3HAXD

Crystal structure of a substrate-bound gar1-minus h/aca rnp from pyrococcus furiosus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
121
structure length
121
Chain Sequence
b'KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable tRNA pseudouridine synthase B
publication title Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 41
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3haxD00
4LCKA 3WXMB 1PXWA 2QI2A 3RA6A 1YJNF 3NK7A 3JCMM 2FC3A 3N4YA 1VQMF 2AIFA 2OZBA 1Q86H 1SDSA 1JJ2F 5GIPC 5FJ4C 4C4WC 3I55F 5A2QM 1YJ9F 3G6EF 1CN7A 1W42A 2LBWA 1NJIH 3CCJF 2LBXA 1W40A 1M90H 5EO3A 5GAPK 2KG4A 3NK6A 1T0KB 2BO1A 3OBWA 5FLXM 1VQNF 1RA4A 1Q7YH 2OTLF 1VQ6F 4X3LA 2OTJF 3LWOC 3HAXD 3ON1A 1VQPF 5G4UC 1W2BF 3CMAF 1VQKF 5IT9M 1N8RH 1K9MH 3LWPC 2VGMA 2QEXF 3HJWC 3SIVA 5G4VC 3CPQA 3LWVC 3NMUC 4X3MA 3PAFA 3VMFB 3G4SF 3CCMF 3CCEF 2CZWA 1W3EX 3E1YA 3J7AR 2I6DA 2QA4F 1M1KH 1VQLF 3VI6A 1VQ4F 1YI2F 3CXCF 1IPAA 3LFOA 3LWQC 3G71F 3CCUF 3E20B 3CC7F 1GZ0A 3CG6A 2WALA 1VQ9F 1Q81H 1KD1H 1X7PA 5GIOC 1E7KA 3V7EA 3J81M 1GO0A 1NMUB 3SIUA 4BW0B 3AGKA 3MCAB 3IR9A 3CCLF 1QVFF 3CC2F 3V7QA 1Q82H 3CPWF 1VQOF 3CCVF 2HVYD 3NVKE 1YHQF 3GYQA 1KQSF 4BY9D 3OW2F 1VQ7F 3N4ZA 3CC4F 1W41A 1H7MA 2KTVA 5GINC 3J80M 2KTUA 1K8AH 2OHWA 3CD6F 1DT9A 1K73H 3JAMM 3RA5A 4NUTA 1VQ8F 3PLAC 3CMEF 3CCSF 1KC8H 1X52A 5DCVA 1GO1A 1RLGA 2VGNA 1QVGF 2JNBA 1YIJF 1VQ5F 3OBYA 3O85A 1S72F 3CCQF 5GANK 1XBIA 3CCRF 1ZWZA 2ALEA 3I56F 1YJWF 1CK2A 3NVIB 3LWRC 1YITF 5EWRA 3FFMA 1X7OA 4TZZA
chains in the Genus database with same CATH superfamily
2VAWA 4LCKA 3WXMB 2MQEA 3JAKA 1U40A 3NK7A 1CLIA 2FC3A 2R751 2ZOVA 2HS4A 2Q1XA 3N4YA 3F0DA 4HNAA 2HQSC 3WPXA 4C4WC 3IEWA 1YJ9F 1CN7A 4LNUA 5LXTA 3LYBA 1NJIH 5JVDA 5LOVA 4I50A 5GAPK 5HY4A 1VH8A 4YJ2B 4X1KB 1U3LA 4TV9B 1VQPF 3FD5A 3KJJA 3E22A 5IYZA 4NWOB 1K9MH 1R1MA 3LWPC 4BVSA 5IJ0B 4R40B 3RYHA 3RYIB 2QEXF 3HJWC 4BVQA 5G4VC 2HP0B 3SIVA 3TD3A 2QTPA 3C9UA 1DBFA 5KX5A 2H8EA 5KMGA 1FFXB 5LYJA 2W8BC 3PAFA 3VMFB 5BMVB 3CCMF 3BYQA 3E1YA 2IG8A 1M1KH 3HKBB 4O2BB 4E6EA 1VQ4F 1YI2F 3CXCF 4X20B 2VAMA 