3H4ZA

Crystal structure of an mbp-der p 7 fusion protein
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
568
structure length
568
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAADPIHYDKITEEINKAVDEAVAAIEKSETFDPMKVPDHSDKFERHIGIIDLKGELDMRNIQVRGLKQMKRVGDANVKSEDGVVKAHLLVGVHDDVVSMEYDLAYKLGDLHPNTHVISDIQDFVVELSLEVSEEGNMTLTSFEVRQFANVVNHIGGLSILDPIFAVLSDVLTAIFQDTVRAEMTKVLAPAFKKELERNNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein fused with Allergen DERP
publication title The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Allergen
total genus 167
structure length 568
sequence length 568
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF16984 Grp7_allergen Group 7 allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.15.10.50 Alpha Beta Super Roll Bactericidal permeability-increasing protein; domain 1 Bactericidal permeability-increasing protein; domain 1 3h4zA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3h4zA01
2XXIA 4NEDA 1SW4A 4HW8A 3M3KA 1B3LA 2OBGA 2QJEA 4KYDA 3H6VA 3TCFA 5I58B 4ESXA 1B58A 1LCTA 3ILTB 4IY6A 1VE4A 2Q9TA 1BLFA 1NNKA 4F3BA 5KCJB 4OFLA 3SKPA 3KJ7A 4RXLA 3PUVE 3EPEA 4IO3A 2QMXA 1DPPA 4F1VA 3ZKKA 4ISUA 1I6BA 5DVFA 1EH3A 3OENA 4R9GA 2ONRA 5AE4A 3LC8A 3UN6A 3MAMA 3FVOA 3C31A 3MZBA 2B3FA 1CE2A 1B5HA 1AOVA 1UTHA 3C33A 3MJNA 1MQIA 1ZKBA 4R6HA 3C32A 1UTBB 1M5DA 5H8NB 1MY2A 2Q2CA 3SETA 4PFWA 1LFGA 2ZYKA 1SYIA 4EXLA 4L17A 1MS7A 1IEJA 3DP8A 1B51A 2REJA 3FJ7A 4PQJA 1Y9UA 2DWAA 2D5WA 2VHAA 1SW2A 4X9TA 5DEXB 2HAVA 1R9LA 5H8FA 2QPQA 1DOTA 1XVXA 3TMGA 2I4BA 5TU0A 4GWOA 2H5YA 1Y4TA 4OHNA 1M5FA 1P1WA 3IB1A 3G3KA 1M5BA 3PMXA 4M1VA 1MG1A 3D4GA 4R74A 4YKPA 3TTMA 2IA4A 3E4RA 3R26A 3I6VA 4U4SA 3CSBA 2RF1A 4LZ7A 3IO6A 3L6HA 5DVJA 4TLLB 4C1TA 1EZOA 3E13X 3N6TA 5I58A 4GFRA 4RYAA 4U22A 2E0SA 2F35A 5KCJA 3VLWA 3VLVA 4RK9A 3CVGA 1QUJA 1URGA 3HHGA 4U23A 4ZEKA 3FJGA 3SEUA 1XC1A 3HHFA 2O68A 1UQWA 3BFUA 2Q89A 1WODA 4X1DA 1LAFE 1I69A 1Y20A 4LZ5A 3F11A 3THIA 1ZMGA 1MM7A 1GTKA 5CI5A 3QUJA 2WKYA 1MM6A 4N07A 3CI8A 1B5JA 4JSOA 2QL3A 4G68B 4KI0E 3QK6A 4POXA 3LR1A 3ZSFA 2XX8A 2G93A 1Y1MA 2X7QA 3G3JA 2O7IA 4JWYA 1MXZA 1N84A 2Y7KA 3FV1A 2FYIA 1JVXA 2XX7A 4OYVA 2I6EA 1UTBA 2F8DA 3PMWA 5H8NA 4RNSA 4UACA 3MUQA 4OWDA 3LUYA 2ESNA 4DCXA 1N7XA 1A99A 1MQDA 4FECA 3RN8A 1BIYA 4JDFA 2DP8A 1JEVA 4FEBA 5AA1A 5AA2D 4NE4A 1N0TA 4F2OA 3OSQA 3CRBA 2R6GE 2RKMA 3AXFA 1B05A 5BUUA 4UA8A 4GIZA 4XTCQ 5DEXA 5DTBA 4DLDA 1NMUA 1MDQA 1II5A 3DLNA 4ELRA 3IL1B 5LOMA 3N5LA 5I2KB 3BFTA 3RNNA 4JSDA 3IR1A 2Z23A 1B9JA 1B3EA 3N6UA 4ONYA 1JQFA 2ZYMA 3PU5A 2DXYA 3EHSA 1HSJA 3TODA 2PMSA 1A8EA 1MQHA 4YKIA 2O51A 3MPKA 3O66A 4R9FA 1DMBA 1I6QA 2O7UA 4R6YA 1TWYA 4XIGQ 4DXCA 1N04A 2M8CA 1Z7ME 1O64A 3TELA 4ELQA 4EF1A 1USYE 1JEUA 2ZNSA 3C4MA 4IY5A 1PB8A 1RKMA 3O28A 3KOSA 3MW0A 3IJXB 3T9UA 3OOAA 1LB9A 4FIMA 3PPNA 3K6UA 3SEXA 4YB7A 3U92A 3UP9A 1D9VA 5H8QB 4NWDA 3O9PA 4FORA 1RYXA 4ZZEA 1LB8A 2REGA 4QFOA 4HTGA 1Y3QA 4G68A 1I6AA 4RY1A 3FVNA 3IOVA 3PPRA 3MP6A 2HXWA 1SDXA 1Q35A 2YPNA 2ZNTA 1AIVA 3FXQA 4F2QA 4QFKA 1BP5A 3MVZA 1D4NA 1A7LA 1FTOA 1JW1A 4XXUA 5I2NA 3LSWA 4HCYA 4IGTA 1A55A 5K2XA 5JK4A 3OD7A 4R72A 2UVJA 1AH5A 3FV2A 4GQOA 4ZEIA 1LAHE 2V3QA 1FCKA 3TTLA 3N26A 1LGBC 4RJZA 2F36A 3IO4A 4YZZA 3H3GA 1MPCA 3C34A 1FTKA 3FATA 1A54A 3PGFA 2OZZA 4GL8A 1GGGA 3ONMA 1EZ9A 5H8FB 1LSTA 1NKXA 3DELB 4PFYA 5CMMA 5I2KA 3LSLA 3KSXA 4ZE8A 4EQ7A 2LAOA 1Y4CA 2DOJA 1B7HA 2OWSA 4MLVA 3GXAA 3EN3A 3MZ9A 4JXIA 2ANJA 4P0IA 4HCWA 4ZEFA 1URSA 4QF9A 2FNCA 1B3GA 2O1MA 4BDNA 4ZDMA 1EU8A 1LFIA 3MZ1A 2UVGA 3B7DA 1PBPA 3MWBA 5ISUA 4DXBA 4F3PA 4LVQA 3TAJA 3S2VA 3H6UA 4WEDA 1QUKA 3Q28A 2Q2AA 1OLAA 5JTYB 2I49A 1B0HA 2DSFA 1O7TA 3CFLA 3OELA 1XOCA 5H8QA 3S9NC 3U1OA 2XXRA 4OXVA 3TCHA 3A3CA 4QRZA 2DE3A 2H25A 4YB5A 3K01A 2F7CA 3RQTA 1MH4A 3KBRA 1ZLQA 4OERA 2PVUA 2A5TB 3U93A 3CSGA 3TEPA 1ELJA 4YICA 3T93B 3SEWA 3H6TA 2OJTA 4KQPA 4MLQA 3IORA 4LA9A 3PPOA 4U4XA 1WVJA 2D21A 3UA8A 2XXTA 1MQGA 1JW5A 2F7BA 4I1DA 2DWJA 3T9HB 4LONB 4TOZA 2NOOA 3C9HA 4JWXA 3L6GA 4BDRA 3V89B 3T96B 4EQ9A 5CBRA 4OENA 2VD3A 4RK2A 1VFDA 2DYXA 1MXXA 3S9LC 1SBPA 2PBWA 3PUZE 3ZKLA 3OEKA 4KCDA 4LUBA 1TXFA 5JEIA 2HZLA 1SW1A 3N94A 3FGSA 3VXCA 4O3BA 3TQWA 5A5XB 3QYTA 3TTKA 1B5IA 3TDJA 1R9QA 3PD8A 1US4A 3DP6A 5B7DA 4LQ5A 2NUVA 4C1UA 1P1QA 2GHBA 3MBPA 1PDAA 2F6GA 4ZECA 1USYH 2QS2A 4ECFA 1NNFA 3H7MA 4NF6B 4GL0A 1B3HA 3W9VA 4YKJA 3MPLA 3IJOB 1P1NA 3TUSA 4TLMB 4H0WA 3LSFB 2F6PA 3A3UA 3HN0A 2DQVA 3VV5A 5FHMA 2BJJX 4ELOA 4JB7A 1LLSA 4GXSB 3JV9A 4BLAA 1OQGA 1QJMA 3WAFA 2H9BA 3VVDA 4XKPA 2O6AA 1R1NA 1B7UA 1N3WA 2F7AA 1F9BA 2DWHA 2AL4A 4OEUA 1Y3NA 3B6WA 5JTYA 4NF8B 2FA7A 3T9XB 3K1NA 4N13A 4R73A 1MDP1 1IQ7A 2DVZA 3I5OA 2V93A 5L9SA 5I56B 3OO7A 2DE2A 2XXQA 3LSXA 4G2ZA 4JWOA 2XD3A 4NWCA 5KDTB 1FQAA 4PFUA 1B1XA 3IOUA 2A5TA 4H5GA 1PB7A 4F29A 4O3AA 4I9DA 4X48A 1KWHA 3EHTA 4ZE9A 1B7ZA 3RT8A 4NMYA 5I59B 4U21A 4E0XA 4G4PA 5FHOA 3KJTA 3DP4A 4ZZAA 3VLUA 5I2NB 2NWJA 1IXIA 4H5FA 1LAGE 3KG2A 3OXNA 2QRYA 2UVIA 3MP1A 4JBZA 3FVKA 4MBPA 1H76A 3OO6A 2Q88A 4E0WA 1Z7NE 1MY1A 3E3KA 2HEUA 3K1MA 4KD5A 4MH5A 1QKAA 5CMCA 4WXJA 1NH8A 3B6QA 1ZJLA 5I84A 1QKBA 3HCQA 5A5XA 2PYYA 3TKDA 2Y7PA 4EQBA 1IUDA 3MVXA 2VGQA 1NH7A 3KN7A 2W7YA 2CZLA 2ZNUA 3TTRA 3QUFA 4QSDA 1S7YA 1P99A 2Z8FA 1BTJA 2YLNA 3USDA 3ILUB 1OLCA 1SI0A 2Z8EA 5HBCA 3PMVA 4NF6A 4OFJA 2O84X 3TYHA 3O6IA 4EF2A 1SQYA 3JZJA 4R2BA 2I3WA 4PFTA 4OEVA 2UYFA 2IEEA 3OO8A 4QFNA 3GBBA 2XHDA 3G3IA 2P0SA 2RC9A 1SYHA 1D3KA 3OO9A 1UIUA 2VD2A 4G8NA 5M2VA 1MXUA 3TTNA 2XXUA 2R9JA 3T22A 2G29A 3CIJA 3VDFA 3E9XA 4U1OA 5BWJA 4RA1A 4NF8A 1SVXB 3UORA 3V8XB 4EDPA 2Y7WA 3W9WA 3KOTA 1LBCA 5FHNA 4EUOA 2ZMBA 2F34A 5I56A 3P7IA 1ZBMA 1FQCA 5AA4B 5KDTA 3IOWA 1JW4A 3HV1A 4XKRA 4Z7EA 4ZS9A 1MY4A 2AIXA 4AB5A 4OFOA 4F31B 2I4CA 3VE1B 1H3DA 3GLBA 4RPOA 2PX1A 5CBSA 4Q8RA 4NTLA 2OLBA 4KCCA 2HZKA 2QS1A 1SW5A 1TFDA 2B65A 4F3SA 5I59A 3H4ZA 1M5EA 4H1XA 4C0RA 3JYRA 2QSXA 3K1PA 5L8DA 1MY0A 1LAXA 2ZYNA 4IO7A 3UK4A 3MC2A 1AL3A 1B1HA 2THIA 3LBSA 1POY1 2RC7A 4FE8A 4H6DA 5ELVA 2QMWA 5I57B 4YU0A 5ITPA 5DVIA 3RUMA 4AB6A 3PV0E 3UIFA 3FXRA 2NXOA 1FQEA 5IAIA 1H44A 4PP0A 1P1UA 1NL5A 2R71A 4ND9A 4G8HA 3QXMA 4IGRA 1B46A 1US5A 4NF4B 2ZYOA 4YKKA 4PE5B 3EQ1A 5TP9B 1B0LA 1TT1A 5CMBA 2F97A 3RTWB 2DVCA 1MQJA 4KYSA 3MP8A 1URDA 2OK2A 1L5TA 2VP1A 1O63A 3KGCA 1ZU0A 4ZEBA 1NFTA 2XXVA 4GF8A 5CM6A 1QUIA 3DM0A 3KN3A 1FQFA 1VFEA 1PB9A 2I48A 5DT6A 2Q8JA 4DXUA 2RCBA 2H4IA 4OZ9A 3T9VA 3I3VA 2HAUA 3KZGA 3CG1A 2GHAA 2I58A 2QS4A 3UV1A 5ICQA 5K2YA 4Q5TA 3CG3A 3O29A 1B2HA 4F18A 5CMKA 1POTA 3M8UA 2PT1A 1S9TA 2RINA 5CC2A 1XHYA 1B6HA 3K2DA 4KFQA 5AA4A 3GBAA 2OCUA 2Y7RA 1IXHA 1Y1ZA 4LZ8A 2ONKE 1D9YA 1GV8A 1WDNA 4F22A 3UGWA 3K02A 1J1NA 1DTGA 3ZS6A 2DWIA 4QFPA 3FJMA 1XT8A 4N6PA 2UYEA 3EF7A 2XXPA 4NF5B 2KLFA 3MVWA 1RYOA 1MPDA 4MF3A 4GRKA 3A09A 4R75A 3K6WA 1QULA 3PUWE 3O97A 2XXYA 1SD3A 4LATA 1Q1KA 1Y3PA 2CMOA 1A40A 4KR5A 4BDQA 3FXUA 4PETA 5IKBA 5I57A 1YTVA 1N76A 4M4GA 3OSRA 3QSLA 4IB2A 3S4UA 3CR9A 1FW0A 1AMFA 3RPWA 1ZTYA 2DE4A 3K00A 4NF4A 4OMBA 1M5CA 5TP9A 1OIBA 4IO4A 3W15C 4GOTA 3K6VA 3O2AA 1P1OA 5TPAB 3PPQA 3SDFA 3KFMA 3U8QA 4WKMA 2OWTA 3SEYA 4H65A 1JNFA 4BDLA 2F78A 1IXGA 2X7PA 5FTHA 3PUXE 3EHUA 1FQDA 2P1SA 3RTFB 1CB6A 1IITA 1R6ZA 2XD2A 1NNTA 4G68C 3FZVA 1B4HA 4GXAA 3TCGA 5HM4B 1DTZA 4P11A 2HFBA 1FQBA 4DE8A 4THIA 3KSJA 2Z22A 1HSLA 1DSNA 2XX9A 4YMAA 1VSOA 3FASA 4YMBA 5J1DA 3FD3A 3R7XA 2X26A 1DPEA 2UXAA 1XS5A 4FJPA 4I62A 2A5SA 5L9MA 3G7WA 3B6TA 4OETA 1MRPA 3FVGA 4H67A 4Q0CA 4XKQA 1MPBA 4R6KA 2DS9A 5KZTA 4OTEA 4IO5A 3HPIA 4WEPA 3BBRA 4KHZE 4IO2A 1H45A 2UVHA 2H98A 3M3LA 4KYEA 2D3IA 3MQ9A 4OESA 4K3FA 2QS3A 2HQ0A 5HPQA 3BKIB 4BDOA 3IB2A 3FUZA 4NF5A 1JVYA 3H06B 3IK6B 2GFEA 1BKAA 5EHSA 4OQOA 5FTIA 3G3GA 2RC8A 3RGYA 4BDMA 3RLFE 5ICTA 1FTJA 2HCAA 4G77A 3TFLA 3Q29A 2XXHA 2I3VA 3GZGA 1OQHA 5ITOA 4DIGA 5L9OA 3O6HA 3HSTA 2O69A 3H03A 2GRVA 3M3FA 5H8SA 4IO6A 2V25A 1B52A 3IB0A 3QIMA 4DDDA 4F19A 2E1SA 4G8MA 4YAHX 4H8IA 4ZEDA 1B3FA 3MVYA 4QHQA 1T0KA 1LBBA 4DZ1A 1QW0A 5TPAA 1MY3A 4I8CA 3TQLA 2Z8DA 2O1LA 5H8HB 1SI1A 3PD9A 1IZ1A 1FTMA 1TFAA 3IAZA 3K6XA 1LFHA 1FTLA 5CRYA 2XXXA 3R6UA 4QSCA 5AA2B 4ESWA 2ZXTA 2B3BA 1YAEA 3D4CA 5B70A 2I0BA 4U2RA 3VXBA 1OVTA 3U72A 4POWA 2ABHA 4FEDA 1JETA 3IX1A 3SESA 4LP2B 3QAXA 4U1ZA 4P0GA 2I0CA 1LCFA 4QSEA 5EYFA 1OVBA 1B32A 3ECRA 1N3XA 3VVFA 3K4UA 3OMBA 3VVEA 4H8JA 4R2FA 1MH3A 1VR5A 1ZIUA 4HS7A 2AYSA 4YB6A 3G3FA 3Q27A 2P2AA 1YCJA 4F39A 1S50A 3U94A 4FAJA 2YJPA 3S9MC 2F5XA 3TZAA 1ANFA 3C36A 1EZPA 4ELPA 1B40A 1GR2A 5EHMA 4Q30B 3RY3A 1B4ZA 5F1QA 4F1YA 4GLIA 1OMPA 2PT2A 3FIRA 4F1UA 4QFLA 1UTHB 1NNPA 1QVSA 5DYHA 1HSEA 4LQ2A 1N7WA 2XXWA 4OVJA 1MXVA 1YPNA 3PUYE 1H43A 3CFZA 3HO7A 3VFJA 2V84A 1PEBA 2Y84A 2AL5A 4GVOA 3IOTA 3CFXA 5F7VA 3TPAA 3T66A 1MXYA 4KPTA 4O3CA 3V5AA 3Q26A 3K0VA 2DXRA 3WAEA 2VOZA 3SEVA 1XVYA 5AA3A 4X1BA 3Q25A 1UIVA 4F3GA 4EXKA 1PBQA 1ATGA 2NVUB 3V83A 4XKNA 3C35A 3PPPA 4TQUQ 4Z0IA 1MXWA 2V3UA 2Y7IA 3KEIA 1IXCA 5H8HA 4RPNA 1PC3A 3KN8A 2ALUA 1IIWA 1GVCA 3SERA 4MFIA 3ODBA 2GH9A 2V3TA 3RT6B 5AA2A 1A8FA 2H99A 4DCYA 2ONSA 3H6WA 4AQ4A 4FATA 4GD5A 2RCAA 3G3HA 3S9EA 3O6GA 3OEMA
