB9A 1YIJ1 2NVQI 3CD6Z 4BY1I 1W2BZ 2F4OA 3CCRZ 2OTL1 2NVTI 2DE5A 1WW9A 3CC7Z 3BG0B 2QLVB 4S1TA 2QEXZ 1VQ81 2QREB 1X3WA 1VQPZ 3U50C 2VF1A 3CCUZ 1K732 3CC71 5FLXf 4E2YA 3M4OI 3J80f 2JMOA 1YHQ1 3GKQA 2RIQA 4NB8A 2JIRA 2LEXA 1QYPA 2YADA 3F3FC 1VQ91 3KIFA 2G2KA 4X6AI 3EERA 5IT9b 5IT9f 3GTJI 2AYDA 2M6NA 2QR1B 3G6E1 1VQ61 4BBRI 1TWGI 4AYBA 2K3RA 1Z03A
chains in the Genus database with same CATH topology
2OOYB 3FQMA 1VQLZ 1VQOZ 2Q51A 2JS4A 1QVFZ 3I551 3HKZA 3S15I 1Y1VI 3VMHA 4NBEA 1KC81 1KRLA 1KD11 3CCSZ 1S7MA 2RHBA 2I3CA 2LFUA 2P3YA 3S1NI 1S72Z 1N2FA 4QTUA 3IFUA 3TE5B 2QKDA 3MZLB 2R7ZI 4E2XA 3PO3S 2JA6I 3Q87A 1Q812 2R6MA 1Z01A 4EWCA 1K8A1 2Y0SA 1QVGZ 4MXUA 3P5JB 1M1K1 3CC41 3J81b 4MD9A 4NBDA 3VTNA 4NB9A 1I3QI 3G4SZ 1LQLA 2NVYI 3FKII 5C3EI 3JAMf 3CCQZ 1VQNZ 1VQM1 1Q821 4MD7A 3CCS1 4NH1C 2NVXI 2H85A 3D6WA 2E2JI 3IX0A 2AKLA 1VQP1 1W2BY 3CCJ1 2E2HI 4BXXI 3GTGI 3CCL1 2W03A 4E31A 4A3CI 3I07A 4A3LI 4MRIA 1RO4A 1JWHC 3CMA1 5T64A 4DK1A 3GCFA 3NH8A 3G71Z 1ZB9A 5LL6f 1YI2Z 5FLMI 4BY7I 1QVFY 1YJW1 1K731 4DGLA 5IP7I 2HF1A 3J81f 2HU9A 2PK7A 2DE6A 4A3MI 2B63I 2JA5I 2F4MA 3NH5A 3CQZI 2RBLA 1VQL1 4E33A 3VMGA 1M902 1Z02A 1DL6A 3S14I 4A3GI 5IP9I 2KI7B 4QTTA 4BBSI 4A3II 1USPB 4HH4A 1VQ9Z 3FQQA 1Q861 1N8R1 1VQK1 3QWUA 2VUMI 2QRDB 2OTLZ 1VLAA 1Q862 3CMAZ 2JNYA 1P9NA 1VQ8Z 2LIYA 1VQ71 1K83I 2GTHA 5C44I 1RLYA 2DE7A 3CCV1 3CPWY 1TWHI 3S17I 1Y1VS 3K7AI 3RZOI 3GTPI 3CCMZ 2QA41 1YIJZ 1Q7Y1 2WB1A 4RV9A 1ZH1A 1YJ9Z 4RVHA 1VQ51 2GTIA 2OZKA 3I4MI 2P28A 2GU2A 4Y52I 1M901 1RQFA 2R93I 4MONA 3HOWI 4NBCA 1WIIA 1VQKZ 1KQSZ 4NOZA 3CCQ1 1VQN1 3I4NI 3S16I 5FLXb 4XX2A 2YU9I 1QVGY 3NDJA 1K9M1 1VQ6Z 4TNUA 3I56Z 4MH4A 2EGTA 3CMEZ 1Y1WI 1RO0A 1NUIA 3CC4Z 2BJOA 3CXCZ 2OTJ1 2K5RA 5T6BA 2JA8I 1YHQZ 3J7A4 3J80b 3G711 5D1OA 2QA4Z 1YUAA 3F3PC 2IZ4A 1RO2A 3CD61 1L1OC 5T67A 3CME1 1ML8A 4E2ZA 1VQ5Z 3HOYI 3CCEZ 3CC21 4A3DI 2JUBA 1M1K2 4NBBA 1Q822 4RS4A 2JR6A 1YJ91 3H0GI 3S2HI 4NBFA 5AN9F 5CM2M 