2ZVYA 2LCAA 5AVMA 3D01A 3M4SA 4FFBB 5MN6A 5J2UB 2CVLA 4X1IB 3E20B 4RQOA 2WALA 3C9TA 1Q81H 3WGNA 1W5EA 2ZVZA 2VAPA 1E7KA 1GO0A 4G4YA 4U3JB 1U43A 4BW0B 5MN4A 1H48A 3RYFB 3IR9A 2CW4A 5B8FA 4G4ZA 3JALB 3WGMA 3RYIA 3CPWF 1VQOF 3MBMA 5HXUA 4ZOLA 4KWEA 3WJRA 3IKEA 4BY9D 1FFXA 2NMUA 1KNJA 3VOAA 3JATB 1ODEA 5J2TA 3RYCA 1RQ7A 2OHWA 4O2BA 1DT9A 2Q1YA 3JAMM 5HY0A 4G4WA 3C9SA 1Z5WA 3CMEF 3CCSF 2RHLA 4O4JB 1SA0B 5DCVA 3TD4A 2VGNA 1RLGA 3IMPA 1YIJF 3MQWA 5EB0A 2GLZA 5GANK 2ALEA 3F0GA 4B46A 3I56F 3VTIC 5JCOA 3LWRC 3RYFA 1YITF 3T80A 3D54A 3FFMA 3JALA 1XRGA 2UYNB 3S06A 4G4VA 2QI2A 3JCMM 3HKEA 2EWCA 5EIBC 1JJ2F 3JASA 2CHSA 3JATA 3LDTA 5HY1A 4IIJB 2DT4A 2L26A 1TVKB 3N2GA 1W40A 5EZYB 1M90H 4PWTA 1JN1A 4O4JA 1SA0A 5JH7B 1RA4A 1W581 4ZI7A 4DXDA 5MN5A 5JQGA 3B6NA 2OTJF 3HAXD 2H8CA 5C8YA 1VQVA 1JD1A 4C8GA 3Q8HA 5G4UC 5CA1A 1FNKA 5IT9M 1N8RH 4XCQA 3CYQA 3DC2A 2UYNA 4O4HB 4O2AB 3VCZA 3K0TA 2F9ZC 5CB4B 3L7QA 4YJ3B 1W5BA 4BVRA 3WJPA 1IV4A 4BT7A 2CHTA 3J7AR 1W3EX 3CYPB 1JFFA 4IIJA 5ITZB 1OAPA 4G88A 1W57A 3ELCA 2UZHA 3I7TA 3VI6A 3WJQA 5EAZA 3S03A 1T0AA 5JH7A 3WPWA 4EI8A 3CC7F 1GZ0A 1X25A 4ZHWA 1X7PA 4ERHA 3P0ZA 5IJ9A 3J81M 4B62A 3I3FA 2HRUA 2GVIA 3AGKA 2FGYA 2HX0A 5CA0B 3MCAB 1NQ3A 5LP6B 3IEQA 1UI9A 3S0HA 3CC2F 2PMPA 3V7QA 5JCOC 3CCVF 5CB4A 2HVYD 2ZODA 4X1YB 4M8IA 3FBAA 1VK3A 4WBNB 3OW2F 3CC4F 3LMEA 3FPIA 1W41A 1H7MA 1FSZA 5GINC 3EORA 2KTUA 4YJ2A 1GX1A 1K73H 4EB6B 4NUTA 4X1KA 5EYPB 3PLAC 5EIBD 4TV9A 2Z1EA 3M1XA 3HTNA 3IKFA 2Z1UA 3UT5B 5IJ0A 2P6YA 3CCQF 1W5FA 2AMTA 1PF5A 3U0OA 3HKDB 2HP0A 4B45A 1CK2A 3NVIB 5EWRA 1J7HA 3QHDA 3F6MA 3P4EA 3GTZA 5BMVA 3MDOA 1PXWA 5LA6B 1YJNF 2CWJA 3HKBA 5FNVB 3KHNA 2N48A 2OTMA 2AIFA 4X20A 4F6RB 3JAWB 1UFYA 3VIUA 3VOBA 5GIPC 2ZF8A 4FFBA 5A2QM 3I55F 5J2UA 2YYEA 2LBTA 3G6EF 3CB2A 4X1IA 1TUBB 1W42A 2LBWA 3P10A 3CCJF 3DDNA 2LBXA 4ZHYB 5EO3A 2KG4A 3JARB 4DRXB 3V4DA 5FLXM 1VQNF 1XHOA 4U3JA 1Q7YH 1JY8A 2Z1FA 5GONB 4X3LA 2IQQA 3RE3A 2R6R1 3VYTC 3HKCB 3CMAF 1W2BF 4BT3A 3MCQA 4I4TB 3N2KB 3TD5A 4TUYB 4NQ3A 1IV1A 3WGLA 3VO8A 4B5CA 1SZQA 3CPQA 2UYJA 3LWVC 2B33A 3JAKB 3CCEF 3M84A 2I6DA 