chains in the Genus database with same CATH superfamily
2XXIA 4NEDA 5EYGA 4MEVA 1SW4A 4HW8A 3M3KA 1B3LA 2OBGA 2RQFA 2QJEA 1LBWA 4KYDA 3H6VA 3TCFA 5I58B 4PAIA 4ESXA 1B58A 1LCTA 3ILTB 4IY6A 1VE4A 2Q9TA 1BLFA 1NNKA 4F3BA 4QBAA 5KCJB 4OFLA 3SKPA 3KJ7A 4RXLA 4MNPA 3PUVE 3EPEA 5I7LA 4IO3A 2QMXA 2Y5LA 1DPPA 5IM2A 4F1VA 3ZKKA 4ISUA 1I6BA 5DVFA 1EH3A 4PFBA 3OENA 1FPEA 4R9GA 2ONRA 5AE4A 3LC8A 3UN6A 3MAMA 3FVOA 3C31A 4NX1A 3MZBA 2B3FA 1CE2A 1B5HA 1AOVA 4PAFA 1UTHA 3C33A 3MJNA 1MQIA 1ZKBA 4N8GA 4R6HA 3C32A 1UTBB 1M5DA 5H8NB 1FBFA 1MY2A 4NAPA 2Q2CA 3SETA 1AWBA 4PFWA 1LFGA 2ZYKA 1SYIA 4EXLA 4L17A 5I5PA 1MS7A 1IEJA 3DP8A 1B51A 1VDWA 2L5VA 2REJA 3FJ7A 4PQJA 1Y9UA 3T1BA 2DWAA 4DI4B 1LBVA 2D5WA 2VHAA 1SW2A 5IZZA 4X9TA 5DEXB 2HAVA 3QMFA 1R9LA 5H8FA 2QPQA 1DOTA 1XVXA 3TMGA 2I4BA 5TU0A 4GWOA 2H5YA 1Y4TA 4P56A 4OHNA 1M5FA 1NV7A 1P1WA 3IB1A 3D1RA 3G3KA 4IR8A 1M5BA 3PMXA 4M1VA 1MG1A 3D4GA 4R74A 4YKPA 3TTMA 4GWZA 2IA4A 3A1ZA 3E4RA 3R26A 3I6VA 4U4SA 3CSBA 2RF1A 4LZ7A 3IO6A 3L6HA 5DVJA 3FBPA 4MNCA 4TLLB 4C1TA 1EZOA 3E13X 3N6TA 5I58A 4GFRA 4RYAA 4U22A 4HE0A 3IFAA 2E0SA 2F35A 5KCJA 1JP4A 3VLWA 2FBPA 3VLVA 4RK9A 3CVGA 1QUJA 1URGA 3HHGA 4U23A 4ZEKA 3FJGA 3SEUA 1XC1A 3HHFA 2O68A 1UQWA 3PTYA 3BFUA 2Q89A 4X8RA 1WODA 4X1DA 1LAFE 1I69A 1Y20A 4LZ5A 3F11A 3THIA 1ZMGA 1MM7A 1GTKA 5CI5A 1LBZA 3QUJA 2WKYA 1MM6A 4N07A 3CI8A 1B5JA 4JSOA 2QL3A 4MX6A 4G68B 4KI0E 3QK6A 4POXA 3LR1A 3ZSFA 2XX8A 2G93A 1Y1MA 2X7QA 3G3JA 2O7IA 4JWYA 1MXZA 1N84A 2Y7KA 3FV1A 2FYIA 1JVXA 2XX7A 4OYVA 2I6EA 1UTBA 2F8DA 1FPFA 3PMWA 5H8NA 4OVTA 1DBZA 4RNSA 4UACA 3MUQA 4OWDA 3LUYA 3ROJA 2ESNA 4DCXA 1N7XA 1A99A 1MQDA 4P47A 4FECA 5EYHA 3RN8A 1BIYA 5T3JA 4JDFA 2DP8A 1JEVA 4FEBA 5AA1A 1N0TA 4NE4A 5AA2D 4P3LA 4F2OA 3OSQA 4PE3A 3CRBA 2R6GE 2RKMA 1FBDA 3AXFA 1EYJA 4G61A 1B05A 2CEYA 2MKZA 5BUUA 4UA8A 4GIZA 2F3BA 2FHYA 4XTCQ 5DEXA 5DTBA 4DLDA 4OA4A 1NMUA 1MDQA 1II5A 3DLNA 4ELRA 3IL1B 1FTAA 5LOMA 3N5LA 5I2KB 3BFTA 3RNNA 4JSDA 3MYUA 3IR1A 2Z23A 1B9JA 3KC0A 1B3EA 3N6UA 4ONYA 1JQFA 2ZYMA 3B8BA 3PU5A 2WBDA 2DXYA 3EHSA 4O8MA 1HSJA 3TODA 2PMSA 1A8EA 1MQHA 4YKIA 2O51A 3MPKA 3O66A 4R9FA 1DMBA 1I6QA 2O7UA 4G0SA 4R6YA 1TWYA 4XIGQ 4DXCA 1N04A 2M8CA 1Z7ME 1O64A 3TELA 4KGOA 4ELQA 4EF1A 4NGUA 1USYE 1JEUA 2ZNSA 4PCDA 3C4MA 4IY5A 1PB8A 1RKMA 3O28A 3KOSA 3MW0A 3IJXB 3T9UA 3OOAA 1LB9A 4FIMA 3PPNA 3U65A 3K6UA 3SEXA 4YB7A 3U92A 3UP9A 1D9VA 5H8QB 2V4CA 4NWDA 3O9PA 4OVQA 4FORA 4JVIA 1RYXA 4UABA 3E79A 4ZZEA 1LB8A 2REGA 4QFOA 1G0HA 4HTGA 1Y3QA 2QVRA 4PBHA 4G68A 4P9KA 1I6AA 4RY1A 3FVNA 3IOVA 2XXKA 3PPRA 4GX6A 4NN3A 3MP6A 1FPIA 2HXWA 1SDXA 1Q35A 2YPNA 2ZNTA 1AIVA 3FXQA 4F2QA 4QFKA 1BP5A 3MVZA 1D4NA 1A7LA 1FTOA 1JW1A 4XXUA 5I2NA 3LSWA 4HCYA 4IGTA 1A55A 5K2XA 5JK4A 3OD7A 4R72A 4MMPA 1IMEA 2UVJA 1AH5A 4MIJA 3FV2A 4GQOA 4ZEIA 1LAHE 2V3QA 1FCKA 3TTLA 3N26A 1FBCA 1LGBC 4PFRA 4RJZA 2F36A 3IO4A 4YZZA 2VT5A 2RCKA 3H3GA 1MPCA 3C34A 1FTKA 1EYKA 3FATA 1A54A 1FPGA 3PGFA 3E78A 2OZZA 4GL8A 1GGGA 3ONMA 1EZ9A 5H8FB 3CHGA 1LSTA 1NKXA 3DELB 4PFYA 5CMMA 5I2KA 3LSLA 3KSXA 1RDXA 2WX9A 4ZE8A 4EQ7A 2LAOA 1EWFA 1Y4CA 2DOJA 1B7HA 4MNIA 2OWSA 4MLVA 3GXAA 2XWOA 3EN3A 4O7MA 4GWYA 3MZ9A 4JVDA 4JXIA 2ANJA 4P0IA 4GBWA 4HCWA 4ZEFA 1URSA 4QF9A 2FNCA 1B3GA 2O1MA 4BDNA 4ZDMA 1EU8A 1LFIA 3E8TA 3MZ1A 2UVGA 3B7DA 2Q8MA 1PBPA 3MWBA 5ISUA 4DXBA 2FIXA 4F3PA 4LVQA 3TAJA 3S2VA 4NF0A 3H6UA 4WEDA 1QUKA 3ISPA 3Q28A 1NUYA 2Q2AA 1OLAA 2HXRA 5JTYB 2I49A 1B0HA 2DSFA 5EQ8A 4MJOA 1O7TA 3CFLA 3OELA 4P1LA 1XOCA 5H8QA 3S9NC 3U1OA 2XXRA 4OXVA 3TCHA 3A3CA 4QRZA 5ET7A 2DE3A 2H25A 4YB5A 3K01A 2F7CA 3RQTA 1YYZA 1MH4A 3KBRA 1ZLQA 4OERA 2PVUA 2A5TB 3U93A 3CSGA 3TEPA 1ELJA 1FBHA 4YICA 3T93B 3SEWA 3H6TA 2OJTA 4KQPA 5J16A 4MLQA 3IORA 1FPDA 4LA9A 2HPGA 3PPOA 4LN5A 4U4XA 1G0IA 1YXIA 1WVJA 2D21A 3UA8A 2XXTA 3LV0A 4X04A 4PF6A 1MQGA 2WBBA 1JW5A 2F7BA 4I1DA 2DWJA 3T9HB 5I3SA 5ET5A 4LONB 2CZHA 4TOZA 2NOOA 3C9HA 4JWXA 1DCUA 3L6GA 2PFYA 2P3VA 3T96B 3V89B 4BDRA 4EQ9A 5CBRA 4F2AA 4OENA 2VD3A 4RK2A 1VFDA 2JJKA 2DYXA 1MXXA 4JVCA 3S9LC 1SBPA 2PBWA 3PUZE 3ZKLA 3OEKA 4KCDA 4LUBA 1TXFA 5JEIA 2HZLA 2DDKA 1SW1A 3N94A 3IFCA 3FGSA 3VXCA 4O3BA 4AS5A 3TQWA 5A5XB 3QYTA 3TTKA 1B5IA 3TDJA 1FBGA 1R9QA 3PD8A 1US4A 3DP6A 5B7DA 3BIGA 4LQ5A 2NUVA 4C1UA 1P1QA 1NV4A 2GHBA 3MBPA 1PDAA 2F6GA 4ZECA 1USYH 2QS2A 3E8WA 4ECFA 1NNFA 2KQZA 3H7MA 4NF6B 4GL0A 1B3HA 3W9VA 4YKJA 3MPLA 3IJOB 4XF5A 1P1NA 3TUSA 4TLMB 3N72A 2KR0A 4H0WA 3LSFB 2F6PA 3A3UA 4GBVA 3HN0A 5EQ9A 1KA1A 2DQVA 3VV5A 5FHMA 2BJJX 4N8YA 4ELOA 2ZZWA 4JB7A 1LLSA 4GXSB 2OWZA 3JV9A 4BLAA 1OQGA 1QJMA 4NHBA 3WAFA 2H9BA 3VVDA 1BP1A 4XKPA 2O6AA 1IMFA 1R1NA 1B7UA 1N3WA 2F7AA 1F9BA 1KA0A 2DWHA 2AL4A 4OEUA 1Y3NA 3B6WA 5JTYA 4NF8B 2FA7A 5IZ1A 3T9XB 3K1NA 4N13A 4R73A 5I7KA 1MDP1 1IQ7A 2DVZA 3I5OA 2V93A 5L9SA 5I56B 3OO7A 2DE2A 2XXQA 3LSXA 4G2ZA 4JWOA 2XD3A 4NWCA 5KDTB 2ZZXA 1FQAA 4I3EA 4PFUA 1B1XA 3IOUA 3B50A 4OANA 2A5TA 4H5GA 1PB7A 4F29A 4O3AA 4I9DA 2CZIA 4X48A 1KWHA 1DK4A 4I3YA 1NV3A 3EKIA 1FPLA 3HFUA 2XWVA 3EHTA 1FPBA 4ZE9A 1B7ZA 3RT8A 4NMYA 5I59B 4U21A 4E0XA 4G4PA 5FHOA 3KJTA 3DP4A 4ZZAA 3VLUA 5I2NB 2NWJA 4O94A 4PDDA 1IXIA 4H5FA 1LAGE 3KG2A 3OXNA 2QRYA 2UVIA 3MP1A 4JBZA 3FVKA 4MBPA 1H76A 3OO6A 2Q88A 4E0WA 1Z7NE 1MY1A 3E3KA 2HEUA 3K1MA 4KD5A 4MH5A 3SZPA 1QKAA 5CMCA 4WXJA 5IZ3B 3T0JA 1NH8A 3B6QA 1LEVA 1ZJLA 5EQ7A 5I84A 1QKBA 3HCQA 2VPNA 5A5XA 2PYYA 3TKDA 2Y7PA 5ESYA 4EQBA 1IUDA 3MVXA 1NV5A 2VGQA 1NH7A 3KN7A 2W7YA 2CZLA 2ZNUA 3TTRA 3QUFA 2GQ1A 4QSDA 1FJ6A 4H45A 1S7YA 1P99A 2Z8FA 1BTJA 2YLNA 3USDA 2OX3A 3ILUB 1OLCA 1SI0A 2Z8EA 5HBCA 3PMVA 4NF6A 4OFJA 2O84X 3TYHA 3O6IA 4EF2A 3RYDA 1SQYA 3JZJA 4R2BA 2I3WA 4PFTA 4KGHA 4OEVA 2UYFA 2IEEA 3OO8A 4QFNA 3GBBA 2XHDA 3G3IA 2P0SA 2RC9A 1SYHA 1D3KA 3OO9A 1UIUA 2VD2A 4G8NA 1BK4A 4OVSA 5M2VA 1MXUA 3TTNA 3NOHA 4XEQA 2XXUA 4GWUA 2R9JA 3T22A 2G29A 3CIJA 3VDFA 3E9XA 4U1OA 5BWJA 4RA1A 4NF8A 1SVXB 3UORA 3V8XB 4EDPA 1NUZA 2Y7WA 3W9WA 3KOTA 1LBCA 5FHNA 4EUOA 2ZMBA 2F34A 5I56A 3P7IA 1ZBMA 1FQCA 5AA4B 5KDTA 3IOWA 1JW4A 1USVB 3HV1A 4XKRA 4Z7EA 5LDZA 4ZS9A 2WYPA 4PC9A 1MY4A 2AIXA 4AB5A 4OFOA 4F31B 2I4CA 3VE1B 1H3DA 3GLBA 4RPOA 2PX1A 4MHFA 5CBSA 4Q8RA 2P3NA 4NTLA 2OLBA 4KCCA 2HZKA 2QS1A 1SW5A 1TFDA 4OVPA 2B65A 4F3SA 5I59A 3H4ZA 1M5EA 1FRPA 4H1XA 1NV6A 4C0RA 3JYRA 4PDHA 2QSXA 4EWSA 3K1PA 4PGPA 5L8DA 1CNQA 1MY0A 1LAXA 5I7IA 2ZYNA 4IO7A 3UK4A 3MC2A 1AL3A 1B1HA 2THIA 2XWIA 3LBSA 1POY1 2RC7A 4FE8A 1SPIA 4H6DA 5ELVA 2QMWA 5I57B 4YU0A 5ITPA 5DVIA 3RUMA 4AB6A 3PV0E 3UIFA 1NUXA 3FXRA 1FPKA 2NXOA 4I40A 1FQEA 5IAIA 1H44A 5IZ3A 4PP0A 1P1UA 1NL5A 2R71A 4ND9A 2XWKA 3QXMA 4G8HA 4IGRA 1B46A 4P1EA 1US5A 4NF4B 2ZYOA 4H46A 2Q74A 4YKKA 4PE5B 3EQ1A 5TP9B 1B0LA 1TT1A 5CMBA 2F97A 3RTWB 4GWWA 2DVCA 1MQJA 4KYSA 1FJ9A 2XA5A 3MP8A 1URDA 2OK2A 4NQ8A 1L5TA 2VP1A 1O63A 3KGCA 1ZU0A 4ZEBA 1NFTA 2XXVA 4GF8A 5CM6A 1QUIA 3DM0A 1RDZA 4PGNA 3KN3A 1YZ0A 1FQFA 1VFEA 1PB9A 2I48A 4O7IA 5DT6A 2Q8JA 4DXUA 2RCBA 2H4IA 4OZ9A 2B4LA 3T9VA 3FXBA 3I3VA 2HAUA 3KZGA 3CG1A 2GHAA 2I58A 2QS4A 3UV1A 5ICQA 5K2YA 4Q5TA 3CG3A 3O29A 3KBZA 1B2HA 4F18A 2OBDA 4XFEA 5CMKA 1POTA 3M8UA 2PT1A 1S9TA 2RINA 5CC2A 1XHYA 4N91A 1B6HA 3K2DA 4KFQA 4PBQA 5AA4A 3GBAA 2OCUA 2Y7RA 1FPJA 1IXHA 1Y1ZA 1NV1A 4LZ8A 2ONKE 1D9YA 1GV8A 1WDNA 4F22A 3UGWA 3K02A 3LUZA 1J1NA 1DTGA 3ZS6A 2DWIA 4QFPA 3FJMA 5EQAA 2Y5KA 1XT8A 4N6PA 2UYEA 3EF7A 2XXPA 4NF5B 2KLFA 3MVWA 1RYOA 1MPDA 5LTCA 2CZKA 2ZZVA 3KC1A 3BIHA 4MF3A 4GRKA 3A09A 4R75A 3K6WA 1QULA 2BJIA 3AOSA 3PUWE 3O97A 2XXYA 1SD3A 4LATA 1Q1KA 4N6KA 1Y3PA 4GX4A 4FBPA 2CMOA 1A40A 4KR5A 4BDQA 3FXUA 4PETA 2QVVA 5IKBA 5I57A 1YTVA 4HXVA 5F24A 1N76A 4M4GA 3OSRA 1XI6A 3QSLA 4IB2A 1NUWA 3S4UA 3CR9A 1FW0A 1AMFA 3RPWA 4OVRA 1ZTYA 2DE4A 3K00A 4NF4A 4OMBA 1FSAA 1M5CA 5TP9A 1OIBA 4IO4A 3W15C 4GOTA 3K6VA 3O2AA 5IGAA 1P1OA 5TPAB 1EYIA 3PPQA 3SDFA 3KFMA 3U8QA 4WKMA 2OWTA 3SEYA 