3GTKI 1ZB8A 1S721 3PO3I 4RVGA 2E9HA 5D1OB 4E30A 3GTOI 2J6AA 3GTMS 3S1QI 4NBHA 2RT9A 1K8A2 3TDHB 3CCJZ 1Q811 1KD12 3VMIA 4E2WA 2PM9A 1QF8A 4NFRA 2V8JA 3NDIA 3KIHA 1NP6A 4A3BI 2RPRA 2E2II 3ESWA 3CCR1 1VQ41 1YJN1 1RNIA 5D1PA 1KC82 3RZDI 4HGYA 5A2Qb 1KQSY 1TWAI 2PMZA 3HOVI 2QEX1 3I561 2V8KA 3OW2Y 3MZKB 4NBGA 1X3ZA 5A2Qf 3S1RI 1I50I 3I55Z 4A3KI 2JA7I 4CL1A 3NFZA 3CXCY 1SFOI 3CCE1 5C4JI 3CCLZ 2M48A 2O4HA 1PFTA 3G4S1 3PO2I 2VUGA 1YJWZ 1TWFI 4E32A 4Y7NI 3IF8A 3G6EZ 1YI21 1K9M2 4DQYB 2OTJZ 1VQ7Z 4A3EI 5C4XI 1VQ4Z 2WAQA 4NBAA 1YJNZ 3CC2Z 2O53A 3HOZI 4MD8A 3BG1B 3HOUI 3MONA 1YIT1 2KPIA 2W04A 4RVDA 3LUSA 3GTQI 2Q4ZA 3HOXI 3GTLI 1JJ2Z 2IZ3A 3H3VJ 3CCU1 1Q7Y2 2ZAEB 3GTMI 1YITZ 1NJI2 1JJ2Y 1I6HI 1X0TA 1WCMI 4A3FI 3M3YI 4A93I 3JAMb 3D9XA 4A3JI 2OOXB 3NH4A 1YUKA 3S1MI 3EEDA 1USPA 3CCVZ 4RVFA 1VQO1 1R9TI 1NJI1 3T4NB 3CCM1 4HGZA 1N8R2 3S2DI 2R92I 2QRCB 3CPWZ 1TWCI 2V8IA 1VQMZ 3OW2Z 1TFIA 3VB9A 1YIJ1 2NVQI 3CD6Z 4BY1I 1W2BZ 2F4OA 3CCRZ 2OTL1 2NVTI 2DE5A 1WW9A 3CC7Z 3BG0B 2QLVB 4S1TA 2QEXZ 1VQ81 2QREB 1X3WA 1VQPZ 3U50C 2VF1A 3CCUZ 1K732 3CC71 5FLXf 4E2YA 3M4OI 3J80f 2JMOA 1YHQ1 3GKQA 2RIQA 4NB8A 1QYPA 2YADA 3F3FC 1VQ91 3KIFA 2G2KA 4X6AI 3EERA 5IT9b 5IT9f 3GTJI 2M6NA 2QR1B 1VQ61 3G6E1 4BBRI 1TWGI 4AYBA 2K3RA 1Z03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  1L1O C;  4A3E I;  2HF1 A;  2JS4 A;  5C4X I;  1ML8 A;  4NBA A;  3HOY I;  2PK7 A;  2DE6 A;  4A3M I;  2B63 I;  2JA5 I;  2F4M A;  3HOZ I;  4A3D I;  3CQZ I;  3HOU I;  2RBL A;  4NBB A;  2KPI A;  3VMG A;  3S15 I;  1Y1V I;  1DL6 A;  3S14 I;  4A3G I;  2JR6 A;  5IP9 I;  3H0G I;  3S2H I;  3LUS A;  4NBF A;  3VMH A;  4NBE A;  3GTQ I;  3HOX I;  4QTT A;  4BBS I;  3GTL I;  4A3I I;  1USP B;  3H3V J;  5CM2 M;  3GTK I;  1ZB8 A;  2P3Y A;  3S1N I;  3PO3 I;  1N2F A;  4QTU A;  3GTM I;  2VUM I;  3GTO I;  2J6A A;  3GTM S;  2R7Z I;  3S1Q I;  1VLA A;  1I6H I;  4NBH A;  3PO3 S;  1WCM I;  4A3F I;  3M3Y I;  4A93 I;  