3R0PA 2QA4F 3F0FA 4HNAB 3JVHA 4G4XA 3LFOA 3LWQC 3GHZA 3G71F 1YQNA 4IHJB 4I55B 5LXTB 5GONA 5JVDB 5LOVB 4I50B 3V7EA 2ZAUA 4O4LB 1NMUB 3SIUA 2IAFA 5HP8A 3VYSC 4TUYA 2UYPA 5HWEA 3E22B 5IYZB 2Z1TA 2HP3A 1YHQF 1TVKA 1Z5VA 1KNKA 1ONIA 4EI9A 3S0WA 3WGKA 1VQ7F 3N4ZA 5EZYA 3RYHB 4BT6A 4ZHVA 2KTVA 4EI7A 3CD6F 5KX5B 3RA5A 5KMGB 1VQ8F 5LYJB 2RHOA 1OFUA 4IHJA 1KC8H 4I55A 1GO1A 5HY2A 1W55A 1U3PA 4RHAA 1VQ5F 1H47A 3O85A 3ZO8A 2RHJA 2BTQB 4O4HA 4O4LA 4O2AA 2YXZA 1ZWZA 3WGJA 1YJWF 4ZHQB 4YJ3A 1X7OA 4TZZA 2Z01A 4C82A 2RHHA 3RA6A 1COMA 5ITZA 1RLUA 3KIZA 1VQMF 2OZBA 4TV8B 4C8IA 1Q86H 2K1SA 1SDSA 3HWUA 4ZK7A 5FJ4C 3QTYA 1QD9A 1RQ2A 4ZOLB 4U39A 3K12A 2I6RA 3NK6A 1T0KB 5J2TB 2BO1A 3RYCB 3OBWA 2OTLF 1VQ6F 2RB9A 5CA0A 3LWOC 5LP6A 3ESJA 3ON1A 4BT2A 4C81A 1VQKF 4X1YA 4ZHQA 1QU9A 2VGMA 3K2XA 4WBNA 3OONA 3ZP7A 3ZOPA 3D00A 3NMUC 5EB1B 2HS3A 1YGYA 2BTOA 3C8LA 4X3MA 4EB6A 4TV8A 5EYPA 3G4SF 1VHAA 2CZWA 4BT4A 5HP7A 1VQLF 3HKEB 3FD6A 1IV2A 2AIZP 3UT5A 3KJKA 1IPAA 3JASB 2KGWA 1IV3A 3QUWA 4BT5A 3CCUF 3HKDA 2BTUA 3CG6A 1W5AA 2VXYA 3N2GB 1VQ9F 1KD1H 3ZP4A 5GIOC 5LA6A 3S02A 4C8EA 4ZI7B 2G9IA 5JQGB 2PHNA 5FNVA 3CCLF 4O4IB 1QVFF 5C8YB 1W59A 4F6RA 3JAWA 2H6LA 1Q82H 3KE1A 5CA1B 3S0YA 3NVKE 3GYQA 1TUBA 1KQSF 1Q8RA 3V3TA 3C9RA 3ERNA 2HRYA 3JARA 4DRXA 3J80M 2HS0A 2V9YA 4LNUB 1K8AH 5HXZA 1QAHA 2DYYA 4BVTA 2UYKA 1JFFB 1XV2A 1X52A 3F0EA 3HKCA 3K14A 4I4TA 1QVGF 2JNBA 3N2KA 3OBYA 2GZLA 1S72F 3VYUC 3CCRF 1XBIA 5LP6C 4O4IA 1FNJA 2CSLA 5IJ9B
chains in the Genus database with same CATH topology
4LCKA 3WXMB 1PXWA 2QI2A 3RA6A 1YJNF 3NK7A 3JCMM 2FC3A 3N4YA 1VQMF 2AIFA 2OZBA 1Q86H 1SDSA 1JJ2F 5GIPC 5HY1A 5FJ4C 4C4WC 3I55F 5A2QM 1YJ9F 3G6EF 1CN7A 1W42A 2LBWA 1NJIH 3CCJF 2LBXA 1W40A 1M90H 5EO3A 5GAPK 2KG4A 3NK6A 1T0KB 2BO1A 5HY4A 3OBWA 5FLXM 1VQNF 1RA4A 1Q7YH 2OTLF 1VQ6F 4X3LA 2OTJF 3LWOC 3HAXD 3ON1A 1VQPF 5G4UC 1W2BF 3CMAF 1VQKF 5IT9M 1N8RH 1K9MH 4XCQA 3LWPC 2VGMA 4NQ3A 4BVSA 2QEXF 3HJWC 4BVQA 2F9ZC 5G4VC 3SIVA 3CPQA 3D00A 3LWVC 3NMUC 4X3MA 4BVRA 3PAFA 3VMFB 3G4SF 3CCMF 3CCEF 2CZWA 1W3EX 3E1YA 3J7AR 2I6DA 2QA4F 1M1KH 1VQLF 3VI6A 