2R8TA 4H65A 1JNFA 4BDLA 4MAGA 2F78A 1IXGA 2X7PA 5FTHA 3PUXE 3EHUA 1FQDA 2PCRA 5ET6A 4N17A 4M4DA 2P1SA 3RTFB 1CB6A 1IITA 1IMCA 1R6ZA 2FVZA 2XD2A 1NNTA 3A29A 4G68C 3FZVA 1B4HA 4GXAA 3TCGA 5ET8A 5HM4B 5DW8A 1DTZA 4P11A 2HFBA 1FQBA 4DE8A 4THIA 4PTKA 3KSJA 2Z22A 5FBPA 1HSLA 1DSNA 2XX9A 4YMAA 1VSOA 3FASA 4YMBA 5J1DA 3FD3A 3R7XA 2X26A 1DPEA 4PF8A 2UXAA 1XS5A 4FJPA 4I62A 4GWSA 2A5SA 5L9MA 3G7WA 3B6TA 4OETA 1RDYA 1MRPA 3FVGA 4H67A 4Q0CA 4XKQA 1MPBA 4R6KA 2DS9A 1Q9DA 5KZTA 4OTEA 4MCOA 4IO5A 3HPIA 4WEPA 3BBRA 4KHZE 4IO2A 1H45A 2UVHA 2H98A 3M3LA 4KYEA 2D3IA 3MQ9A 4OESA 4K3FA 2QS3A 2HQ0A 5HPQA 3BKIB 4BDOA 3IB2A 3FUZA 4NF5A 1JVYA 3H06B 3IK6B 2GFEA 1BKAA 5EHSA 1NV0A 2PFZA 4OQOA 5FTIA 1QGXA 1INPA 3G3GA 4GX3A 2RC8A 3RGYA 4BDMA 3GYYA 3RLFE 5ICTA 1FTJA 2HCAA 4G77A 3TFLA 3Q29A 2XXHA 2I3VA 1NV2A 2WEFA 3GZGA 3RPLB 1OQHA 4DI3D 2B4MA 5ITOA 4DIGA 5L9OA 3O6HA 3HSTA 2O69A 3H03A 2GRVA 3M3FA 5H8SA 4IO6A 4N6DA 4N81A 2V25A 1B52A 3IB0A 3QIMA 4DDDA 1IMBA 1K9ZA 4F19A 2E1SA 4G8MA 4YAHX 4H8IA 4ZEDA 1B3FA 1LBXA 3MVYA 4QHQA 1T0KA 1LBBA 4DZ1A 1QW0A 5TPAA 1MY3A 4I8CA 3TQLA 2Z8DA 2O1LA 5H8HB 1SI1A 3PD9A 1IZ1A 1FTMA 1TFAA 3IAZA 3K6XA 1LFHA 1FTLA 5CRYA 2XXXA 3R6UA 4QSCA 5AA2B 2HHMA 4ESWA 4AS4A 2ZXTA 2B3BA 4HE1A 1IMAA 1YAEA 3D4CA 5B70A 2I0BA 4U2RA 3VXBA 1OVTA 3U72A 4POWA 2ABHA 4FEDA 2QFLA 1JETA 3MSTA 4PFIA 3IX1A 3SESA 4LP2B 3QAXA 4U1ZA 4P0GA 1D9QA 2I0CA 4P8BA 1LCFA 4QSEA 5EYFA 1OVBA 1B32A 3ECRA 1N3XA 3VVFA 3K4UA 3OMBA 3VVEA 4PAKA 4H8JA 4R2FA 1MH3A 1VR5A 1ZIUA 4HS7A 2AYSA 4YB6A 3G3FA 3Q27A 2P2AA 1YCJA 4F39A 1S50A 3U94A 2VPOA 4HE2A 4FAJA 2YJPA 4KXPA 3S9MC 2F5XA 3TZAA 1USUB 5A5LA 1ANFA 3C36A 1EZPA 4QXDA 4ELPA 1K9YA 1B40A 1GR2A 5EHMA 4Q30B 3RY3A 1B4ZA 5F1QA 4F1YA 4GLIA 1OMPA 2PT2A 3L6IA 3FIRA 4F1UA 4QFLA 2F3DA 1NNPA 1UTHB 1QVSA 5DYHA 1HSEA 4LQ2A 1N7WA 2XXWA 4OVJA 1MXVA 2QVUA 1YPNA 3PUYE 2WYKA 3RPLA 4N15A 1H43A 3CFZA 3HO7A 3VFJA 2V84A 1PEBA 2Y84A 2AL5A 4GVOA 3IOTA 3CFXA 3AOTA 5F7VA 3TPAA 3T66A 1MXYA 4KPTA 4O3CA 1FBPA 3V5AA 3Q26A 3K0VA 1FBEA 2DXRA 3WAEA 2VOZA 3SEVA 1NI9A 1XVYA 5AA3A 4X1BA 3Q25A 2CEXA 1UIVA 4F3GA 4EXKA 1PBQA 1ATGA 1IMDA 2NVUB 3ZPMA 3V83A 4XKNA 3C35A 3PPPA 4TQUQ 4Z0IA 1MXWA 2V3UA 2Y7IA 3KEIA 1IXCA 5H8HA 4RPNA 1PC3A 3KN8A 1KZ8A 2ALUA 4N4UA 1IIWA 5I7JA 1GVCA 3SERA 4MFIA 3ODBA 2GH9A 2V3TA 4NG7A 2FIEA 3RT6B 5AA2A 1A8FA 1LBYA 2H99A 4DCYA 2ONSA 3H6WA 4AQ4A 4GWXA 4FATA 4GD5A 2RCAA 3G3HA 3S9EA 3O6GA 3OEMA
chains in the Genus database with same CATH topology
2XXIA 4NEDA 1SW4A 4HW8A 3M3KA 1B3LA 2OBGA 2RQFA 2QJEA 4KYDA 3H6VA 3TCFA 5I58B 4ESXA 1B58A 1LCTA 3ILTB 4IY6A 1VE4A 2Q9TA 1BLFA 1NNKA 4F3BA 5KCJB 4OFLA 3SKPA 3KJ7A 4RXLA 3PUVE 3EPEA 5I7LA 4IO3A 2QMXA 1DPPA 4F1VA 3ZKKA 4ISUA 1I6BA 5DVFA 1EH3A 3OENA 4R9GA 2ONRA 5AE4A 3LC8A 3UN6A 3MAMA 3FVOA 3C31A 3MZBA 2B3FA 1CE2A 1B5HA 1AOVA 1UTHA 3C33A 3MJNA 1MQIA 1ZKBA 4R6HA 3C32A 1UTBB 1M5DA 5H8NB 1MY2A 2Q2CA 3SETA 4PFWA 1LFGA 2ZYKA 1SYIA 4EXLA 4L17A 1MS7A 1IEJA 3DP8A 1B51A 2REJA 3FJ7A 4PQJA 1Y9UA 2DWAA 2D5WA 2VHAA 1SW2A 4X9TA 5DEXB 2HAVA 1R9LA 5H8FA 2QPQA 1DOTA 1XVXA 3TMGA 2I4BA 5TU0A 4GWOA 2H5YA 1Y4TA 4OHNA 1M5FA 1P1WA 3IB1A 3G3KA 1M5BA 3PMXA 4M1VA 1MG1A 3D4GA 4R74A 4YKPA 3TTMA 2IA4A 3A1ZA 3E4RA 3R26A 3I6VA 4U4SA 3CSBA 2RF1A 4LZ7A 3IO6A 3L6HA 5DVJA 4TLLB 4C1TA 1EZOA 3E13X 3N6TA 5I58A 4GFRA 4RYAA 4U22A 2E0SA 2F35A 5KCJA 3VLWA 3VLVA 4RK9A 3CVGA 1QUJA 1URGA 3HHGA 4U23A 4ZEKA 3FJGA 3SEUA 1XC1A 3HHFA 2O68A 1UQWA 3BFUA 2Q89A 1WODA 4X1DA 1LAFE 1I69A 1Y20A 4LZ5A 3F11A 3THIA 1ZMGA 1MM7A 1GTKA 5CI5A 3QUJA 2WKYA 1MM6A 4N07A 3CI8A 1B5JA 4JSOA 2QL3A 4G68B 4KI0E 3QK6A 4POXA 3LR1A 3ZSFA 2XX8A 2G93A 1Y1MA 2X7QA 3G3JA 2O7IA 4JWYA 1MXZA 1N84A 2Y7KA 3FV1A 2FYIA 1JVXA 2XX7A 4OYVA 2I6EA 1UTBA 2F8DA 3PMWA 5H8NA 4RNSA 4UACA 3MUQA 4OWDA 3LUYA 2ESNA 4DCXA 1N7XA 1A99A 1MQDA 4FECA 3RN8A 1BIYA 4JDFA 2DP8A 1JEVA 4FEBA 5AA1A 1N0TA 4NE4A 5AA2D 4F2OA 3OSQA 3CRBA 2R6GE 2RKMA 3AXFA 1B05A 5BUUA 4UA8A 4GIZA 4XTCQ 5DEXA 5DTBA 4DLDA 1NMUA 1MDQA 1II5A 3DLNA 4ELRA 3IL1B 5LOMA 3N5LA 5I2KB 3BFTA 3RNNA 4JSDA 3IR1A 2Z23A 1B9JA 1B3EA 3N6UA 4ONYA 1JQFA 2ZYMA 3PU5A 2DXYA 3EHSA 1HSJA 3TODA 2PMSA 1A8EA 1MQHA 4YKIA 2O51A 3MPKA 3O66A 4R9FA 1DMBA 1I6QA 2O7UA 4G0SA 4R6YA 1TWYA 4XIGQ 4DXCA 1N04A 2M8CA 1Z7ME 1O64A 3TELA 4KGOA 4ELQA 4EF1A 1USYE 1JEUA 2ZNSA 3C4MA 4IY5A 1PB8A 1RKMA 3O28A 3KOSA 3MW0A 3IJXB 3T9UA 3OOAA 1LB9A 4FIMA 3PPNA 3K6UA 3SEXA 4YB7A 3U92A 3UP9A 1D9VA 5H8QB 4NWDA 3O9PA 4FORA 1RYXA 4ZZEA 1LB8A 2REGA 4QFOA 4HTGA 1Y3QA 4G68A 1I6AA 4RY1A 3FVNA 3IOVA 3PPRA 3MP6A 2HXWA 1SDXA 1Q35A 2YPNA 2ZNTA 1AIVA 3FXQA 4F2QA 4QFKA 1BP5A 3MVZA 1D4NA 1A7LA 1FTOA 1JW1A 4XXUA 5I2NA 3LSWA 4HCYA 4IGTA 1A55A 5K2XA 5JK4A 3OD7A 4R72A 2UVJA 1AH5A 3FV2A 4GQOA 4ZEIA 1LAHE 2V3QA 1FCKA 3TTLA 3N26A 1LGBC 4RJZA 2F36A 3IO4A 4YZZA 2RCKA 3H3GA 1MPCA 3C34A 1FTKA 3FATA 1A54A 3PGFA 2OZZA 4GL8A 1GGGA 3ONMA 1EZ9A 5H8FB 1LSTA 1NKXA 3DELB 4PFYA 5CMMA 5I2KA 3LSLA 3KSXA 4ZE8A 4EQ7A 2LAOA 1EWFA 1Y4CA 2DOJA 1B7HA 2OWSA 4MLVA 3GXAA 3EN3A 3MZ9A 4JXIA 2ANJA 4P0IA 4HCWA 4ZEFA 1URSA 4QF9A 2FNCA 1B3GA 2O1MA 4BDNA 4ZDMA 1EU8A 1LFIA 3E8TA 3MZ1A 2UVGA 3B7DA 1PBPA 3MWBA 5ISUA 4DXBA 4F3PA 4LVQA 3TAJA 3S2VA 3H6UA 4WEDA 1QUKA 3Q28A 2Q2AA 1OLAA 5JTYB 2I49A 1B0HA 2DSFA 1O7TA 3CFLA 3OELA 1XOCA 5H8QA 3S9NC 3U1OA 2XXRA 4OXVA 3TCHA 3A3CA 4QRZA 2DE3A 2H25A 4YB5A 3K01A 2F7CA 3RQTA 1MH4A 3KBRA 1ZLQA 4OERA 2PVUA 2A5TB 3U93A 3CSGA 3TEPA 1ELJA 4YICA 3T93B 3SEWA 3H6TA 2OJTA 4KQPA 4MLQA 3IORA 4LA9A 3PPOA 4U4XA 1WVJA 2D21A 3UA8A 2XXTA 1MQGA 1JW5A 2F7BA 4I1DA 2DWJA 3T9HB 4LONB 4TOZA 2NOOA 3C9HA 4JWXA 3L6GA 4BDRA 3V89B 3T96B 4EQ9A 5CBRA 4F2AA 4OENA 2VD3A 4RK2A 1VFDA 2DYXA 1MXXA 3S9LC 1SBPA 2PBWA 3PUZE 3ZKLA 3OEKA 4KCDA 4LUBA 1TXFA 5JEIA 2HZLA 1SW1A 3N94A 3FGSA 3VXCA 4O3BA 3TQWA 5A5XB 3QYTA 3TTKA 1B5IA 3TDJA 1R9QA 3PD8A 1US4A 3DP6A 5B7DA 4LQ5A 2NUVA 4C1UA 1P1QA 2GHBA 3MBPA 1PDAA 2F6GA 4ZECA 1USYH 2QS2A 3E8WA 4ECFA 1NNFA 3H7MA 4NF6B 4GL0A 1B3HA 3W9VA 4YKJA 3MPLA 3IJOB 1P1NA 3TUSA 4TLMB 3N72A 4H0WA 3LSFB 2F6PA 3A3UA 3HN0A 2DQVA 3VV5A 5FHMA 2BJJX 4ELOA 4JB7A 1LLSA 4GXSB 3JV9A 4BLAA 1OQGA 1QJMA 3WAFA 2H9BA 3VVDA 1BP1A 4XKPA 2O6AA 1R1NA 1B7UA 1N3WA 2F7AA 1F9BA 2DWHA 2AL4A 4OEUA 1Y3NA 3B6WA 5JTYA 4NF8B 2FA7A 3T9XB 3K1NA 4N13A 4R73A 5I7KA 1MDP1 1IQ7A 2DVZA 3I5OA 2V93A 5L9SA 5I56B 3OO7A 2DE2A 2XXQA 3LSXA 4G2ZA 4JWOA 2XD3A 4NWCA 5KDTB 1FQAA 4PFUA 1B1XA 3IOUA 2A5TA 4H5GA 1PB7A 4F29A 4O3AA 4I9DA 4X48A 1KWHA 3EHTA 4ZE9A 1B7ZA 3RT8A 4NMYA 5I59B 4U21A 4E0XA 4G4PA 5FHOA 3KJTA 3DP4A 4ZZAA 3VLUA 5I2NB 2NWJA 1IXIA 4H5FA 1LAGE 3KG2A 3OXNA 2QRYA 2UVIA 3MP1A 4JBZA 3FVKA 4MBPA 1H76A 3OO6A 2Q88A 4E0WA 1Z7NE 1MY1A 3E3KA 2HEUA 3K1MA 4KD5A 4MH5A 1QKAA 5CMCA 4WXJA 1NH8A 3B6QA 1ZJLA 5I84A 1QKBA 3HCQA 5A5XA 2PYYA 3TKDA 2Y7PA 4EQBA 1IUDA 3MVXA 2VGQA 1NH7A 3KN7A 2W7YA 2CZLA 2ZNUA 3TTRA 3QUFA 4QSDA 1S7YA 1P99A 2Z8FA 1BTJA 2YLNA 3USDA 3ILUB 1OLCA 1SI0A 2Z8EA 5HBCA 3PMVA 4NF6A 4OFJA 2O84X 3TYHA 3O6IA 4EF2A 1SQYA 3JZJA 4R2BA 2I3WA 4PFTA 4KGHA 4OEVA 2UYFA 2IEEA 3OO8A 4QFNA 3GBBA 2XHDA 3G3IA 2P0SA 2RC9A 1SYHA 1D3KA 3OO9A 1UIUA 2VD2A 4G8NA 5M2VA 1MXUA 3TTNA 2XXUA 2R9JA 3T22A 2G29A 3CIJA 3VDFA 3E9XA 4U1OA 5BWJA 4RA1A 4NF8A 1SVXB 3UORA 3V8XB 4EDPA 2Y7WA 3W9WA 3KOTA 1LBCA 5FHNA 4EUOA 2ZMBA 2F34A 5I56A 3P7IA 1ZBMA 1FQCA 5AA4B 5KDTA 3IOWA 1JW4A 1USVB 3HV1A 4XKRA 4Z7EA 4ZS9A 1MY4A 2AIXA 4AB5A 4OFOA 4F31B 2I4CA 3VE1B 1H3DA 3GLBA 4RPOA 2PX1A 5CBSA 4Q8RA 4NTLA 2OLBA 4KCCA 2HZKA 2QS1A 1SW5A 1TFDA 2B65A 4F3SA 5I59A 3H4ZA 1M5EA 4H1XA 4C0RA 3JYRA 2QSXA 4EWSA 3K1PA 5L8DA 1MY0A 1LAXA 2ZYNA 4IO7A 3UK4A 3MC2A 1AL3A 1B1HA 2THIA 3LBSA 1POY1 2RC7A 4FE8A 4H6DA 5ELVA 2QMWA 5I57B 4YU0A 5ITPA 5DVIA 3RUMA 4AB6A 3PV0E 3UIFA 3FXRA 2NXOA 1FQEA 5IAIA 1H44A 4PP0A 1P1UA 1NL5A 2R71A 4ND9A 4G8HA 3QXMA 4IGRA 1B46A 1US5A 4NF4B 2ZYOA 4YKKA 4PE5B 3EQ1A 5TP9B 1B0LA 1TT1A 5CMBA 2F97A 3RTWB 2DVCA 1MQJA 4KYSA 3MP8A 1URDA 2OK2A 1L5TA 2VP1A 1O63A 3KGCA 1ZU0A 4ZEBA 1NFTA 2XXVA 4GF8A 5CM6A 1QUIA 3DM0A 3KN3A 1FQFA 1VFEA 1PB9A 2I48A 5DT6A 2Q8JA 4DXUA 2RCBA 2H4IA 4OZ9A 3T9VA 3I3VA 2HAUA 3KZGA 3CG1A 2GHAA 2I58A 2QS4A 3UV1A 5ICQA 5K2YA 4Q5TA 3CG3A 3O29A 1B2HA 4F18A 2OBDA 5CMKA 1POTA 3M8UA 2PT1A 1S9TA 2RINA 5CC2A 1XHYA 1B6HA 3K2DA 4KFQA 5AA4A 3GBAA 2OCUA 2Y7RA 1IXHA 1Y1ZA 4LZ8A 2ONKE 1D9YA 1GV8A 1WDNA 4F22A 3UGWA 3K02A 1J1NA 1DTGA 3ZS6A 2DWIA 4QFPA 3FJMA 1XT8A 4N6PA 2UYEA 3EF7A 2XXPA 4NF5B 2KLFA 3MVWA 1RYOA 1MPDA 4MF3A 4GRKA 3A09A 4R75A 3K6WA 1QULA 3PUWE 3AOSA 3O97A 2XXYA 1SD3A 4LATA 1Q1KA 