2JA6 I;  3Q87 A;  2JNY A;  4A3J I;  1K83 I;  5C44 I;  1RLY A;  3VMI A;  3S1M I;  2DE7 A;  1USP A;  1TWH I;  3S17 I;  1Y1V S;  3K7A I;  1R9T I;  3RZO I;  3GTP I;  3S2D I;  2R92 I;  1TWC I;  4A3B I;  2E2I I;  1TFI A;  3ESW A;  4NBD A;  4NB9 A;  1I3Q I;  1LQL A;  2NVY I;  3FKI I;  3I4M I;  3VB9 A;  3RZD I;  5C3E I;  2NVQ I;  3HOV I;  1TWA I;  4Y52 I;  4BY1 I;  2R93 I;  2F4O A;  2NVX I;  2NVT I;  3D6W A;  2DE5 A;  1WW9 A;  2E2J I;  3HOW I;  4NBC A;  2AKL A;  4NBG A;  1X3Z A;  3S1R I;  1I50 I;  4NOZ A;  3I4N I;  4A3K I;  2E2H I;  4BXX I;  1X3W A;  3S16 I;  3U50 C;  2JA7 I;  4XX2 A;  2YU9 I;  3GTG I;  1SFO I;  5C4J I;  3M4O I;  3GKQ A;  4NB8 A;  1QYP A;  1PFT A;  4MH4 A;  1Y1W I;  4A3C I;  3I07 A;  4A3L I;  1NUI A;  3PO2 I;  2BJO A;  1RO4 A;  4X6A I;  2K5R A;  3EER A;  1TWF I;  2JA8 I;  4Y7N I;  3GTJ I;  3GCF A;  4BBR I;  1ZB9 A;  1TWG I;  5FLM I;  1YUA A;  4BY7 I; 
#chains in the Genus database with same CATH topology
 2OOY B;  3FQM A;  1VQL Z;  1VQO Z;  2Q51 A;  2JS4 A;  2V45 A;  2VPY A;  3IR7 A;  1QVF Z;  2NAP A;  3I55 1;  3HKZ A;  3S15 I;  1Y1V I;  3VMH A;  4NBE A;  1KC8 1;  1KRL A;  1KD1 1;  3CCS Z;  1S7M A;  2RHB A;  1FDI A;  2I3C A;  2LFU A;  2P3Y A;  1WZN A;  3S1N I;  1S72 Z;  1N2F A;  4QTU A;  3IFU A;  3TE5 B;  2QKD A;  3MZL B;  2R7Z I;  4E2X A;  3PO3 S;  2JA6 I;  3Q87 A;  1Q81 2;  2R6M A;  1Z01 A;  4EWC A;  2VPX A;  1K8A 1;  2Y0S A;  1QVG Z;  4MXU A;  3P5J B;  1M1K 1;  3CC4 1;  3J81 b;  4MD9 A;  4NBD A;  3VTN A;  4NB9 A;  1I3Q I;  3G4S Z;  1LQL A;  2NVY I;  3FKI I;  5C3E I;  3JAM f;  3CCQ Z;  1VQN Z;  1VQM 1;  1Q82 1;  4MD7 A;  3CCS 1;  4NH1 C;  2NVX I;  2H85 A;  3D6W A;  2E2J I;  3IX0 A;  2AKL A;  2JIO A;  1VQP 1;  1W2B Y;  3CCJ 1;  2E2H I;  4BXX I;  3GTG I;  3CCL 1;  2W03 A;  4E31 A;  1FDO A;  2VPZ A;  4A3C I;  3I07 A;  4A3L I;  4MRI A;  1RO4 A;  1JWH C;  3CMA 1;  5T64 A;  4DK1 A;  3GCF A;  3NH8 A;  3G71 Z;  1ZB9 A;  5LL6 