1VQ4F 1YI2F 3CXCF 1IPAA 3LFOA 3LWQC 3G71F 4EI8A 3CCUF 3E20B 3CC7F 1GZ0A 3CG6A 2WALA 1VQ9F 1Q81H 1KD1H 1X7PA 5GIOC 1E7KA 3V7EA 3J81M 1GO0A 1NMUB 3SIUA 4BW0B 3AGKA 2FGYA 3MCAB 3IR9A 3CCLF 1QVFF 5HWEA 3CC2F 3V7QA 1Q82H 3CPWF 1VQOF 3CCVF 2HVYD 3NVKE 1YHQF 3GYQA 5HXUA 1KQSF 4BY9D 4EI9A 3OW2F 1VQ7F 3N4ZA 3CC4F 3V3TA 1W41A 1H7MA 2KTVA 5GINC 4EI7A 3J80M 2KTUA 1K8AH 2OHWA 3CD6F 1DT9A 5HXZA 3JAMM 1K73H 3RA5A 4NUTA 4BVTA 5HY0A 1VQ8F 3PLAC 3CMEF 3CCSF 1KC8H 1X52A 5DCVA 1GO1A 5HY2A 1RLGA 2VGNA 1QVGF 2JNBA 1YIJF 1VQ5F 3OBYA 3O85A 2GLZA 1S72F 3CCQF 5GANK 1XBIA 3CCRF 1ZWZA 2ALEA 3I56F 1YJWF 1CK2A 3NVIB 3LWRC 1YITF 5EWRA 3FFMA 1X7OA 4TZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LCK A;  3WXM B;  1PXW A;  2QI2 A;  3RA6 A;  1YJN F;  3NK7 A;  3JCM M;  2FC3 A;  3N4Y A;  1VQM F;  2AIF A;  2OZB A;  1Q86 H;  1SDS A;  1JJ2 F;  5GIP C;  5FJ4 C;  4C4W C;  3I55 F;  5A2Q M;  1YJ9 F;  3G6E F;  1CN7 A;  1W42 A;  2LBW A;  1NJI H;  3CCJ F;  2LBX A;  1W40 A;  1M90 H;  5EO3 A;  5GAP K;  2KG4 A;  3NK6 A;  1T0K B;  2BO1 A;  3OBW A;  5FLX M;  1VQN F;  1RA4 A;  1Q7Y H;  2OTL F;  1VQ6 F;  4X3L A;  2OTJ F;  3LWO C;  3HAX D;  3ON1 A;  1VQP F;  5G4U C;  1W2B F;  3CMA F;  1VQK F;  5IT9 M;  1N8R H;  1K9M H;  3LWP C;  2VGM A;  2QEX F;  3HJW C;  3SIV A;  5G4V C;  3CPQ A;  3LWV C;  3NMU C;  4X3M A;  3PAF A;  3VMF B;  3G4S F;  3CCM F;  3CCE F;  2CZW A;  1W3E X;  3E1Y A;  3J7A R;  2I6D A;  2QA4 F;  1M1K H;  1VQL F;  3VI6 A;  1VQ4 F;  1YI2 F;  3CXC F;  1IPA A;  3LFO A;  3LWQ C;  3G71 F;  3CCU F;  3E20 B;  3CC7 F;  1GZ0 A;  3CG6 A;  2WAL A;  1VQ9 F;  1Q81 H;  1KD1 H;  1X7P A;  5GIO C;  1E7K A;  3V7E A;  3J81 M;  1GO0 A;  1NMU B;  3SIU A;  4BW0 B;  3AGK A;  3MCA B;  3IR9 A;  3CCL F;  1QVF F;  3CC2 F;  3V7Q A;  1Q82 H;  3CPW F;  1VQO F;  3CCV F;  2HVY D;  3NVK E;  1YHQ F;  3GYQ A;  1KQS F;  4BY9 D;  3OW2 F;  1VQ7 F;  3N4Z A;  3CC4 F;  1W41 A;  1H7M A;  2KTV A;  5GIN C;  3J80 M;  2KTU A;  1K8A H;  2OHW A;  3CD6 F;  1DT9 A;  1K73 H;  3JAM M;  3RA5 A;  4NUT A;  1VQ8 F;  3PLA C;  3CME F;  3CCS F;  1KC8 H;  1X52 A;  5DCV A;  1GO1 A;  1RLG A;  2VGN A;  1QVG F;  2JNB A;  1YIJ F;  1VQ5 F;  3OBY A;  3O85 A;  1S72 F;  3CCQ F;  5GAN K;  1XBI A;  3CCR F;  1ZWZ A;  2ALE A;  3I56 F;  1YJW F;  1CK2 A;  3NVI B;  3LWR C;  1YIT F;  5EWR A;  3FFM A;  1X7O A;  4TZZ A; 