1Y3PA 2CMOA 1A40A 4KR5A 4BDQA 3FXUA 4PETA 5IKBA 5I57A 1YTVA 1N76A 4M4GA 3OSRA 3QSLA 4IB2A 3S4UA 3CR9A 1FW0A 1AMFA 3RPWA 1ZTYA 2DE4A 3K00A 4NF4A 4OMBA 1M5CA 5TP9A 1OIBA 4IO4A 3W15C 4GOTA 3K6VA 3O2AA 1P1OA 5TPAB 3PPQA 3SDFA 3KFMA 3U8QA 4WKMA 2OWTA 3SEYA 4H65A 1JNFA 4BDLA 2F78A 1IXGA 2X7PA 5FTHA 3PUXE 3EHUA 1FQDA 4M4DA 2P1SA 3RTFB 1CB6A 1IITA 1R6ZA 2XD2A 1NNTA 4G68C 3FZVA 1B4HA 4GXAA 3TCGA 5HM4B 1DTZA 4P11A 2HFBA 1FQBA 4DE8A 4THIA 3KSJA 2Z22A 1HSLA 1DSNA 2XX9A 4YMAA 1VSOA 3FASA 4YMBA 5J1DA 3FD3A 3R7XA 2X26A 1DPEA 2UXAA 1XS5A 4FJPA 4I62A 2A5SA 5L9MA 3G7WA 3B6TA 4OETA 1MRPA 3FVGA 4H67A 4Q0CA 4XKQA 1MPBA 4R6KA 2DS9A 5KZTA 4OTEA 4IO5A 3HPIA 4WEPA 3BBRA 4KHZE 4IO2A 1H45A 2UVHA 2H98A 3M3LA 4KYEA 2D3IA 3MQ9A 4OESA 4K3FA 2QS3A 2HQ0A 5HPQA 3BKIB 4BDOA 3IB2A 3FUZA 4NF5A 1JVYA 3H06B 3IK6B 2GFEA 1BKAA 5EHSA 4OQOA 5FTIA 3G3GA 2RC8A 3RGYA 4BDMA 3RLFE 5ICTA 1FTJA 2HCAA 4G77A 3TFLA 3Q29A 2XXHA 2I3VA 3GZGA 1OQHA 5ITOA 4DIGA 5L9OA 3O6HA 3HSTA 2O69A 3H03A 2GRVA 3M3FA 5H8SA 4IO6A 2V25A 1B52A 3IB0A 3QIMA 4DDDA 4F19A 2E1SA 4G8MA 4YAHX 4H8IA 4ZEDA 1B3FA 3MVYA 4QHQA 1T0KA 1LBBA 4DZ1A 1QW0A 5TPAA 1MY3A 4I8CA 3TQLA 2Z8DA 2O1LA 5H8HB 1SI1A 3PD9A 1IZ1A 1FTMA 1TFAA 3IAZA 3K6XA 1LFHA 1FTLA 5CRYA 2XXXA 3R6UA 4QSCA 5AA2B 4ESWA 2ZXTA 2B3BA 1YAEA 3D4CA 5B70A 2I0BA 4U2RA 3VXBA 1OVTA 3U72A 4POWA 2ABHA 4FEDA 1JETA 3IX1A 3SESA 4LP2B 3QAXA 4U1ZA 4P0GA 2I0CA 1LCFA 4QSEA 5EYFA 1OVBA 1B32A 3ECRA 1N3XA 3VVFA 3K4UA 3OMBA 3VVEA 4H8JA 4R2FA 1MH3A 1VR5A 1ZIUA 4HS7A 2AYSA 4YB6A 3G3FA 3Q27A 2P2AA 1YCJA 4F39A 1S50A 3U94A 4FAJA 2YJPA 3S9MC 2F5XA 3TZAA 1USUB 1ANFA 3C36A 1EZPA 4ELPA 1B40A 1GR2A 5EHMA 4Q30B 3RY3A 1B4ZA 5F1QA 4F1YA 4GLIA 1OMPA 2PT2A 3L6IA 3FIRA 4F1UA 4QFLA 1UTHB 1NNPA 1QVSA 5DYHA 1HSEA 4LQ2A 1N7WA 2XXWA 4OVJA 1MXVA 1YPNA 3PUYE 1H43A 3CFZA 3HO7A 3VFJA 2V84A 1PEBA 2Y84A 2AL5A 4GVOA 3IOTA 3CFXA 3AOTA 5F7VA 3TPAA 3T66A 1MXYA 4KPTA 4O3CA 3V5AA 3Q26A 3K0VA 2DXRA 3WAEA 2VOZA 3SEVA 1XVYA 5AA3A 4X1BA 3Q25A 1UIVA 4F3GA 4EXKA 1PBQA 1ATGA 2NVUB 3ZPMA 3V83A 4XKNA 3C35A 3PPPA 4TQUQ 4Z0IA 1MXWA 2V3UA 2Y7IA 3KEIA 1IXCA 5H8HA 4RPNA 1PC3A 3KN8A 2ALUA 1IIWA 5I7JA 1GVCA 3SERA 4MFIA 3ODBA 2GH9A 2V3TA 3RT6B 5AA2A 1A8FA 2H99A 4DCYA 2ONSA 3H6WA 4AQ4A 4FATA 4GD5A 2RCAA 3G3HA 3S9EA 3O6GA 3OEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXI A;  4NED A;  1SW4 A;  4HW8 A;  3M3K A;  1B3L A;  2OBG A;  2QJE A;  4KYD A;  3H6V A;  3TCF A;  5I58 B;  4ESX A;  1B58 A;  1LCT A;  3ILT B;  4IY6 A;  1VE4 A;  2Q9T A;  1BLF A;  1NNK A;  4F3B A;  5KCJ B;  4OFL A;  3SKP A;  3KJ7 A;  4RXL A;  3PUV E;  3EPE A;  4IO3 A;  2QMX A;  1DPP A;  4F1V A;  3ZKK A;  4ISU A;  1I6B A;  5DVF A;  1EH3 A;  3OEN A;  4R9G A;  2ONR A;  5AE4 A;  3LC8 A;  3UN6 A;  3MAM A;  3FVO A;  3C31 A;  3MZB A;  2B3F A;  1CE2 A;  1B5H A;  1AOV A;  1UTH A;  3C33 A;  3MJN A;  1MQI A;  1ZKB A;  4R6H A;  3C32 A;  1UTB B;  1M5D A;  5H8N B;  1MY2 A;  2Q2C A;  3SET A;  4PFW A;  1LFG A;  2ZYK A;  1SYI A;  4EXL A;  4L17 A;  1MS7 A;  1IEJ A;  3DP8 A;  1B51 A;  2REJ A;  3FJ7 A;  4PQJ A;  1Y9U A;  2DWA A;  2D5W A;  2VHA A;  1SW2 A;  4X9T A;  5DEX B;  2HAV A;  1R9L A;  5H8F A;  2QPQ A;  1DOT A;  1XVX A;  3TMG A;  2I4B A;  5TU0 A;  4GWO A;  2H5Y A;  1Y4T A;  4OHN A;  1M5F A;  1P1W A;  3IB1 A;  3G3K A;  1M5B A;  3PMX A;  4M1V A;  1MG1 A;  3D4G A;  4R74 A;  4YKP A;  3TTM A;  2IA4 A;  3E4R A;  3R26 A;  3I6V A;  4U4S A;  3CSB A;  2RF1 A;  4LZ7 A;  3IO6 A;  3L6H A;  5DVJ A;  4TLL B;  4C1T A;  1EZO A;  3E13 X;  3N6T A;  5I58 A;  4GFR A;  4RYA A;  4U22 A;  2E0S A;  2F35 A;  5KCJ A;  3VLW A;  3VLV A;  4RK9 A;  3CVG A;  1QUJ A;  1URG A;  3HHG A;  4U23 A;  4ZEK A;  3FJG A;  3SEU A;  1XC1 A;  3HHF A;  2O68 A;  1UQW A;  3BFU A;  2Q89 A;  1WOD A;  4X1D A;  1LAF E;  1I69 A;  1Y20 A;  4LZ5 A;  3F11 A;  3THI A;  1ZMG A;  1MM7 A;  1GTK A;  5CI5 A;  3QUJ A;  2WKY A;  1MM6 A;  4N07 A;  3CI8 A;  1B5J A;  4JSO A;  2QL3 A;  4G68 B;  4KI0 E;  3QK6 A;  4POX A;  3LR1 A;  3ZSF A;  2XX8 A;  2G93 A;  1Y1M A;  2X7Q A;  3G3J A;  2O7I A;  4JWY A;  1MXZ A;  1N84 A;  2Y7K A;  3FV1 A;  2FYI A;  1JVX A;  2XX7 A;  4OYV A;  2I6E A;  1UTB A;  2F8D A;  3PMW A;  5H8N A;  4RNS A;  4UAC A;  3MUQ A;  4OWD A;  3LUY A;  2ESN A;  4DCX A;  1N7X A;  1A99 A;  1MQD A;  4FEC A;  3RN8 A;  1BIY A;  4JDF A;  2DP8 A;  1JEV A;  4FEB A;  5AA1 A;  5AA2 D;  4NE4 A;  1N0T A;  4F2O A;  3OSQ A;  3CRB A;  2R6G E;  2RKM A;  3AXF A;  1B05 A;  5BUU A;  4UA8 A;  4GIZ A;  4XTC Q;  5DEX A;  5DTB A;  4DLD A;  1NMU A;  1MDQ A;  1II5 A;  3DLN A;  4ELR A;  3IL1 B;  5LOM A;  3N5L A;  5I2K B;  3BFT A;  3RNN A;  4JSD A;  3IR1 A;  2Z23 A;  1B9J A;  1B3E A;  3N6U A;  4ONY A;  1JQF A;  2ZYM A;  3PU5 A;  2DXY A;  3EHS A;  1HSJ A;  3TOD A;  2PMS A;  1A8E A;  1MQH A;  4YKI A;  2O51 A;  3MPK A;  3O66 A;  4R9F A;  1DMB A;  1I6Q A;  2O7U A;  4R6Y A;  1TWY A;  4XIG Q;  4DXC A;  1N04 A;  2M8C A;  1Z7M E;  1O64 A;  3TEL A;  4ELQ A;  4EF1 A;  1USY E;  1JEU A;  2ZNS A;  3C4M A;  4IY5 A;  1PB8 A;  1RKM A;  3O28 A;  3KOS A;  3MW0 A;  3IJX B;  3T9U A;  3OOA A;  1LB9 A;  4FIM A;  3PPN A;  3K6U A;  3SEX A;  4YB7 A;  3U92 A;  3UP9 A;  1D9V A;  5H8Q B;  4NWD A;  3O9P A;  4FOR A;  1RYX A;  4ZZE A;  1LB8 A;  2REG A;  4QFO A;  4HTG A;  1Y3Q A;  4G68 A;  1I6A A;  4RY1 A;  3FVN A;  3IOV A;  3PPR A;  3MP6 A;  2HXW A;  1SDX A;  1Q35 A;  2YPN A;  2ZNT A;  1AIV A;  3FXQ A;  4F2Q A;  4QFK A;  1BP5 A;  3MVZ A;  1D4N A;  1A7L A;  1FTO A;  1JW1 A;  4XXU A;  5I2N A;  3LSW A;  4HCY A;  4IGT A;  1A55 A;  5K2X A;  5JK4 A;  3OD7 A;  4R72 A;  2UVJ A;  1AH5 A;  3FV2 A;  4GQO A;  4ZEI A;  1LAH E;  2V3Q A;  1FCK A;  3TTL A;  3N26 A;  1LGB C;  4RJZ A;  2F36 A;  3IO4 A;  4YZZ A;  3H3G A;  1MPC A;  3C34 A;  1FTK A;  3FAT A;  1A54 A;  3PGF A;  2OZZ A;  4GL8 A;  1GGG A;  3ONM A;  1EZ9 A;  5H8F B;  1LST A;  1NKX A;  3DEL B;  4PFY A;  5CMM A;  5I2K A;  3LSL A;  3KSX A;  4ZE8 A;  4EQ7 A;  2LAO A;  1Y4C A;  2DOJ A;  1B7H A;  2OWS A;  4MLV A;  3GXA A;  3EN3 A;  3MZ9 A;  4JXI A;  2ANJ A;  4P0I A;  4HCW A;  4ZEF A;  1URS A;  4QF9 A;  2FNC A;  1B3G A;  2O1M A;  4BDN A;  4ZDM A;  1EU8 A;  1LFI A;  3MZ1 A;  2UVG A;  3B7D A;  1PBP A;  3MWB A;  5ISU A;  4DXB A;  4F3P A;  4LVQ A;  3TAJ A;  3S2V A;  3H6U A;  4WED A;  1QUK A;  3Q28 A;  2Q2A A;  1OLA A;  5JTY B;  2I49 A;  1B0H A;  2DSF A;  1O7T A;  3CFL A;  3OEL A;  1XOC A;  5H8Q A;  3S9N C;  3U1O A;  2XXR A;  4OXV A;  3TCH A;  3A3C A;  4QRZ A;  2DE3 A;  2H25 A;  4YB5 A;  3K01 A;  2F7C A;  3RQT A;  1MH4 A;  3KBR A;  1ZLQ A;  4OER A;  2PVU A;  2A5T B;  3U93 A;  3CSG A;  3TEP A;  1ELJ A;  4YIC A;  3T93 B;  3SEW A;  3H6T A;  2OJT A;  4KQP A;  4MLQ A;  3IOR A;  4LA9 A;  3PPO A;  4U4X A;  1WVJ A;  2D21 A;  3UA8 A;  2XXT A;  1MQG A;  1JW5 A;  2F7B A;  4I1D A;  2DWJ A;  3T9H B;  4LON B;  4TOZ A;  2NOO A;  3C9H A;  4JWX A;  3L6G A;  4BDR A;  3V89 B;  3T96 B;  4EQ9 A;  5CBR A;  4OEN A;  2VD3 A;  4RK2 A;  1VFD A;  2DYX A;  1MXX A;  3S9L C;  1SBP A;  2PBW A;  3PUZ E;  3ZKL A;  3OEK A;  4KCD A;  4LUB A;  1TXF A;  5JEI A;  2HZL A;  1SW1 A;  3N94 A;  3FGS A;  3VXC A;  4O3B A;  3TQW A;  5A5X B;  3QYT A;  3TTK A;  1B5I A;  3TDJ A;  1R9Q A;  3PD8 A;  1US4 A;  3DP6 A;  5B7D A;  4LQ5 A;  2NUV A;  4C1U A;  1P1Q A;  2GHB A;  3MBP A;  1PDA A;  2F6G A;  4ZEC A;  1USY H;  2QS2 A;  4ECF A;  1NNF A;  3H7M A;  4NF6 B;  4GL0 A;  1B3H A;  3W9V A;  4YKJ A;  3MPL A;  3IJO B;  1P1N A;  3TUS A;  4TLM B;  4H0W A;  3LSF B;  2F6P A;  3A3U A;  3HN0 A;  2DQV A;  3VV5 A;  5FHM A;  2BJJ X;  4ELO A;  4JB7 A;  1LLS A;  4GXS B;  3JV9 A;  4BLA A;  1OQG A;  1QJM A;  3WAF A;  2H9B A;  3VVD A;  4XKP A;  2O6A A;  1R1N A;  1B7U A;  1N3W A;  2F7A A;  1F9B A;  2DWH A;  2AL4 A;  4OEU A;  1Y3N A;  3B6W A;  5JTY A;  4NF8 B;  2FA7 A;  3T9X B;  3K1N A;  4N13 A;  4R73 A;  1MDP 1;  1IQ7 A;  2DVZ A;  3I5O A;  2V93 A;  5L9S A;  5I56 B;  3OO7 A;  2DE2 A;  2XXQ A;  3LSX A;  4G2Z A;  4JWO A;  2XD3 A;  4NWC A;  5KDT B;  1FQA A;  4PFU A;  1B1X A;  3IOU A;  2A5T A;  4H5G A;  1PB7 A;  4F29 A;  4O3A A;  4I9D A;  4X48 A;  1KWH A;  3EHT A;  4ZE9 A;  1B7Z A;  3RT8 A;  4NMY A;  5I59 B;  4U21 A;  4E0X A;  4G4P A;  5FHO A;  3KJT A;  3DP4 A;  4ZZA A;  3VLU A;  5I2N B;  2NWJ A;  1IXI A;  4H5F A;  1LAG E;  3KG2 A;  3OXN A;  2QRY A;  2UVI A;  3MP1 A;  4JBZ A;  3FVK A;  4MBP A;  1H76 A;  3OO6 A;  2Q88 A;  4E0W A;  1Z7N E;  1MY1 A;  3E3K A;  2HEU A;  3K1M A;  4KD5 A;  4MH5 A;  