f;  1YI2 Z;  5FLM I;  4BY7 I;  1QVF Y;  1YJW 1;  1K73 1;  4DGL A;  5IP7 I;  2HF1 A;  3J81 f;  2HU9 A;  2PK7 A;  2DE6 A;  4A3M I;  2B63 I;  2JA5 I;  2F4M A;  3NH5 A;  3CQZ I;  2RBL A;  1VQL 1;  4E33 A;  3VMG A;  1M90 2;  1Z02 A;  1DL6 A;  3S14 I;  4A3G I;  5IP9 I;  3D2L A;  2KI7 B;  4QTT A;  4BBS I;  4A3I I;  1USP B;  4HH4 A;  1VQ9 Z;  3FQQ A;  1Q86 1;  1N8R 1;  1VQK 1;  3QWU A;  2VUM I;  2QRD B;  2OTL Z;  1VLA A;  1Q86 2;  3CMA Z;  2JNY A;  1P9N A;  1VQ8 Z;  2LIY A;  1VQ7 1;  1K83 I;  2GTH A;  5C44 I;  1RLY A;  2DE7 A;  3CCV 1;  3CPW Y;  1TWH I;  3S17 I;  1Y1V S;  3K7A I;  3RZO I;  3GTP I;  3CCM Z;  2QA4 1;  1YIJ Z;  1Q7Y 1;  2WB1 A;  4RV9 A;  1ZH1 A;  1YJ9 Z;  4RVH A;  1VQ5 1;  2GTI A;  2OZK A;  3I4M I;  2P28 A;  2GU2 A;  4Y52 I;  1M90 1;  1RQF A;  2R93 I;  1SIW A;  4MON A;  3HOW I;  4NBC A;  1WII A;  1VQK Z;  2JIP A;  1KQS Z;  4NOZ A;  3CCQ 1;  1VQN 1;  3I4N I;  3S16 I;  5FLX b;  4XX2 A;  2YU9 I;  1QVG Y;  3NDJ A;  1K9M 1;  1VQ6 Z;  4TNU A;  3I56 Z;  4MH4 A;  2EGT A;  3CME Z;  1Y1W I;  1RO0 A;  1NUI A;  3CC4 Z;  2BJO A;  3CXC Z;  2OTJ 1;  2K5R A;  5T6B A;  2JA8 I;  1YHQ Z;  3J7A 4;  3J80 b;  3G71 1;  1AA6 A;  5D1O A;  2QA4 Z;  1YUA A;  3F3P C;  1QXF A;  2IZ4 A;  1RO2 A;  3CD6 1;  1L1O C;  5T67 A;  3CME 1;  1ML8 A;  4E2Z A;  1VQ5 Z;  3HOY I;  3CCE Z;  3CC2 1;  4A3D I;  2JUB A;  1M1K 2;  4NBB A;  1Q82 2;  4RS4 A;  2JR6 A;  1YJ9 1;  3H0G I;  3S2H I;  4NBF A;  5AN9 F;  2V3V A;  5CM2 M;  3GTK I;  1ZB8 A;  1S72 1;  3PO3 I;  4RVG A;  2E9H A;  5D1O B;  4E30 A;  3GTO I;  2J6A A;  3GTM S;  3S1Q I;  4NBH A;  2RT9 A;  1K8A 2;  3TDH B;  3CCJ Z;  2E7Z A;  1Q81 1;  1KD1 2;  3VMI A;  4E2W A;  2PM9 A;  1QF8 A;  2VPW A;  4NFR A;  2V8J A;  3NDI A;  3KIH A;  1NP6 A;  4A3B I;  2RPR A;  2E2I I;  3ESW A;  3CCR 1;  1VQ4 1;  1YJN 1;  1RNI A;  5D1P A;  1KC8 2;  3RZD I;  4HGY A;  5A2Q b;  1KQS Y;  1TWA I;  2PMZ A;  3HOV I;  2QEX 1;  3I56 1;  2V8K A;  3OW2 