#chains in the Genus database with same CATH topology
 2VAW A;  4LCK A;  3WXM B;  2MQE A;  3JAK A;  1U40 A;  3NK7 A;  1CLI A;  2FC3 A;  2R75 1;  2ZOV A;  2HS4 A;  2Q1X A;  3N4Y A;  3F0D A;  4HNA A;  2HQS C;  3WPX A;  4C4W C;  3IEW A;  1YJ9 F;  1CN7 A;  4LNU A;  5LXT A;  3LYB A;  1NJI H;  5JVD A;  5LOV A;  4I50 A;  5GAP K;  5HY4 A;  1VH8 A;  4YJ2 B;  4X1K B;  1U3L A;  4TV9 B;  1VQP F;  3FD5 A;  3KJJ A;  3E22 A;  5IYZ A;  4NWO B;  1K9M H;  1R1M A;  3LWP C;  4BVS A;  5IJ0 B;  4R40 B;  3RYH A;  3RYI B;  2QEX F;  3HJW C;  4BVQ A;  5G4V C;  2HP0 B;  3SIV A;  3TD3 A;  2QTP A;  3C9U A;  1DBF A;  5KX5 A;  2H8E A;  5KMG A;  1FFX B;  5LYJ A;  2W8B C;  3PAF A;  3VMF B;  5BMV B;  3CCM F;  3BYQ A;  3E1Y A;  2IG8 A;  1M1K H;  3HKB B;  4O2B B;  4E6E A;  1VQ4 F;  1YI2 F;  3CXC F;  4X20 B;  2VAM A;  2ZVY A;  2LCA A;  5AVM A;  3D01 A;  3M4S A;  4FFB B;  5MN6 A;  5J2U B;  2CVL A;  4X1I B;  3E20 B;  4RQO A;  2WAL A;  3C9T A;  1Q81 H;  3WGN A;  1W5E A;  2ZVZ A;  2VAP A;  1E7K A;  1GO0 A;  4G4Y A;  4U3J B;  1U43 A;  4BW0 B;  5MN4 A;  1H48 A;  3RYF B;  3IR9 A;  2CW4 A;  5B8F A;  4G4Z A;  3JAL B;  3WGM A;  3RYI A;  3CPW F;  1VQO F;  3MBM A;  5HXU A;  4ZOL A;  4KWE A;  3WJR A;  3IKE A;  4BY9 D;  1FFX A;  2NMU A;  1KNJ A;  3VOA A;  3JAT B;  1ODE A;  5J2T A;  3RYC A;  1RQ7 A;  2OHW A;  4O2B A;  1DT9 A;  2Q1Y A;  3JAM M;  5HY0 A;  4G4W A;  3C9S A;  1Z5W A;  3CME F;  3CCS F;  2RHL A;  4O4J B;  1SA0 B;  5DCV A;  3TD4 A;  2VGN A;  1RLG A;  3IMP A;  1YIJ F;  3MQW A;  5EB0 A;  2GLZ A;  5GAN K;  2ALE A;  3F0G A;  4B46 A;  3I56 F;  3VTI C;  5JCO A;  3LWR C;  3RYF A;  1YIT F;  3T80 A;  3D54 A;  3FFM A;  3JAL A;  1XRG A;  2UYN B;  3S06 A;  4G4V A;  2QI2 A;  3JCM M;  3HKE A;  2EWC A;  5EIB C;  1JJ2 F;  3JAS A;  2CHS A;  3JAT A;  3LDT A;  5HY1 A;  4IIJ B;  2DT4 A;  2L26 A;  