1QKA A;  5CMC A;  4WXJ A;  1NH8 A;  3B6Q A;  1ZJL A;  5I84 A;  1QKB A;  3HCQ A;  5A5X A;  2PYY A;  3TKD A;  2Y7P A;  4EQB A;  1IUD A;  3MVX A;  2VGQ A;  1NH7 A;  3KN7 A;  2W7Y A;  2CZL A;  2ZNU A;  3TTR A;  3QUF A;  4QSD A;  1S7Y A;  1P99 A;  2Z8F A;  1BTJ A;  2YLN A;  3USD A;  3ILU B;  1OLC A;  1SI0 A;  2Z8E A;  5HBC A;  3PMV A;  4NF6 A;  4OFJ A;  2O84 X;  3TYH A;  3O6I A;  4EF2 A;  1SQY A;  3JZJ A;  4R2B A;  2I3W A;  4PFT A;  4OEV A;  2UYF A;  2IEE A;  3OO8 A;  4QFN A;  3GBB A;  2XHD A;  3G3I A;  2P0S A;  2RC9 A;  1SYH A;  1D3K A;  3OO9 A;  1UIU A;  2VD2 A;  4G8N A;  5M2V A;  1MXU A;  3TTN A;  2XXU A;  2R9J A;  3T22 A;  2G29 A;  3CIJ A;  3VDF A;  3E9X A;  4U1O A;  5BWJ A;  4RA1 A;  4NF8 A;  1SVX B;  3UOR A;  3V8X B;  4EDP A;  2Y7W A;  3W9W A;  3KOT A;  1LBC A;  5FHN A;  4EUO A;  2ZMB A;  2F34 A;  5I56 A;  3P7I A;  1ZBM A;  1FQC A;  5AA4 B;  5KDT A;  3IOW A;  1JW4 A;  3HV1 A;  4XKR A;  4Z7E A;  4ZS9 A;  1MY4 A;  2AIX A;  4AB5 A;  4OFO A;  4F31 B;  2I4C A;  3VE1 B;  1H3D A;  3GLB A;  4RPO A;  2PX1 A;  5CBS A;  4Q8R A;  4NTL A;  2OLB A;  4KCC A;  2HZK A;  2QS1 A;  1SW5 A;  1TFD A;  2B65 A;  4F3S A;  5I59 A;  3H4Z A;  1M5E A;  4H1X A;  4C0R A;  3JYR A;  2QSX A;  3K1P A;  5L8D A;  1MY0 A;  1LAX A;  2ZYN A;  4IO7 A;  3UK4 A;  3MC2 A;  1AL3 A;  1B1H A;  2THI A;  3LBS A;  1POY 1;  2RC7 A;  4FE8 A;  4H6D A;  5ELV A;  2QMW A;  5I57 B;  4YU0 A;  5ITP A;  5DVI A;  3RUM A;  4AB6 A;  3PV0 E;  3UIF A;  3FXR A;  2NXO A;  1FQE A;  5IAI A;  1H44 A;  4PP0 A;  1P1U A;  1NL5 A;  2R71 A;  4ND9 A;  4G8H A;  3QXM A;  4IGR A;  1B46 A;  1US5 A;  4NF4 B;  2ZYO A;  4YKK A;  4PE5 B;  3EQ1 A;  5TP9 B;  1B0L A;  1TT1 A;  5CMB A;  2F97 A;  3RTW B;  2DVC A;  1MQJ A;  4KYS A;  3MP8 A;  1URD A;  2OK2 A;  1L5T A;  2VP1 A;  1O63 A;  3KGC A;  1ZU0 A;  4ZEB A;  1NFT A;  2XXV A;  4GF8 A;  5CM6 A;  1QUI A;  3DM0 A;  3KN3 A;  1FQF A;  1VFE A;  1PB9 A;  2I48 A;  5DT6 A;  2Q8J A;  4DXU A;  2RCB A;  2H4I A;  4OZ9 A;  3T9V A;  3I3V A;  2HAU A;  3KZG A;  3CG1 A;  2GHA A;  2I58 A;  2QS4 A;  3UV1 A;  5ICQ A;  5K2Y A;  4Q5T A;  3CG3 A;  3O29 A;  1B2H A;  4F18 A;  5CMK A;  1POT A;  3M8U A;  2PT1 A;  1S9T A;  2RIN A;  5CC2 A;  1XHY A;  1B6H A;  3K2D A;  4KFQ A;  5AA4 A;  3GBA A;  2OCU A;  2Y7R A;  1IXH A;  1Y1Z A;  4LZ8 A;  2ONK E;  1D9Y A;  1GV8 A;  1WDN A;  4F22 A;  3UGW A;  3K02 A;  1J1N A;  1DTG A;  3ZS6 A;  2DWI A;  4QFP A;  3FJM A;  1XT8 A;  4N6P A;  2UYE A;  3EF7 A;  2XXP A;  4NF5 B;  2KLF A;  3MVW A;  1RYO A;  1MPD A;  4MF3 A;  4GRK A;  3A09 A;  4R75 A;  3K6W A;  1QUL A;  3PUW E;  3O97 A;  2XXY A;  1SD3 A;  4LAT A;  1Q1K A;  1Y3P A;  2CMO A;  1A40 A;  4KR5 A;  4BDQ A;  3FXU A;  4PET A;  5IKB A;  5I57 A;  1YTV A;  1N76 A;  4M4G A;  3OSR A;  3QSL A;  4IB2 A;  3S4U A;  3CR9 A;  1FW0 A;  1AMF A;  3RPW A;  1ZTY A;  2DE4 A;  3K00 A;  4NF4 A;  4OMB A;  1M5C A;  5TP9 A;  1OIB A;  4IO4 A;  3W15 C;  4GOT A;  3K6V A;  3O2A A;  1P1O A;  5TPA B;  3PPQ A;  3SDF A;  3KFM A;  3U8Q A;  4WKM A;  2OWT A;  3SEY A;  4H65 A;  1JNF A;  4BDL A;  2F78 A;  1IXG A;  2X7P A;  5FTH A;  3PUX E;  3EHU A;  1FQD A;  2P1S A;  3RTF B;  1CB6 A;  1IIT A;  1R6Z A;  2XD2 A;  1NNT A;  4G68 C;  3FZV A;  1B4H A;  4GXA A;  3TCG A;  5HM4 B;  1DTZ A;  4P11 A;  2HFB A;  1FQB A;  4DE8 A;  4THI A;  3KSJ A;  2Z22 A;  1HSL A;  1DSN A;  2XX9 A;  4YMA A;  1VSO A;  3FAS A;  4YMB A;  5J1D A;  3FD3 A;  3R7X A;  2X26 A;  1DPE A;  2UXA A;  1XS5 A;  4FJP A;  4I62 A;  2A5S A;  5L9M A;  3G7W A;  3B6T A;  4OET A;  1MRP A;  3FVG A;  4H67 A;  4Q0C A;  4XKQ A;  1MPB A;  4R6K A;  2DS9 A;  5KZT A;  4OTE A;  4IO5 A;  3HPI A;  4WEP A;  3BBR A;  4KHZ E;  4IO2 A;  1H45 A;  2UVH A;  2H98 A;  3M3L A;  4KYE A;  2D3I A;  3MQ9 A;  4OES A;  4K3F A;  2QS3 A;  2HQ0 A;  5HPQ A;  3BKI B;  4BDO A;  3IB2 A;  3FUZ A;  4NF5 A;  1JVY A;  3H06 B;  3IK6 B;  2GFE A;  1BKA A;  5EHS A;  4OQO A;  5FTI A;  3G3G A;  2RC8 A;  3RGY A;  4BDM A;  3RLF E;  5ICT A;  1FTJ A;  2HCA A;  4G77 A;  3TFL A;  3Q29 A;  2XXH A;  2I3V A;  3GZG A;  1OQH A;  5ITO A;  4DIG A;  5L9O A;  3O6H A;  3HST A;  2O69 A;  3H03 A;  2GRV A;  3M3F A;  5H8S A;  4IO6 A;  2V25 A;  1B52 A;  3IB0 A;  3QIM A;  4DDD A;  4F19 A;  2E1S A;  4G8M A;  4YAH X;  4H8I A;  4ZED A;  1B3F A;  3MVY A;  4QHQ A;  1T0K A;  1LBB A;  4DZ1 A;  1QW0 A;  5TPA A;  1MY3 A;  4I8C A;  3TQL A;  2Z8D A;  2O1L A;  5H8H B;  1SI1 A;  3PD9 A;  1IZ1 A;  1FTM A;  1TFA A;  3IAZ A;  3K6X A;  1LFH A;  1FTL A;  5CRY A;  2XXX A;  3R6U A;  4QSC A;  5AA2 B;  4ESW A;  2ZXT A;  2B3B A;  1YAE A;  3D4C A;  5B70 A;  2I0B A;  4U2R A;  3VXB A;  1OVT A;  3U72 A;  4POW A;  2ABH A;  4FED A;  1JET A;  3IX1 A;  3SES A;  4LP2 B;  3QAX A;  4U1Z A;  4P0G A;  2I0C A;  1LCF A;  4QSE A;  5EYF A;  1OVB A;  1B32 A;  3ECR A;  1N3X A;  3VVF A;  3K4U A;  3OMB A;  3VVE A;  4H8J A;  4R2F A;  1MH3 A;  1VR5 A;  1ZIU A;  4HS7 A;  2AYS A;  4YB6 A;  3G3F A;  3Q27 A;  2P2A A;  1YCJ A;  4F39 A;  1S50 A;  3U94 A;  4FAJ A;  2YJP A;  3S9M C;  2F5X A;  3TZA A;  1ANF A;  3C36 A;  1EZP A;  4ELP A;  1B40 A;  1GR2 A;  5EHM A;  4Q30 B;  3RY3 A;  1B4Z A;  5F1Q A;  4F1Y A;  4GLI A;  1OMP A;  2PT2 A;  3FIR A;  4F1U A;  4QFL A;  1UTH B;  1NNP A;  1QVS A;  5DYH A;  1HSE A;  4LQ2 A;  1N7W A;  2XXW A;  4OVJ A;  1MXV A;  1YPN A;  3PUY E;  1H43 A;  3CFZ A;  3HO7 A;  3VFJ A;  2V84 A;  1PEB A;  2Y84 A;  2AL5 A;  4GVO A;  3IOT A;  3CFX A;  5F7V A;  3TPA A;  3T66 A;  1MXY A;  4KPT A;  4O3C A;  3V5A A;  3Q26 A;  3K0V A;  2DXR A;  3WAE A;  2VOZ A;  3SEV A;  1XVY A;  5AA3 A;  4X1B A;  3Q25 A;  1UIV A;  4F3G A;  4EXK A;  1PBQ A;  1ATG A;  2NVU B;  3V83 A;  4XKN A;  3C35 A;  3PPP A;  4TQU Q;  4Z0I A;  1MXW A;  2V3U A;  2Y7I A;  3KEI A;  1IXC A;  5H8H A;  4RPN A;  1PC3 A;  3KN8 A;  2ALU A;  1IIW A;  1GVC A;  3SER A;  4MFI A;  3ODB A;  2GH9 A;  2V3T A;  3RT6 B;  5AA2 A;  1A8F A;  2H99 A;  4DCY A;  2ONS A;  3H6W A;  4AQ4 A;  4FAT A;  4GD5 A;  2RCA A;  3G3H A;  3S9E A;  3O6G A;  3OEM A; 
#chains in the Genus database with same CATH topology
 2XXI A;  4NED A;  5EYG A;  4MEV A;  1SW4 A;  4HW8 A;  3M3K A;  1B3L A;  2OBG A;  2RQF A;  2QJE A;  1LBW A;  4KYD A;  3H6V A;  3TCF A;  5I58 B;  4PAI A;  4ESX A;  1B58 A;  1LCT A;  3ILT B;  4IY6 A;  1VE4 A;  2Q9T A;  1BLF A;  1NNK A;  4F3B A;  4QBA A;  5KCJ B;  4OFL A;  3SKP A;  3KJ7 A;  4RXL A;  4MNP A;  3PUV E;  3EPE A;  5I7L A;  4IO3 A;  2QMX A;  2Y5L A;  1DPP A;  5IM2 A;  4F1V A;  3ZKK A;  4ISU A;  1I6B A;  5DVF A;  1EH3 A;  4PFB A;  3OEN A;  1FPE A;  4R9G A;  2ONR A;  5AE4 A;  3LC8 A;  3UN6 A;  3MAM A;  3FVO A;  3C31 A;  4NX1 A;  3MZB A;  2B3F A;  1CE2 A;  1B5H A;  1AOV A;  4PAF A;  1UTH A;  3C33 A;  3MJN A;  1MQI A;  1ZKB A;  4N8G A;  4R6H A;  3C32 A;  1UTB B;  1M5D A;  5H8N B;  1FBF A;  1MY2 A;  4NAP A;  2Q2C A;  3SET A;  1AWB A;  4PFW A;  1LFG A;  2ZYK A;  1SYI A;  4EXL A;  4L17 A;  5I5P A;  1MS7 A;  1IEJ A;  3DP8 A;  1B51 A;  1VDW A;  2L5V A;  2REJ A;  3FJ7 A;  4PQJ A;  1Y9U A;  3T1B A;  2DWA A;  4DI4 B;  1LBV A;  2D5W A;  2VHA A;  1SW2 A;  5IZZ A;  4X9T A;  5DEX B;  2HAV A;  3QMF A;  1R9L A;  5H8F A;  2QPQ A;  1DOT A;  1XVX A;  3TMG A;  2I4B A;  5TU0 A;  4GWO A;  2H5Y A;  1Y4T A;  4P56 A;  4OHN A;  1M5F A;  1NV7 A;  1P1W A;  3IB1 A;  3D1R A;  3G3K A;  4IR8 A;  1M5B A;  3PMX A;  4M1V A;  1MG1 A;  3D4G A;  4R74 A;  4YKP A;  3TTM A;  4GWZ A;  2IA4 A;  3A1Z A;  3E4R A;  3R26 A;  3I6V A;  4U4S A;  3CSB A;  2RF1 A;  4LZ7 A;  3IO6 A;  3L6H A;  5DVJ A;  3FBP A;  4MNC A;  4TLL B;  4C1T A;  1EZO A;  3E13 X;  3N6T A;  5I58 A;  4GFR A;  4RYA A;  4U22 A;  4HE0 A;  3IFA A;  2E0S A;  2F35 A;  5KCJ A;  1JP4 A;  3VLW A;  2FBP A;  3VLV A;  4RK9 A;  3CVG A;  1QUJ A;  1URG A;  3HHG A;  4U23 A;  4ZEK A;  3FJG A;  3SEU A;  1XC1 A;  3HHF A;  2O68 A;  1UQW A;  3PTY A;  3BFU A;  2Q89 A;  4X8R A;  1WOD A;  4X1D A;  1LAF E;  1I69 A;  1Y20 A;  4LZ5 A;  3F11 A;  3THI A;  1ZMG A;  1MM7 A;  1GTK A;  5CI5 A;  1LBZ A;  3QUJ A;  2WKY A;  1MM6 A;  4N07 A;  3CI8 A;  1B5J A;  4JSO A;  2QL3 A;  4MX6 A;  4G68 B;  4KI0 E;  3QK6 A;  4POX A;  3LR1 A;  3ZSF A;  2XX8 A;  2G93 A;  1Y1M A;  2X7Q A;  3G3J A;  2O7I A;  4JWY A;  1MXZ A;  1N84 A;  2Y7K A;  3FV1 A;  2FYI A;  1JVX A;  2XX7 A;  4OYV A;  2I6E A;  1UTB A;  2F8D A;  1FPF A;  3PMW A;  5H8N A;  4OVT A;  1DBZ A;  4RNS A;  4UAC A;  3MUQ A;  4OWD A;  3LUY A;  3ROJ A;  2ESN A;  4DCX A;  1N7X A;  1A99 