Y;  3MZK B;  4NBG A;  1X3Z A;  5A2Q f;  3S1R I;  1I50 I;  3I55 Z;  4A3K I;  2JIQ A;  2JA7 I;  4CL1 A;  3NFZ A;  3CXC Y;  1SFO I;  3CCE 1;  5C4J I;  3CCL Z;  2M48 A;  2O4H A;  1PFT A;  1WJ2 A;  1Y8C A;  3G4S 1;  3PO2 I;  2VUG A;  1YJW Z;  2IV2 X;  1TWF I;  4E32 A;  4Y7N I;  3IF8 A;  3G6E Z;  1YI2 1;  1K9M 2;  4DQY B;  2OTJ Z;  1VQ7 Z;  4A3E I;  5C4X I;  1VQ4 Z;  2WAQ A;  4NBA A;  1YJN Z;  3CC2 Z;  2O53 A;  3HOZ I;  4MD8 A;  3BG1 B;  3HOU I;  3MON A;  1YIT 1;  2KPI A;  2W04 A;  4RVD A;  2JIM A;  3LUS A;  3GTQ I;  2Q4Z A;  3HOX I;  3GTL I;  1JJ2 Z;  2IZ3 A;  3H3V J;  3CCU 1;  1Q7Y 2;  2ZAE B;  3GTM I;  1YIT Z;  1NJI 2;  1JJ2 Y;  1I6H I;  1X0T A;  1WCM I;  4A3F I;  3M3Y I;  4A93 I;  3JAM b;  3D9X A;  4A3J I;  2OOX B;  3NH4 A;  1YUK A;  3S1M I;  3EED A;  1USP A;  3CCV Z;  4RVF A;  1VQO 1;  1R9T I;  1NJI 1;  3T4N B;  3CCM 1;  4HGZ A;  1N8R 2;  3S2D I;  2R92 I;  2QRC B;  3CPW Z;  1TWC I;  2V8I A;  1VQM Z;  3OW2 Z;  1TFI A;  1Q16 A;  3VB9 A;  1YIJ 1;  2NVQ I;  3CD6 Z;  4BY1 I;  1W2B Z;  2F4O A;  3CCR Z;  2OTL 1;  2NVT I;  2DE5 A;  1WW9 A;  3CC7 Z;  3BG0 B;  2QLV B;  4S1T A;  2QEX Z;  1VQ8 1;  2QRE B;  1X3W A;  1VQP Z;  3U50 C;  2VF1 A;  3CCU Z;  1K73 2;  3CC7 1;  5FLX f;  4E2Y A;  3M4O I;  3J80 f;  2JMO A;  1YHQ 1;  3GKQ A;  2RIQ A;  4NB8 A;  2JIR A;  2LEX A;  1QYP A;  2YAD A;  3F3F C;  1VQ9 1;  3KIF A;  2G2K A;  4X6A I;  3EER A;  5IT9 b;  5IT9 f;  3GTJ I;  2AYD A;  2M6N A;  2QR1 B;  3G6E 1;  1VQ6 1;  4BBR I;  1TWG I;  4AYB A;  2K3R A;  1Z03 A; 
#chains in the Genus database with same CATH homology
 2OOY B;  3FQM A;  1VQL Z;  1VQO Z;  2Q51 A;  2JS4 A;  1QVF Z;  3I55 1;  3HKZ A;  3S15 I;  1Y1V I;  3VMH A;  4NBE A;  1KC8 1;  1KRL A;  1KD1 1;  3CCS Z;  1S7M A;  2RHB A;  2I3C A;  2LFU A;  2P3Y A;  3S1N I;  1S72 Z;  1N2F A;  4QTU A;  3IFU A;  3TE5 B;  2QKD A;  3MZL B;  2R7Z I;  4E2X A;  3PO3 S;  2JA6 I;  3Q87 A;  1Q81 2;  2R6M A;  1Z01 A;  