1TVK B;  3N2G A;  1W40 A;  5EZY B;  1M90 H;  4PWT A;  1JN1 A;  4O4J A;  1SA0 A;  5JH7 B;  1RA4 A;  1W58 1;  4ZI7 A;  4DXD A;  5MN5 A;  5JQG A;  3B6N A;  2OTJ F;  3HAX D;  2H8C A;  5C8Y A;  1VQV A;  1JD1 A;  4C8G A;  3Q8H A;  5G4U C;  5CA1 A;  1FNK A;  5IT9 M;  1N8R H;  4XCQ A;  3CYQ A;  3DC2 A;  2UYN A;  4O4H B;  4O2A B;  3VCZ A;  3K0T A;  2F9Z C;  5CB4 B;  3L7Q A;  4YJ3 B;  1W5B A;  4BVR A;  3WJP A;  1IV4 A;  4BT7 A;  2CHT A;  3J7A R;  1W3E X;  3CYP B;  1JFF A;  4IIJ A;  5ITZ B;  1OAP A;  4G88 A;  1W57 A;  3ELC A;  2UZH A;  3I7T A;  3VI6 A;  3WJQ A;  5EAZ A;  3S03 A;  1T0A A;  5JH7 A;  3WPW A;  4EI8 A;  3CC7 F;  1GZ0 A;  1X25 A;  4ZHW A;  1X7P A;  4ERH A;  3P0Z A;  5IJ9 A;  3J81 M;  4B62 A;  3I3F A;  2HRU A;  2GVI A;  3AGK A;  2FGY A;  2HX0 A;  5CA0 B;  3MCA B;  1NQ3 A;  5LP6 B;  3IEQ A;  1UI9 A;  3S0H A;  3CC2 F;  2PMP A;  3V7Q A;  5JCO C;  3CCV F;  5CB4 A;  2HVY D;  2ZOD A;  4X1Y B;  4M8I A;  3FBA A;  1VK3 A;  4WBN B;  3OW2 F;  3CC4 F;  3LME A;  3FPI A;  1W41 A;  1H7M A;  1FSZ A;  5GIN C;  3EOR A;  2KTU A;  4YJ2 A;  1GX1 A;  1K73 H;  4EB6 B;  4NUT A;  4X1K A;  5EYP B;  3PLA C;  5EIB D;  4TV9 A;  2Z1E A;  3M1X A;  3HTN A;  3IKF A;  2Z1U A;  3UT5 B;  5IJ0 A;  2P6Y A;  3CCQ F;  1W5F A;  2AMT A;  1PF5 A;  3U0O A;  3HKD B;  2HP0 A;  4B45 A;  1CK2 A;  3NVI B;  5EWR A;  1J7H A;  3QHD A;  3F6M A;  3P4E A;  3GTZ A;  5BMV A;  3MDO A;  1PXW A;  5LA6 B;  1YJN F;  2CWJ A;  3HKB A;  5FNV B;  3KHN A;  2N48 A;  2OTM A;  2AIF A;  4X20 A;  4F6R B;  3JAW B;  1UFY A;  3VIU A;  3VOB A;  5GIP C;  2ZF8 A;  4FFB A;  5A2Q M;  3I55 F;  5J2U A;  2YYE A;  2LBT A;  3G6E F;  3CB2 A;  4X1I A;  1TUB B;  1W42 A;  2LBW A;  3P10 A;  3CCJ F;  3DDN A;  2LBX A;  4ZHY B;  5EO3 A;  2KG4 A;  3JAR B;  4DRX B;  3V4D A;  5FLX M;  1VQN F;  1XHO A;  4U3J A;  1Q7Y H;  1JY8 A;  2Z1F A;  5GON B;  4X3L A;  2IQQ A;  3RE3 A;  2R6R 1;  3VYT C;  3HKC B;  3CMA F;  1W2B F;  4BT3 A;  3MCQ A;  4I4T B;  3N2K B;  3TD5 A;  4TUY B;  4NQ3 A;  1IV1 A;  3WGL A;  3VO8 A;  4B5C A;  1SZQ A;  3CPQ A;  2UYJ A;  3LWV C;  2B33 A;  3JAK