A;  1MQD A;  4P47 A;  4FEC A;  5EYH A;  3RN8 A;  1BIY A;  5T3J A;  4JDF A;  2DP8 A;  1JEV A;  4FEB A;  5AA1 A;  1N0T A;  4NE4 A;  5AA2 D;  4P3L A;  4F2O A;  3OSQ A;  4PE3 A;  3CRB A;  2R6G E;  2RKM A;  1FBD A;  3AXF A;  1EYJ A;  4G61 A;  1B05 A;  2CEY A;  2MKZ A;  5BUU A;  4UA8 A;  4GIZ A;  2F3B A;  2FHY A;  4XTC Q;  5DEX A;  5DTB A;  4DLD A;  4OA4 A;  1NMU A;  1MDQ A;  1II5 A;  3DLN A;  4ELR A;  3IL1 B;  1FTA A;  5LOM A;  3N5L A;  5I2K B;  3BFT A;  3RNN A;  4JSD A;  3MYU A;  3IR1 A;  2Z23 A;  1B9J A;  3KC0 A;  1B3E A;  3N6U A;  4ONY A;  1JQF A;  2ZYM A;  3B8B A;  3PU5 A;  2WBD A;  2DXY A;  3EHS A;  4O8M A;  1HSJ A;  3TOD A;  2PMS A;  1A8E A;  1MQH A;  4YKI A;  2O51 A;  3MPK A;  3O66 A;  4R9F A;  1DMB A;  1I6Q A;  2O7U A;  4G0S A;  4R6Y A;  1TWY A;  4XIG Q;  4DXC A;  1N04 A;  2M8C A;  1Z7M E;  1O64 A;  3TEL A;  4KGO A;  4ELQ A;  4EF1 A;  4NGU A;  1USY E;  1JEU A;  2ZNS A;  4PCD A;  3C4M A;  4IY5 A;  1PB8 A;  1RKM A;  3O28 A;  3KOS A;  3MW0 A;  3IJX B;  3T9U A;  3OOA A;  1LB9 A;  4FIM A;  3PPN A;  3U65 A;  3K6U A;  3SEX A;  4YB7 A;  3U92 A;  3UP9 A;  1D9V A;  5H8Q B;  2V4C A;  4NWD A;  3O9P A;  4OVQ A;  4FOR A;  4JVI A;  1RYX A;  4UAB A;  3E79 A;  4ZZE A;  1LB8 A;  2REG A;  4QFO A;  1G0H A;  4HTG A;  1Y3Q A;  2QVR A;  4PBH A;  4G68 A;  4P9K A;  1I6A A;  4RY1 A;  3FVN A;  3IOV A;  2XXK A;  3PPR A;  4GX6 A;  4NN3 A;  3MP6 A;  1FPI A;  2HXW A;  1SDX A;  1Q35 A;  2YPN A;  2ZNT A;  1AIV A;  3FXQ A;  4F2Q A;  4QFK A;  1BP5 A;  3MVZ A;  1D4N A;  1A7L A;  1FTO A;  1JW1 A;  4XXU A;  5I2N A;  3LSW A;  4HCY A;  4IGT A;  1A55 A;  5K2X A;  5JK4 A;  3OD7 A;  4R72 A;  4MMP A;  1IME A;  2UVJ A;  1AH5 A;  4MIJ A;  3FV2 A;  4GQO A;  4ZEI A;  1LAH E;  2V3Q A;  1FCK A;  3TTL A;  3N26 A;  1FBC A;  1LGB C;  4PFR A;  4RJZ A;  2F36 A;  3IO4 A;  4YZZ A;  2VT5 A;  2RCK A;  3H3G A;  1MPC A;  3C34 A;  1FTK A;  1EYK A;  3FAT A;  1A54 A;  1FPG A;  3PGF A;  3E78 A;  2OZZ A;  4GL8 A;  1GGG A;  3ONM A;  1EZ9 A;  5H8F B;  3CHG A;  1LST A;  1NKX A;  3DEL B;  4PFY A;  5CMM A;  5I2K A;  3LSL A;  3KSX A;  1RDX A;  2WX9 A;  4ZE8 A;  4EQ7 A;  2LAO A;  1EWF A;  1Y4C A;  2DOJ A;  1B7H A;  4MNI A;  2OWS A;  4MLV A;  3GXA A;  2XWO A;  3EN3 A;  4O7M A;  4GWY A;  3MZ9 A;  4JVD A;  4JXI A;  2ANJ A;  4P0I A;  4GBW A;  4HCW A;  4ZEF A;  1URS A;  4QF9 A;  2FNC A;  1B3G A;  2O1M A;  4BDN A;  4ZDM A;  1EU8 A;  1LFI A;  3E8T A;  3MZ1 A;  2UVG A;  3B7D A;  2Q8M A;  1PBP A;  3MWB A;  5ISU A;  4DXB A;  2FIX A;  4F3P A;  4LVQ A;  3TAJ A;  3S2V A;  4NF0 A;  3H6U A;  4WED A;  1QUK A;  3ISP A;  3Q28 A;  1NUY A;  2Q2A A;  1OLA A;  2HXR A;  5JTY B;  2I49 A;  1B0H A;  2DSF A;  5EQ8 A;  4MJO A;  1O7T A;  3CFL A;  3OEL A;  4P1L A;  1XOC A;  5H8Q A;  3S9N C;  3U1O A;  2XXR A;  4OXV A;  3TCH A;  3A3C A;  4QRZ A;  5ET7 A;  2DE3 A;  2H25 A;  4YB5 A;  3K01 A;  2F7C A;  3RQT A;  1YYZ A;  1MH4 A;  3KBR A;  1ZLQ A;  4OER A;  2PVU A;  2A5T B;  3U93 A;  3CSG A;  3TEP A;  1ELJ A;  1FBH A;  4YIC A;  3T93 B;  3SEW A;  3H6T A;  2OJT A;  4KQP A;  5J16 A;  4MLQ A;  3IOR A;  1FPD A;  4LA9 A;  2HPG A;  3PPO A;  4LN5 A;  4U4X A;  1G0I A;  1YXI A;  1WVJ A;  2D21 A;  3UA8 A;  2XXT A;  3LV0 A;  4X04 A;  4PF6 A;  1MQG A;  2WBB A;  1JW5 A;  2F7B A;  4I1D A;  2DWJ A;  3T9H B;  5I3S A;  5ET5 A;  4LON B;  2CZH A;  4TOZ A;  2NOO A;  3C9H A;  4JWX A;  1DCU A;  3L6G A;  2PFY A;  2P3V A;  3T96 B;  3V89 B;  4BDR A;  4EQ9 A;  5CBR A;  4F2A A;  4OEN A;  2VD3 A;  4RK2 A;  1VFD A;  2JJK A;  2DYX A;  1MXX A;  4JVC A;  3S9L C;  1SBP A;  2PBW A;  3PUZ E;  3ZKL A;  3OEK A;  4KCD A;  4LUB A;  1TXF A;  5JEI A;  2HZL A;  2DDK A;  1SW1 A;  3N94 A;  3IFC A;  3FGS A;  3VXC A;  4O3B A;  4AS5 A;  3TQW A;  5A5X B;  3QYT A;  3TTK A;  1B5I A;  3TDJ A;  1FBG A;  1R9Q A;  3PD8 A;  1US4 A;  3DP6 A;  5B7D A;  3BIG A;  4LQ5 A;  2NUV A;  4C1U A;  1P1Q A;  1NV4 A;  2GHB A;  3MBP A;  1PDA A;  2F6G A;  4ZEC A;  1USY H;  2QS2 A;  3E8W A;  4ECF A;  1NNF A;  2KQZ A;  3H7M A;  4NF6 B;  4GL0 A;  1B3H A;  3W9V A;  4YKJ A;  3MPL A;  3IJO B;  4XF5 A;  1P1N A;  3TUS A;  4TLM B;  3N72 A;  2KR0 A;  4H0W A;  3LSF B;  2F6P A;  3A3U A;  4GBV A;  3HN0 A;  5EQ9 A;  1KA1 A;  2DQV A;  3VV5 A;  5FHM A;  2BJJ X;  4N8Y A;  4ELO A;  2ZZW A;  4JB7 A;  1LLS A;  4GXS B;  2OWZ A;  3JV9 A;  4BLA A;  1OQG A;  1QJM A;  4NHB A;  3WAF A;  2H9B A;  3VVD A;  1BP1 A;  4XKP A;  2O6A A;  1IMF A;  1R1N A;  1B7U A;  1N3W A;  2F7A A;  1F9B A;  1KA0 A;  2DWH A;  2AL4 A;  4OEU A;  1Y3N A;  3B6W A;  5JTY A;  4NF8 B;  2FA7 A;  5IZ1 A;  3T9X B;  3K1N A;  4N13 A;  4R73 A;  5I7K A;  1MDP 1;  1IQ7 A;  2DVZ A;  3I5O A;  2V93 A;  5L9S A;  5I56 B;  3OO7 A;  2DE2 A;  2XXQ A;  3LSX A;  4G2Z A;  4JWO A;  2XD3 A;  4NWC A;  5KDT B;  2ZZX A;  1FQA A;  4I3E A;  4PFU A;  1B1X A;  3IOU A;  3B50 A;  4OAN A;  2A5T A;  4H5G A;  1PB7 A;  4F29 A;  4O3A A;  4I9D A;  2CZI A;  4X48 A;  1KWH A;  1DK4 A;  4I3Y A;  1NV3 A;  3EKI A;  1FPL A;  3HFU A;  2XWV A;  3EHT A;  1FPB A;  4ZE9 A;  1B7Z A;  3RT8 A;  4NMY A;  5I59 B;  4U21 A;  4E0X A;  4G4P A;  5FHO A;  3KJT A;  3DP4 A;  4ZZA A;  3VLU A;  5I2N B;  2NWJ A;  4O94 A;  4PDD A;  1IXI A;  4H5F A;  1LAG E;  3KG2 A;  3OXN A;  2QRY A;  2UVI A;  3MP1 A;  4JBZ A;  3FVK A;  4MBP A;  1H76 A;  3OO6 A;  2Q88 A;  4E0W A;  1Z7N E;  1MY1 A;  3E3K A;  2HEU A;  3K1M A;  4KD5 A;  4MH5 A;  3SZP A;  1QKA A;  5CMC A;  4WXJ A;  5IZ3 B;  3T0J A;  1NH8 A;  3B6Q A;  1LEV A;  1ZJL A;  5EQ7 A;  5I84 A;  1QKB A;  3HCQ A;  2VPN A;  5A5X A;  2PYY A;  3TKD A;  2Y7P A;  5ESY A;  4EQB A;  1IUD A;  3MVX A;  1NV5 A;  2VGQ A;  1NH7 A;  3KN7 A;  2W7Y A;  2CZL A;  2ZNU A;  3TTR A;  3QUF A;  2GQ1 A;  4QSD A;  1FJ6 A;  4H45 A;  1S7Y A;  1P99 A;  2Z8F A;  1BTJ A;  2YLN A;  3USD A;  2OX3 A;  3ILU B;  1OLC A;  1SI0 A;  2Z8E A;  5HBC A;  3PMV A;  4NF6 A;  4OFJ A;  2O84 X;  3TYH A;  3O6I A;  4EF2 A;  3RYD A;  1SQY A;  3JZJ A;  4R2B A;  2I3W A;  4PFT A;  4KGH A;  4OEV A;  2UYF A;  2IEE A;  3OO8 A;  4QFN A;  3GBB A;  2XHD A;  3G3I A;  2P0S A;  2RC9 A;  1SYH A;  1D3K A;  3OO9 A;  1UIU A;  2VD2 A;  4G8N A;  1BK4 A;  4OVS A;  5M2V A;  1MXU A;  3TTN A;  3NOH A;  4XEQ A;  2XXU A;  4GWU A;  2R9J A;  3T22 A;  2G29 A;  3CIJ A;  3VDF A;  3E9X A;  4U1O A;  5BWJ A;  4RA1 A;  4NF8 A;  1SVX B;  3UOR A;  3V8X B;  4EDP A;  1NUZ A;  2Y7W A;  3W9W A;  3KOT A;  1LBC A;  5FHN A;  4EUO A;  2ZMB A;  2F34 A;  5I56 A;  3P7I A;  1ZBM A;  1FQC A;  5AA4 B;  5KDT A;  3IOW A;  1JW4 A;  1USV B;  3HV1 A;  4XKR A;  4Z7E A;  5LDZ A;  4ZS9 A;  2WYP A;  4PC9 A;  1MY4 A;  2AIX A;  4AB5 A;  4OFO A;  4F31 B;  2I4C A;  3VE1 B;  1H3D A;  3GLB A;  4RPO A;  2PX1 A;  4MHF A;  5CBS A;  4Q8R A;  2P3N A;  4NTL A;  2OLB A;  4KCC A;  2HZK A;  2QS1 A;  1SW5 A;  1TFD A;  4OVP A;  2B65 A;  4F3S A;  5I59 A;  3H4Z A;  1M5E A;  1FRP A;  4H1X A;  1NV6 A;  4C0R A;  3JYR A;  4PDH A;  2QSX A;  4EWS A;  3K1P A;  4PGP A;  5L8D A;  1CNQ A;  1MY0 A;  1LAX A;  5I7I A;  2ZYN A;  4IO7 A;  3UK4 A;  3MC2 A;  1AL3 A;  1B1H A;  2THI A;  2XWI A;  3LBS A;  1POY 1;  2RC7 A;  4FE8 A;  1SPI A;  4H6D A;  5ELV A;  2QMW A;  5I57 B;  4YU0 A;  5ITP A;  5DVI A;  3RUM A;  4AB6 A;  3PV0 E;  3UIF A;  1NUX A;  3FXR A;  1FPK A;  2NXO A;  4I40 A;  1FQE A;  5IAI A;  1H44 A;  5IZ3 A;  4PP0 A;  1P1U A;  1NL5 A;  2R71 A;  4ND9 A;  2XWK A;  3QXM A;  4G8H A;  4IGR A;  1B46 A;  4P1E A;  1US5 A;  4NF4 B;  2ZYO A;  4H46 A;  2Q74 A;  4YKK A;  4PE5 B;  3EQ1 A;  5TP9 B;  1B0L A;  1TT1 A;  5CMB A;  2F97 A;  3RTW B;  4GWW A;  2DVC A;  1MQJ A;  4KYS A;  1FJ9 A;  2XA5 A;  3MP8 A;  1URD A;  2OK2 A;  4NQ8 A;  1L5T A;  2VP1 A;  1O63 A;  3KGC A;  1ZU0 A;  4ZEB A;  1NFT A;  2XXV A;  4GF8 A;  5CM6 A;  1QUI A;  3DM0 A;  1RDZ A;  4PGN A;  3KN3 A;  1YZ0 A;  1FQF A;  1VFE A;  1PB9 A;  2I48 A;  4O7I A;  5DT6 A;  2Q8J A;  4DXU A;  2RCB A;  2H4I A;  4OZ9 A;  2B4L A;  3T9V A;  3FXB A;  3I3V A;  2HAU A;  3KZG A;  3CG1 A;  2GHA A;  2I58 A;  2QS4 A;  3UV1 A;  5ICQ A;  5K2Y A;  4Q5T A;  3CG3 A;  3O29 A;  3KBZ A;  1B2H A;  4F18 A;  2OBD A;  4XFE A;  5CMK A;  1POT A;  3M8U A;  2PT1 A;  1S9T A;  2RIN A;  5CC2 A;  1XHY A;  4N91 A;  1B6H A;  3K2D A;  4KFQ A;  4PBQ A;  5AA4 A;  3GBA A;  2OCU A;  2Y7R A;  1FPJ A;  1IXH A;  1Y1Z A;  1NV1 A;  4LZ8 A;  2ONK E;  1D9Y A;  1GV8 A;  1WDN A;  4F22 A;  3UGW A;  3K02 A;  3LUZ A;  1J1N A;  1DTG A;  3ZS6 A;  2DWI A;  4QFP A;  3FJM A;  5EQA A;  2Y5K A;  