4EWC A;  1K8A 1;  2Y0S A;  1QVG Z;  4MXU A;  3P5J B;  1M1K 1;  3CC4 1;  3J81 b;  4MD9 A;  4NBD A;  3VTN A;  4NB9 A;  1I3Q I;  3G4S Z;  1LQL A;  2NVY I;  3FKI I;  5C3E I;  3JAM f;  3CCQ Z;  1VQN Z;  1VQM 1;  1Q82 1;  4MD7 A;  3CCS 1;  4NH1 C;  2NVX I;  2H85 A;  3D6W A;  2E2J I;  3IX0 A;  2AKL A;  1VQP 1;  1W2B Y;  3CCJ 1;  2E2H I;  4BXX I;  3GTG I;  3CCL 1;  2W03 A;  4E31 A;  4A3C I;  3I07 A;  4A3L I;  4MRI A;  1RO4 A;  1JWH C;  3CMA 1;  5T64 A;  4DK1 A;  3GCF A;  3NH8 A;  3G71 Z;  1ZB9 A;  5LL6 f;  1YI2 Z;  5FLM I;  4BY7 I;  1QVF Y;  1YJW 1;  1K73 1;  4DGL A;  5IP7 I;  2HF1 A;  3J81 f;  2HU9 A;  2PK7 A;  2DE6 A;  4A3M I;  2B63 I;  2JA5 I;  2F4M A;  3NH5 A;  3CQZ I;  2RBL A;  1VQL 1;  4E33 A;  3VMG A;  1M90 2;  1Z02 A;  1DL6 A;  3S14 I;  4A3G I;  5IP9 I;  2KI7 B;  4QTT A;  4BBS I;  4A3I I;  1USP B;  4HH4 A;  1VQ9 Z;  3FQQ A;  1Q86 1;  1N8R 1;  1VQK 1;  3QWU A;  2VUM I;  2QRD B;  2OTL Z;  1VLA A;  1Q86 2;  3CMA Z;  2JNY A;  1P9N A;  1VQ8 Z;  2LIY A;  1VQ7 1;  1K83 I;  2GTH A;  5C44 I;  1RLY A;  2DE7 A;  3CCV 1;  3CPW Y;  1TWH I;  3S17 I;  1Y1V S;  3K7A I;  3RZO I;  3GTP I;  3CCM Z;  2QA4 1;  1YIJ Z;  1Q7Y 1;  2WB1 A;  4RV9 A;  1ZH1 A;  1YJ9 Z;  4RVH A;  1VQ5 1;  2GTI A;  2OZK A;  3I4M I;  2P28 A;  2GU2 A;  4Y52 I;  1M90 1;  1RQF A;  2R93 I;  4MON A;  3HOW I;  4NBC A;  1WII A;  1VQK Z;  1KQS Z;  4NOZ A;  3CCQ 1;  1VQN 1;  3I4N I;  3S16 I;  5FLX b;  4XX2 A;  2YU9 I;  1QVG Y;  3NDJ A;  1K9M 1;  1VQ6 Z;  4TNU A;  3I56 Z;  4MH4 A;  2EGT A;  3CME Z;  1Y1W I;  1RO0 A;  1NUI A;  3CC4 Z;  2BJO A;  3CXC Z;  2OTJ 1;  2K5R A;  5T6B A;  2JA8 I;  1YHQ Z;  3J7A 4;  3J80 b;  3G71 1;  5D1O A;  2QA4 Z;  1YUA A;  3F3P C;  2IZ4 A;  1RO2 A;  3CD6 1;  1L1O C;  5T67 A;  3CME 1;  1ML8 A;  4E2Z A;  1VQ5 Z;  3HOY I;  3CCE Z;  3CC2 1;  4A3D I;  2JUB A;  1M1K 2;  4NBB A;  1Q82 2;  4RS4 A;  2JR6 A;  1YJ9 1;  3H0G I;  3S2H I;  4NBF A;  5AN9 F;  5CM2 M;  3GTK I;  