B;  3CCE F;  3M84 A;  2I6D A;  3R0P A;  2QA4 F;  3F0F A;  4HNA B;  3JVH A;  4G4X A;  3LFO A;  3LWQ C;  3GHZ A;  3G71 F;  1YQN A;  4IHJ B;  4I55 B;  5LXT B;  5GON A;  5JVD B;  5LOV B;  4I50 B;  3V7E A;  2ZAU A;  4O4L B;  1NMU B;  3SIU A;  2IAF A;  5HP8 A;  3VYS C;  4TUY A;  2UYP A;  5HWE A;  3E22 B;  5IYZ B;  2Z1T A;  2HP3 A;  1YHQ F;  1TVK A;  1Z5V A;  1KNK A;  1ONI A;  4EI9 A;  3S0W A;  3WGK A;  1VQ7 F;  3N4Z A;  5EZY A;  3RYH B;  4BT6 A;  4ZHV A;  2KTV A;  4EI7 A;  3CD6 F;  5KX5 B;  3RA5 A;  5KMG B;  1VQ8 F;  5LYJ B;  2RHO A;  1OFU A;  4IHJ A;  1KC8 H;  4I55 A;  1GO1 A;  5HY2 A;  1W55 A;  1U3P A;  4RHA A;  1VQ5 F;  1H47 A;  3O85 A;  3ZO8 A;  2RHJ A;  2BTQ B;  4O4H A;  4O4L A;  4O2A A;  2YXZ A;  1ZWZ A;  3WGJ A;  1YJW F;  4ZHQ B;  4YJ3 A;  1X7O A;  4TZZ A;  2Z01 A;  4C82 A;  2RHH A;  3RA6 A;  1COM A;  5ITZ A;  1RLU A;  3KIZ A;  1VQM F;  2OZB A;  4TV8 B;  4C8I A;  1Q86 H;  2K1S A;  1SDS A;  3HWU A;  4ZK7 A;  5FJ4 C;  3QTY A;  1QD9 A;  1RQ2 A;  4ZOL B;  4U39 A;  3K12 A;  2I6R A;  3NK6 A;  1T0K B;  5J2T B;  2BO1 A;  3RYC B;  3OBW A;  2OTL F;  1VQ6 F;  2RB9 A;  5CA0 A;  3LWO C;  5LP6 A;  3ESJ A;  3ON1 A;  4BT2 A;  4C81 A;  1VQK F;  4X1Y A;  4ZHQ A;  1QU9 A;  2VGM A;  3K2X A;  4WBN A;  3OON A;  3ZP7 A;  3ZOP A;  3D00 A;  3NMU C;  5EB1 B;  2HS3 A;  1YGY A;  2BTO A;  3C8L A;  4X3M A;  4EB6 A;  4TV8 A;  5EYP A;  3G4S F;  1VHA A;  2CZW A;  4BT4 A;  5HP7 A;  1VQL F;  3HKE B;  3FD6 A;  1IV2 A;  2AIZ P;  3UT5 A;  3KJK A;  1IPA A;  3JAS B;  2KGW A;  1IV3 A;  3QUW A;  4BT5 A;  3CCU F;  3HKD A;  2BTU A;  3CG6 A;  1W5A A;  2VXY A;  3N2G B;  1VQ9 F;  1KD1 H;  3ZP4 A;  5GIO C;  5LA6 A;  3S02 A;  4C8E A;  4ZI7 B;  2G9I A;  5JQG B;  2PHN A;  5FNV A;  3CCL F;  4O4I B;  1QVF F;  5C8Y B;  1W59 A;  4F6R A;  3JAW A;  2H6L A;  1Q82 H;  3KE1 A;  5CA1 B;  3S0Y A;  3NVK E;  3GYQ A;  1TUB A;  1KQS F;  1Q8R A;  3V3T A;  3C9R A;  3ERN A;  2HRY A;  3JAR A;  4DRX A;  3J80 M;  2HS0 A;  2V9Y A;  4LNU B;  1K8A H;  5HXZ A;  1QAH A;  2DYY A;  4BVT A;  2UYK A;  1JFF B;  1XV2 A;  1X52 A;  3F0E A;  3HKC A;  3K14 A;  4I4T A;  1QVG F;  2JNB A;  3N2K A;  3OBY A;  2GZL A;  1S72 F;  3VYU C;  3CCR F;  1XBI A;  5LP6 C;  4O4I A;  1FNJ A;  2CSL A;  5IJ9 B; 