1XT8 A;  4N6P A;  2UYE A;  3EF7 A;  2XXP A;  4NF5 B;  2KLF A;  3MVW A;  1RYO A;  1MPD A;  5LTC A;  2CZK A;  2ZZV A;  3KC1 A;  3BIH A;  4MF3 A;  4GRK A;  3A09 A;  4R75 A;  3K6W A;  1QUL A;  2BJI A;  3AOS A;  3PUW E;  3O97 A;  2XXY A;  1SD3 A;  4LAT A;  1Q1K A;  4N6K A;  1Y3P A;  4GX4 A;  4FBP A;  2CMO A;  1A40 A;  4KR5 A;  4BDQ A;  3FXU A;  4PET A;  2QVV A;  5IKB A;  5I57 A;  1YTV A;  4HXV A;  5F24 A;  1N76 A;  4M4G A;  3OSR A;  1XI6 A;  3QSL A;  4IB2 A;  1NUW A;  3S4U A;  3CR9 A;  1FW0 A;  1AMF A;  3RPW A;  4OVR A;  1ZTY A;  2DE4 A;  3K00 A;  4NF4 A;  4OMB A;  1FSA A;  1M5C A;  5TP9 A;  1OIB A;  4IO4 A;  3W15 C;  4GOT A;  3K6V A;  3O2A A;  5IGA A;  1P1O A;  5TPA B;  1EYI A;  3PPQ A;  3SDF A;  3KFM A;  3U8Q A;  4WKM A;  2OWT A;  3SEY A;  2R8T A;  4H65 A;  1JNF A;  4BDL A;  4MAG A;  2F78 A;  1IXG A;  2X7P A;  5FTH A;  3PUX E;  3EHU A;  1FQD A;  2PCR A;  5ET6 A;  4N17 A;  4M4D A;  2P1S A;  3RTF B;  1CB6 A;  1IIT A;  1IMC A;  1R6Z A;  2FVZ A;  2XD2 A;  1NNT A;  3A29 A;  4G68 C;  3FZV A;  1B4H A;  4GXA A;  3TCG A;  5ET8 A;  5HM4 B;  5DW8 A;  1DTZ A;  4P11 A;  2HFB A;  1FQB A;  4DE8 A;  4THI A;  4PTK A;  3KSJ A;  2Z22 A;  5FBP A;  1HSL A;  1DSN A;  2XX9 A;  4YMA A;  1VSO A;  3FAS A;  4YMB A;  5J1D A;  3FD3 A;  3R7X A;  2X26 A;  1DPE A;  4PF8 A;  2UXA A;  1XS5 A;  4FJP A;  4I62 A;  4GWS A;  2A5S A;  5L9M A;  3G7W A;  3B6T A;  4OET A;  1RDY A;  1MRP A;  3FVG A;  4H67 A;  4Q0C A;  4XKQ A;  1MPB A;  4R6K A;  2DS9 A;  1Q9D A;  5KZT A;  4OTE A;  4MCO A;  4IO5 A;  3HPI A;  4WEP A;  3BBR A;  4KHZ E;  4IO2 A;  1H45 A;  2UVH A;  2H98 A;  3M3L A;  4KYE A;  2D3I A;  3MQ9 A;  4OES A;  4K3F A;  2QS3 A;  2HQ0 A;  5HPQ A;  3BKI B;  4BDO A;  3IB2 A;  3FUZ A;  4NF5 A;  1JVY A;  3H06 B;  3IK6 B;  2GFE A;  1BKA A;  5EHS A;  1NV0 A;  2PFZ A;  4OQO A;  5FTI A;  1QGX A;  1INP A;  3G3G A;  4GX3 A;  2RC8 A;  3RGY A;  4BDM A;  3GYY A;  3RLF E;  5ICT A;  1FTJ A;  2HCA A;  4G77 A;  3TFL A;  3Q29 A;  2XXH A;  2I3V A;  1NV2 A;  2WEF A;  3GZG A;  3RPL B;  1OQH A;  4DI3 D;  2B4M A;  5ITO A;  4DIG A;  5L9O A;  3O6H A;  3HST A;  2O69 A;  3H03 A;  2GRV A;  3M3F A;  5H8S A;  4IO6 A;  4N6D A;  4N81 A;  2V25 A;  1B52 A;  3IB0 A;  3QIM A;  4DDD A;  1IMB A;  1K9Z A;  4F19 A;  2E1S A;  4G8M A;  4YAH X;  4H8I A;  4ZED A;  1B3F A;  1LBX A;  3MVY A;  4QHQ A;  1T0K A;  1LBB A;  4DZ1 A;  1QW0 A;  5TPA A;  1MY3 A;  4I8C A;  3TQL A;  2Z8D A;  2O1L A;  5H8H B;  1SI1 A;  3PD9 A;  1IZ1 A;  1FTM A;  1TFA A;  3IAZ A;  3K6X A;  1LFH A;  1FTL A;  5CRY A;  2XXX A;  3R6U A;  4QSC A;  5AA2 B;  2HHM A;  4ESW A;  4AS4 A;  2ZXT A;  2B3B A;  4HE1 A;  1IMA A;  1YAE A;  3D4C A;  5B70 A;  2I0B A;  4U2R A;  3VXB A;  1OVT A;  3U72 A;  4POW A;  2ABH A;  4FED A;  2QFL A;  1JET A;  3MST A;  4PFI A;  3IX1 A;  3SES A;  4LP2 B;  3QAX A;  4U1Z A;  4P0G A;  1D9Q A;  2I0C A;  4P8B A;  1LCF A;  4QSE A;  5EYF A;  1OVB A;  1B32 A;  3ECR A;  1N3X A;  3VVF A;  3K4U A;  3OMB A;  3VVE A;  4PAK A;  4H8J A;  4R2F A;  1MH3 A;  1VR5 A;  1ZIU A;  4HS7 A;  2AYS A;  4YB6 A;  3G3F A;  3Q27 A;  2P2A A;  1YCJ A;  4F39 A;  1S50 A;  3U94 A;  2VPO A;  4HE2 A;  4FAJ A;  2YJP A;  4KXP A;  3S9M C;  2F5X A;  3TZA A;  1USU B;  5A5L A;  1ANF A;  3C36 A;  1EZP A;  4QXD A;  4ELP A;  1K9Y A;  1B40 A;  1GR2 A;  5EHM A;  4Q30 B;  3RY3 A;  1B4Z A;  5F1Q A;  4F1Y A;  4GLI A;  1OMP A;  2PT2 A;  3L6I A;  3FIR A;  4F1U A;  4QFL A;  2F3D A;  1NNP A;  1UTH B;  1QVS A;  5DYH A;  1HSE A;  4LQ2 A;  1N7W A;  2XXW A;  4OVJ A;  1MXV A;  2QVU A;  1YPN A;  3PUY E;  2WYK A;  3RPL A;  4N15 A;  1H43 A;  3CFZ A;  3HO7 A;  3VFJ A;  2V84 A;  1PEB A;  2Y84 A;  2AL5 A;  4GVO A;  3IOT A;  3CFX A;  3AOT A;  5F7V A;  3TPA A;  3T66 A;  1MXY A;  4KPT A;  4O3C A;  1FBP A;  3V5A A;  3Q26 A;  3K0V A;  1FBE A;  2DXR A;  3WAE A;  2VOZ A;  3SEV A;  1NI9 A;  1XVY A;  5AA3 A;  4X1B A;  3Q25 A;  2CEX A;  1UIV A;  4F3G A;  4EXK A;  1PBQ A;  1ATG A;  1IMD A;  2NVU B;  3ZPM A;  3V83 A;  4XKN A;  3C35 A;  3PPP A;  4TQU Q;  4Z0I A;  1MXW A;  2V3U A;  2Y7I A;  3KEI A;  1IXC A;  5H8H A;  4RPN A;  1PC3 A;  3KN8 A;  1KZ8 A;  2ALU A;  4N4U A;  1IIW A;  5I7J A;  1GVC A;  3SER A;  4MFI A;  3ODB A;  2GH9 A;  2V3T A;  4NG7 A;  2FIE A;  3RT6 B;  5AA2 A;  1A8F A;  1LBY A;  2H99 A;  4DCY A;  2ONS A;  3H6W A;  4AQ4 A;  4GWX A;  4FAT A;  4GD5 A;  2RCA A;  3G3H A;  3S9E A;  3O6G A;  3OEM A; 
#chains in the Genus database with same CATH homology
 2XXI A;  4NED A;  1SW4 A;  4HW8 A;  3M3K A;  1B3L A;  2OBG A;  2RQF A;  2QJE A;  4KYD A;  3H6V A;  3TCF A;  5I58 B;  4ESX A;  1B58 A;  1LCT A;  3ILT B;  4IY6 A;  1VE4 A;  2Q9T A;  1BLF A;  1NNK A;  4F3B A;  5KCJ B;  4OFL A;  3SKP A;  3KJ7 A;  4RXL A;  3PUV E;  3EPE A;  5I7L A;  4IO3 A;  2QMX A;  1DPP A;  4F1V A;  3ZKK A;  4ISU A;  1I6B A;  5DVF A;  1EH3 A;  3OEN A;  4R9G A;  2ONR A;  5AE4 A;  3LC8 A;  3UN6 A;  3MAM A;  3FVO A;  3C31 A;  3MZB A;  2B3F A;  1CE2 A;  1B5H A;  1AOV A;  1UTH A;  3C33 A;  3MJN A;  1MQI A;  1ZKB A;  4R6H A;  3C32 A;  1UTB B;  1M5D A;  5H8N B;  1MY2 A;  2Q2C A;  3SET A;  4PFW A;  1LFG A;  2ZYK A;  1SYI A;  4EXL A;  4L17 A;  1MS7 A;  1IEJ A;  3DP8 A;  1B51 A;  2REJ A;  3FJ7 A;  4PQJ A;  1Y9U A;  2DWA A;  2D5W A;  2VHA A;  1SW2 A;  4X9T A;  5DEX B;  2HAV A;  1R9L A;  5H8F A;  2QPQ A;  1DOT A;  1XVX A;  3TMG A;  2I4B A;  5TU0 A;  4GWO A;  2H5Y A;  1Y4T A;  4OHN A;  1M5F A;  1P1W A;  3IB1 A;  3G3K A;  1M5B A;  3PMX A;  4M1V A;  1MG1 A;  3D4G A;  4R74 A;  4YKP A;  3TTM A;  2IA4 A;  3A1Z A;  3E4R A;  3R26 A;  3I6V A;  4U4S A;  3CSB A;  2RF1 A;  4LZ7 A;  3IO6 A;  3L6H A;  5DVJ A;  4TLL B;  4C1T A;  1EZO A;  3E13 X;  3N6T A;  5I58 A;  4GFR A;  4RYA A;  4U22 A;  2E0S A;  2F35 A;  5KCJ A;  3VLW A;  3VLV A;  4RK9 A;  3CVG A;  1QUJ A;  1URG A;  3HHG A;  4U23 A;  4ZEK A;  3FJG A;  3SEU A;  1XC1 A;  3HHF A;  2O68 A;  1UQW A;  3BFU A;  2Q89 A;  1WOD A;  4X1D A;  1LAF E;  1I69 A;  1Y20 A;  4LZ5 A;  3F11 A;  3THI A;  1ZMG A;  1MM7 A;  1GTK A;  5CI5 A;  3QUJ A;  2WKY A;  1MM6 A;  4N07 A;  3CI8 A;  1B5J A;  4JSO A;  2QL3 A;  4G68 B;  4KI0 E;  3QK6 A;  4POX A;  3LR1 A;  3ZSF A;  2XX8 A;  2G93 A;  1Y1M A;  2X7Q A;  3G3J A;  2O7I A;  4JWY A;  1MXZ A;  1N84 A;  2Y7K A;  3FV1 A;  2FYI A;  1JVX A;  2XX7 A;  4OYV A;  2I6E A;  1UTB A;  2F8D A;  3PMW A;  5H8N A;  4RNS A;  4UAC A;  3MUQ A;  4OWD A;  3LUY A;  2ESN A;  4DCX A;  1N7X A;  1A99 A;  1MQD A;  4FEC A;  3RN8 A;  1BIY A;  4JDF A;  2DP8 A;  1JEV A;  4FEB A;  5AA1 A;  1N0T A;  4NE4 A;  5AA2 D;  4F2O A;  3OSQ A;  3CRB A;  2R6G E;  2RKM A;  3AXF A;  1B05 A;  5BUU A;  4UA8 A;  4GIZ A;  4XTC Q;  5DEX A;  5DTB A;  4DLD A;  1NMU A;  1MDQ A;  1II5 A;  3DLN A;  4ELR A;  3IL1 B;  5LOM A;  3N5L A;  5I2K B;  3BFT A;  3RNN A;  4JSD A;  3IR1 A;  2Z23 A;  1B9J A;  1B3E A;  3N6U A;  4ONY A;  1JQF A;  2ZYM A;  3PU5 A;  2DXY A;  3EHS A;  1HSJ A;  3TOD A;  2PMS A;  1A8E A;  1MQH A;  4YKI A;  2O51 A;  3MPK A;  3O66 A;  4R9F A;  1DMB A;  1I6Q A;  2O7U A;  4G0S A;  4R6Y A;  1TWY A;  4XIG Q;  4DXC A;  1N04 A;  2M8C A;  1Z7M E;  1O64 A;  3TEL A;  4KGO A;  4ELQ A;  4EF1 A;  1USY E;  1JEU A;  2ZNS A;  3C4M A;  4IY5 A;  1PB8 A;  1RKM A;  3O28 A;  3KOS A;  3MW0 A;  3IJX B;  3T9U A;  3OOA A;  1LB9 A;  4FIM A;  3PPN A;  3K6U A;  3SEX A;  4YB7 A;  3U92 A;  3UP9 A;  1D9V A;  5H8Q B;  4NWD A;  3O9P A;  4FOR A;  1RYX A;  4ZZE A;  1LB8 A;  2REG A;  4QFO A;  4HTG A;  1Y3Q A;  4G68 A;  1I6A A;  4RY1 A;  3FVN A;  3IOV A;  3PPR A;  3MP6 A;  2HXW A;  1SDX A;  1Q35 A;  2YPN A;  2ZNT A;  1AIV A;  3FXQ A;  4F2Q A;  4QFK A;  1BP5 A;  3MVZ A;  1D4N A;  1A7L A;  1FTO A;  1JW1 A;  4XXU A;  5I2N A;  3LSW A;  4HCY A;  4IGT A;  1A55 A;  5K2X A;  5JK4 A;  3OD7 A;  4R72 A;  2UVJ A;  1AH5 A;  3FV2 A;  4GQO A;  4ZEI A;  1LAH E;  2V3Q A;  1FCK A;  3TTL A;  3N26 A;  1LGB C;  4RJZ A;  2F36 A;  3IO4 A;  4YZZ A;  2RCK A;  3H3G A;  1MPC A;  3C34 A;  1FTK A;  3FAT A;  1A54 A;  3PGF A;  2OZZ A;  4GL8 A;  1GGG A;  3ONM A;  1EZ9 A;  5H8F B;  1LST A;  1NKX A;  3DEL B;  4PFY A;  5CMM A;  5I2K A;  3LSL A;  3KSX A;  4ZE8 A;  4EQ7 A;  2LAO A;  1EWF A;  1Y4C A;  2DOJ A;  1B7H A;  2OWS A;  4MLV A;  3GXA A;  3EN3 A;  3MZ9 A;  4JXI A;  2ANJ A;  4P0I A;  4HCW A;  4ZEF A;  1URS A;  4QF9 A;  2FNC A;  1B3G A;  2O1M A;  4BDN A;  4ZDM A;  1EU8 A;  1LFI A;  3E8T A;  3MZ1 A;  2UVG A;  3B7D A;  1PBP A;  3MWB A;  5ISU A;  4DXB A;  4F3P A;  