1ZB8 A;  1S72 1;  3PO3 I;  4RVG A;  2E9H A;  5D1O B;  4E30 A;  3GTO I;  2J6A A;  3GTM S;  3S1Q I;  4NBH A;  2RT9 A;  1K8A 2;  3TDH B;  3CCJ Z;  1Q81 1;  1KD1 2;  3VMI A;  4E2W A;  2PM9 A;  1QF8 A;  4NFR A;  2V8J A;  3NDI A;  3KIH A;  1NP6 A;  4A3B I;  2RPR A;  2E2I I;  3ESW A;  3CCR 1;  1VQ4 1;  1YJN 1;  1RNI A;  5D1P A;  1KC8 2;  3RZD I;  4HGY A;  5A2Q b;  1KQS Y;  1TWA I;  2PMZ A;  3HOV I;  2QEX 1;  3I56 1;  2V8K A;  3OW2 Y;  3MZK B;  4NBG A;  1X3Z A;  5A2Q f;  3S1R I;  1I50 I;  3I55 Z;  4A3K I;  2JA7 I;  4CL1 A;  3NFZ A;  3CXC Y;  1SFO I;  3CCE 1;  5C4J I;  3CCL Z;  2M48 A;  2O4H A;  1PFT A;  3G4S 1;  3PO2 I;  2VUG A;  1YJW Z;  1TWF I;  4E32 A;  4Y7N I;  3IF8 A;  3G6E Z;  1YI2 1;  1K9M 2;  4DQY B;  2OTJ Z;  1VQ7 Z;  4A3E I;  5C4X I;  1VQ4 Z;  2WAQ A;  4NBA A;  1YJN Z;  3CC2 Z;  2O53 A;  3HOZ I;  4MD8 A;  3BG1 B;  3HOU I;  3MON A;  1YIT 1;  2KPI A;  2W04 A;  4RVD A;  3LUS A;  3GTQ I;  2Q4Z A;  3HOX I;  3GTL I;  1JJ2 Z;  2IZ3 A;  3H3V J;  3CCU 1;  1Q7Y 2;  2ZAE B;  3GTM I;  1YIT Z;  1NJI 2;  1JJ2 Y;  1I6H I;  1X0T A;  1WCM I;  4A3F I;  3M3Y I;  4A93 I;  3JAM b;  3D9X A;  4A3J I;  2OOX B;  3NH4 A;  1YUK A;  3S1M I;  3EED A;  1USP A;  3CCV Z;  4RVF A;  1VQO 1;  1R9T I;  1NJI 1;  3T4N B;  3CCM 1;  4HGZ A;  1N8R 2;  3S2D I;  2R92 I;  2QRC B;  3CPW Z;  1TWC I;  2V8I A;  1VQM Z;  3OW2 Z;  1TFI A;  3VB9 A;  1YIJ 1;  2NVQ I;  3CD6 Z;  4BY1 I;  1W2B Z;  2F4O A;  3CCR Z;  2OTL 1;  2NVT I;  2DE5 A;  1WW9 A;  3CC7 Z;  3BG0 B;  2QLV B;  4S1T A;  2QEX Z;  1VQ8 1;  2QRE B;  1X3W A;  1VQP Z;  3U50 C;  2VF1 A;  3CCU Z;  1K73 2;  3CC7 1;  5FLX f;  4E2Y A;  3M4O I;  3J80 f;  2JMO A;  1YHQ 1;  3GKQ A;  2RIQ A;  4NB8 A;  1QYP A;  2YAD A;  3F3F C;  1VQ9 1;  3KIF A;  2G2K A;  4X6A I;  3EER A;  5IT9 b;  5IT9 f;  3GTJ I;  2M6N A;  2QR1 B;  1VQ6 1;  3G6E 1;  4BBR I;  1TWG I;  4AYB A;  2K3R A;  1Z03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...