#chains in the Genus database with same CATH homology
 4LCK A;  3WXM B;  1PXW A;  2QI2 A;  3RA6 A;  1YJN F;  3NK7 A;  3JCM M;  2FC3 A;  3N4Y A;  1VQM F;  2AIF A;  2OZB A;  1Q86 H;  1SDS A;  1JJ2 F;  5GIP C;  5HY1 A;  5FJ4 C;  4C4W C;  3I55 F;  5A2Q M;  1YJ9 F;  3G6E F;  1CN7 A;  1W42 A;  2LBW A;  1NJI H;  3CCJ F;  2LBX A;  1W40 A;  1M90 H;  5EO3 A;  5GAP K;  2KG4 A;  3NK6 A;  1T0K B;  2BO1 A;  5HY4 A;  3OBW A;  5FLX M;  1VQN F;  1RA4 A;  1Q7Y H;  2OTL F;  1VQ6 F;  4X3L A;  2OTJ F;  3LWO C;  3HAX D;  3ON1 A;  1VQP F;  5G4U C;  1W2B F;  3CMA F;  1VQK F;  5IT9 M;  1N8R H;  1K9M H;  4XCQ A;  3LWP C;  2VGM A;  4NQ3 A;  4BVS A;  2QEX F;  3HJW C;  4BVQ A;  2F9Z C;  5G4V C;  3SIV A;  3CPQ A;  3D00 A;  3LWV C;  3NMU C;  4X3M A;  4BVR A;  3PAF A;  3VMF B;  3G4S F;  3CCM F;  3CCE F;  2CZW A;  1W3E X;  3E1Y A;  3J7A R;  2I6D A;  2QA4 F;  1M1K H;  1VQL F;  3VI6 A;  1VQ4 F;  1YI2 F;  3CXC F;  1IPA A;  3LFO A;  3LWQ C;  3G71 F;  4EI8 A;  3CCU F;  3E20 B;  3CC7 F;  1GZ0 A;  3CG6 A;  2WAL A;  1VQ9 F;  1Q81 H;  1KD1 H;  1X7P A;  5GIO C;  1E7K A;  3V7E A;  3J81 M;  1GO0 A;  1NMU B;  3SIU A;  4BW0 B;  3AGK A;  2FGY A;  3MCA B;  3IR9 A;  3CCL F;  1QVF F;  5HWE A;  3CC2 F;  3V7Q A;  1Q82 H;  3CPW F;  1VQO F;  3CCV F;  2HVY D;  3NVK E;  1YHQ F;  3GYQ A;  5HXU A;  1KQS F;  4BY9 D;  4EI9 A;  3OW2 F;  1VQ7 F;  3N4Z A;  3CC4 F;  3V3T A;  1W41 A;  1H7M A;  2KTV A;  5GIN C;  4EI7 A;  3J80 M;  2KTU A;  1K8A H;  2OHW A;  3CD6 F;  1DT9 A;  5HXZ A;  3JAM M;  1K73 H;  3RA5 A;  4NUT A;  4BVT A;  5HY0 A;  1VQ8 F;  3PLA C;  3CME F;  3CCS F;  1KC8 H;  1X52 A;  5DCV A;  1GO1 A;  5HY2 A;  1RLG A;  2VGN A;  1QVG F;  2JNB A;  1YIJ F;  1VQ5 F;  3OBY A;  3O85 A;  2GLZ A;  1S72 F;  3CCQ F;  5GAN K;  1XBI A;  3CCR F;  1ZWZ A;  2ALE A;  3I56 F;  1YJW F;  1CK2 A;  3NVI B;  3LWR C;  1YIT F;  5EWR A;  3FFM A;  1X7O A;  4TZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...