4LVQ A;  3TAJ A;  3S2V A;  3H6U A;  4WED A;  1QUK A;  3Q28 A;  2Q2A A;  1OLA A;  5JTY B;  2I49 A;  1B0H A;  2DSF A;  1O7T A;  3CFL A;  3OEL A;  1XOC A;  5H8Q A;  3S9N C;  3U1O A;  2XXR A;  4OXV A;  3TCH A;  3A3C A;  4QRZ A;  2DE3 A;  2H25 A;  4YB5 A;  3K01 A;  2F7C A;  3RQT A;  1MH4 A;  3KBR A;  1ZLQ A;  4OER A;  2PVU A;  2A5T B;  3U93 A;  3CSG A;  3TEP A;  1ELJ A;  4YIC A;  3T93 B;  3SEW A;  3H6T A;  2OJT A;  4KQP A;  4MLQ A;  3IOR A;  4LA9 A;  3PPO A;  4U4X A;  1WVJ A;  2D21 A;  3UA8 A;  2XXT A;  1MQG A;  1JW5 A;  2F7B A;  4I1D A;  2DWJ A;  3T9H B;  4LON B;  4TOZ A;  2NOO A;  3C9H A;  4JWX A;  3L6G A;  4BDR A;  3V89 B;  3T96 B;  4EQ9 A;  5CBR A;  4F2A A;  4OEN A;  2VD3 A;  4RK2 A;  1VFD A;  2DYX A;  1MXX A;  3S9L C;  1SBP A;  2PBW A;  3PUZ E;  3ZKL A;  3OEK A;  4KCD A;  4LUB A;  1TXF A;  5JEI A;  2HZL A;  1SW1 A;  3N94 A;  3FGS A;  3VXC A;  4O3B A;  3TQW A;  5A5X B;  3QYT A;  3TTK A;  1B5I A;  3TDJ A;  1R9Q A;  3PD8 A;  1US4 A;  3DP6 A;  5B7D A;  4LQ5 A;  2NUV A;  4C1U A;  1P1Q A;  2GHB A;  3MBP A;  1PDA A;  2F6G A;  4ZEC A;  1USY H;  2QS2 A;  3E8W A;  4ECF A;  1NNF A;  3H7M A;  4NF6 B;  4GL0 A;  1B3H A;  3W9V A;  4YKJ A;  3MPL A;  3IJO B;  1P1N A;  3TUS A;  4TLM B;  3N72 A;  4H0W A;  3LSF B;  2F6P A;  3A3U A;  3HN0 A;  2DQV A;  3VV5 A;  5FHM A;  2BJJ X;  4ELO A;  4JB7 A;  1LLS A;  4GXS B;  3JV9 A;  4BLA A;  1OQG A;  1QJM A;  3WAF A;  2H9B A;  3VVD A;  1BP1 A;  4XKP A;  2O6A A;  1R1N A;  1B7U A;  1N3W A;  2F7A A;  1F9B A;  2DWH A;  2AL4 A;  4OEU A;  1Y3N A;  3B6W A;  5JTY A;  4NF8 B;  2FA7 A;  3T9X B;  3K1N A;  4N13 A;  4R73 A;  5I7K A;  1MDP 1;  1IQ7 A;  2DVZ A;  3I5O A;  2V93 A;  5L9S A;  5I56 B;  3OO7 A;  2DE2 A;  2XXQ A;  3LSX A;  4G2Z A;  4JWO A;  2XD3 A;  4NWC A;  5KDT B;  1FQA A;  4PFU A;  1B1X A;  3IOU A;  2A5T A;  4H5G A;  1PB7 A;  4F29 A;  4O3A A;  4I9D A;  4X48 A;  1KWH A;  3EHT A;  4ZE9 A;  1B7Z A;  3RT8 A;  4NMY A;  5I59 B;  4U21 A;  4E0X A;  4G4P A;  5FHO A;  3KJT A;  3DP4 A;  4ZZA A;  3VLU A;  5I2N B;  2NWJ A;  1IXI A;  4H5F A;  1LAG E;  3KG2 A;  3OXN A;  2QRY A;  2UVI A;  3MP1 A;  4JBZ A;  3FVK A;  4MBP A;  1H76 A;  3OO6 A;  2Q88 A;  4E0W A;  1Z7N E;  1MY1 A;  3E3K A;  2HEU A;  3K1M A;  4KD5 A;  4MH5 A;  1QKA A;  5CMC A;  4WXJ A;  1NH8 A;  3B6Q A;  1ZJL A;  5I84 A;  1QKB A;  3HCQ A;  5A5X A;  2PYY A;  3TKD A;  2Y7P A;  4EQB A;  1IUD A;  3MVX A;  2VGQ A;  1NH7 A;  3KN7 A;  2W7Y A;  2CZL A;  2ZNU A;  3TTR A;  3QUF A;  4QSD A;  1S7Y A;  1P99 A;  2Z8F A;  1BTJ A;  2YLN A;  3USD A;  3ILU B;  1OLC A;  1SI0 A;  2Z8E A;  5HBC A;  3PMV A;  4NF6 A;  4OFJ A;  2O84 X;  3TYH A;  3O6I A;  4EF2 A;  1SQY A;  3JZJ A;  4R2B A;  2I3W A;  4PFT A;  4KGH A;  4OEV A;  2UYF A;  2IEE A;  3OO8 A;  4QFN A;  3GBB A;  2XHD A;  3G3I A;  2P0S A;  2RC9 A;  1SYH A;  1D3K A;  3OO9 A;  1UIU A;  2VD2 A;  4G8N A;  5M2V A;  1MXU A;  3TTN A;  2XXU A;  2R9J A;  3T22 A;  2G29 A;  3CIJ A;  3VDF A;  3E9X A;  4U1O A;  5BWJ A;  4RA1 A;  4NF8 A;  1SVX B;  3UOR A;  3V8X B;  4EDP A;  2Y7W A;  3W9W A;  3KOT A;  1LBC A;  5FHN A;  4EUO A;  2ZMB A;  2F34 A;  5I56 A;  3P7I A;  1ZBM A;  1FQC A;  5AA4 B;  5KDT A;  3IOW A;  1JW4 A;  1USV B;  3HV1 A;  4XKR A;  4Z7E A;  4ZS9 A;  1MY4 A;  2AIX A;  4AB5 A;  4OFO A;  4F31 B;  2I4C A;  3VE1 B;  1H3D A;  3GLB A;  4RPO A;  2PX1 A;  5CBS A;  4Q8R A;  4NTL A;  2OLB A;  4KCC A;  2HZK A;  2QS1 A;  1SW5 A;  1TFD A;  2B65 A;  4F3S A;  5I59 A;  3H4Z A;  1M5E A;  4H1X A;  4C0R A;  3JYR A;  2QSX A;  4EWS A;  3K1P A;  5L8D A;  1MY0 A;  1LAX A;  2ZYN A;  4IO7 A;  3UK4 A;  3MC2 A;  1AL3 A;  1B1H A;  2THI A;  3LBS A;  1POY 1;  2RC7 A;  4FE8 A;  4H6D A;  5ELV A;  2QMW A;  5I57 B;  4YU0 A;  5ITP A;  5DVI A;  3RUM A;  4AB6 A;  3PV0 E;  3UIF A;  3FXR A;  2NXO A;  1FQE A;  5IAI A;  1H44 A;  4PP0 A;  1P1U A;  1NL5 A;  2R71 A;  4ND9 A;  4G8H A;  3QXM A;  4IGR A;  1B46 A;  1US5 A;  4NF4 B;  2ZYO A;  4YKK A;  4PE5 B;  3EQ1 A;  5TP9 B;  1B0L A;  1TT1 A;  5CMB A;  2F97 A;  3RTW B;  2DVC A;  1MQJ A;  4KYS A;  3MP8 A;  1URD A;  2OK2 A;  1L5T A;  2VP1 A;  1O63 A;  3KGC A;  1ZU0 A;  4ZEB A;  1NFT A;  2XXV A;  4GF8 A;  5CM6 A;  1QUI A;  3DM0 A;  3KN3 A;  1FQF A;  1VFE A;  1PB9 A;  2I48 A;  5DT6 A;  2Q8J A;  4DXU A;  2RCB A;  2H4I A;  4OZ9 A;  3T9V A;  3I3V A;  2HAU A;  3KZG A;  3CG1 A;  2GHA A;  2I58 A;  2QS4 A;  3UV1 A;  5ICQ A;  5K2Y A;  4Q5T A;  3CG3 A;  3O29 A;  1B2H A;  4F18 A;  2OBD A;  5CMK A;  1POT A;  3M8U A;  2PT1 A;  1S9T A;  2RIN A;  5CC2 A;  1XHY A;  1B6H A;  3K2D A;  4KFQ A;  5AA4 A;  3GBA A;  2OCU A;  2Y7R A;  1IXH A;  1Y1Z A;  4LZ8 A;  2ONK E;  1D9Y A;  1GV8 A;  1WDN A;  4F22 A;  3UGW A;  3K02 A;  1J1N A;  1DTG A;  3ZS6 A;  2DWI A;  4QFP A;  3FJM A;  1XT8 A;  4N6P A;  2UYE A;  3EF7 A;  2XXP A;  4NF5 B;  2KLF A;  3MVW A;  1RYO A;  1MPD A;  4MF3 A;  4GRK A;  3A09 A;  4R75 A;  3K6W A;  1QUL A;  3PUW E;  3AOS A;  3O97 A;  2XXY A;  1SD3 A;  4LAT A;  1Q1K A;  1Y3P A;  2CMO A;  1A40 A;  4KR5 A;  4BDQ A;  3FXU A;  4PET A;  5IKB A;  5I57 A;  1YTV A;  1N76 A;  4M4G A;  3OSR A;  3QSL A;  4IB2 A;  3S4U A;  3CR9 A;  1FW0 A;  1AMF A;  3RPW A;  1ZTY A;  2DE4 A;  3K00 A;  4NF4 A;  4OMB A;  1M5C A;  5TP9 A;  1OIB A;  4IO4 A;  3W15 C;  4GOT A;  3K6V A;  3O2A A;  1P1O A;  5TPA B;  3PPQ A;  3SDF A;  3KFM A;  3U8Q A;  4WKM A;  2OWT A;  3SEY A;  4H65 A;  1JNF A;  4BDL A;  2F78 A;  1IXG A;  2X7P A;  5FTH A;  3PUX E;  3EHU A;  1FQD A;  4M4D A;  2P1S A;  3RTF B;  1CB6 A;  1IIT A;  1R6Z A;  2XD2 A;  1NNT A;  4G68 C;  3FZV A;  1B4H A;  4GXA A;  3TCG A;  5HM4 B;  1DTZ A;  4P11 A;  2HFB A;  1FQB A;  4DE8 A;  4THI A;  3KSJ A;  2Z22 A;  1HSL A;  1DSN A;  2XX9 A;  4YMA A;  1VSO A;  3FAS A;  4YMB A;  5J1D A;  3FD3 A;  3R7X A;  2X26 A;  1DPE A;  2UXA A;  1XS5 A;  4FJP A;  4I62 A;  2A5S A;  5L9M A;  3G7W A;  3B6T A;  4OET A;  1MRP A;  3FVG A;  4H67 A;  4Q0C A;  4XKQ A;  1MPB A;  4R6K A;  2DS9 A;  5KZT A;  4OTE A;  4IO5 A;  3HPI A;  4WEP A;  3BBR A;  4KHZ E;  4IO2 A;  1H45 A;  2UVH A;  2H98 A;  3M3L A;  4KYE A;  2D3I A;  3MQ9 A;  4OES A;  4K3F A;  2QS3 A;  2HQ0 A;  5HPQ A;  3BKI B;  4BDO A;  3IB2 A;  3FUZ A;  4NF5 A;  1JVY A;  3H06 B;  3IK6 B;  2GFE A;  1BKA A;  5EHS A;  4OQO A;  5FTI A;  3G3G A;  2RC8 A;  3RGY A;  4BDM A;  3RLF E;  5ICT A;  1FTJ A;  2HCA A;  4G77 A;  3TFL A;  3Q29 A;  2XXH A;  2I3V A;  3GZG A;  1OQH A;  5ITO A;  4DIG A;  5L9O A;  3O6H A;  3HST A;  2O69 A;  3H03 A;  2GRV A;  3M3F A;  5H8S A;  4IO6 A;  2V25 A;  1B52 A;  3IB0 A;  3QIM A;  4DDD A;  4F19 A;  2E1S A;  4G8M A;  4YAH X;  4H8I A;  4ZED A;  1B3F A;  3MVY A;  4QHQ A;  1T0K A;  1LBB A;  4DZ1 A;  1QW0 A;  5TPA A;  1MY3 A;  4I8C A;  3TQL A;  2Z8D A;  2O1L A;  5H8H B;  1SI1 A;  3PD9 A;  1IZ1 A;  1FTM A;  1TFA A;  3IAZ A;  3K6X A;  1LFH A;  1FTL A;  5CRY A;  2XXX A;  3R6U A;  4QSC A;  5AA2 B;  4ESW A;  2ZXT A;  2B3B A;  1YAE A;  3D4C A;  5B70 A;  2I0B A;  4U2R A;  3VXB A;  1OVT A;  3U72 A;  4POW A;  2ABH A;  4FED A;  1JET A;  3IX1 A;  3SES A;  4LP2 B;  3QAX A;  4U1Z A;  4P0G A;  2I0C A;  1LCF A;  4QSE A;  5EYF A;  1OVB A;  1B32 A;  3ECR A;  1N3X A;  3VVF A;  3K4U A;  3OMB A;  3VVE A;  4H8J A;  4R2F A;  1MH3 A;  1VR5 A;  1ZIU A;  4HS7 A;  2AYS A;  4YB6 A;  3G3F A;  3Q27 A;  2P2A A;  1YCJ A;  4F39 A;  1S50 A;  3U94 A;  4FAJ A;  2YJP A;  3S9M C;  2F5X A;  3TZA A;  1USU B;  1ANF A;  3C36 A;  1EZP A;  4ELP A;  1B40 A;  1GR2 A;  5EHM A;  4Q30 B;  3RY3 A;  1B4Z A;  5F1Q A;  4F1Y A;  4GLI A;  1OMP A;  2PT2 A;  3L6I A;  3FIR A;  4F1U A;  4QFL A;  1UTH B;  1NNP A;  1QVS A;  5DYH A;  1HSE A;  4LQ2 A;  1N7W A;  2XXW A;  4OVJ A;  1MXV A;  1YPN A;  3PUY E;  1H43 A;  3CFZ A;  3HO7 A;  3VFJ A;  2V84 A;  1PEB A;  2Y84 A;  2AL5 A;  4GVO A;  3IOT A;  3CFX A;  3AOT A;  5F7V A;  3TPA A;  3T66 A;  1MXY A;  4KPT A;  4O3C A;  3V5A A;  3Q26 A;  3K0V A;  2DXR A;  3WAE A;  2VOZ A;  3SEV A;  1XVY A;  5AA3 A;  4X1B A;  3Q25 A;  1UIV A;  4F3G A;  4EXK A;  1PBQ A;  1ATG A;  2NVU B;  3ZPM A;  3V83 A;  4XKN A;  3C35 A;  3PPP A;  4TQU Q;  4Z0I A;  1MXW A;  2V3U A;  2Y7I A;  3KEI A;  1IXC A;  5H8H A;  4RPN A;  1PC3 A;  3KN8 A;  2ALU A;  1IIW A;  5I7J A;  1GVC A;  3SER A;  4MFI A;  3ODB A;  2GH9 A;  2V3T A;  3RT6 B;  5AA2 A;  1A8F A;  2H99 A;  4DCY A;  2ONS A;  3H6W A;  4AQ4 A;  4FAT A;  4GD5 A;  2RCA A;  3G3H A;  3S9E A;  3O6G A;  3OEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...