3HJYB

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
molecule keywords pseudouridine synthase CBf5
molecule tags Isomerase/rna
source organism Pyrococcus furiosus
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 3hjyB00
3LWPB 3MQKB 2EY4E 3HJYB 3HJWB 3LWQB 3LWVB 2AQCA 2HVYC 3LWRB 2RFKB 2APOB 3HAXC 3LWOB 2AUSB
chains in the Genus database with same CATH superfamily
1JYBA 2E2IL 4Y7NL 3P8BA 3KYWA 1IROA 3M4OL 1BE7A 4C3JL 3H9CA 2JA5L 2V3BB 5AI2A 4A3FL 2M4YA 3H3VM 1BQ9A 4BY7L 3GTKL 2Z3RB 4JAGA 5MGNA 4AHXA 2A68D 5EIOC 2C6AA 1H7VA 1YUZA 3HAXC 1P7PA 2PSMC 2B63L 4AR6A 3PO3L 3H9BA 4E6YA 4XGHA 3KYVA 5RXNA 4B8CD 4ME3A 3CQZL 1ODHA 3PIO1 2A6HD 4ZN1B 2WAQP 1TWGL 3JR7A 4LHNA 3LWPB 3RZDL 3PZAA 4A3CL 1C09A 2PMZP 5IYBL 1RWDA 4A3DL 5JVG1 1RDGA 2JI2A 1SMMA 3PWFA 4AHYA 3HOUL 4AI2A 2H12A 3I4NL 1YK4A 2AQCA 4YWLA 2HVYC 2C6BA 1PFUA 3GTJL 1QCVA 3HOXL 4QIWP 2ERSA 3LWRB 2APOB 1CAAA 3J7Y1 5IYDL 2JA8L 1K83L 4BBRL 1T9PA 2PYAA 3HOZL 1R0HA 1R0JA 2BE5D 4TPUA 5C44L 2NVQL 2B5ID 1DVBA 1IW7D 1B2OA 2NYDA 4UY81 2XJRA 5FJ8L 1PZXA 1S2ZA 2RDVA 3KYYA 1PFYA 2M4VA 2V0EA 2XJSA 1F4LA 5M3ML 4AHZA 2XJUA 5GAHc 4JAEA 1PFVA 2O5JD 3K35A 1IU5A 2CKAA 3K7AL 2JI3A 2JA7L 1R0IA 5C3EL 3HJWB 1QQTA 3LWQB 1VZIA 4A3KL 2A69D 3QQCE 6RXNA 5H1Sc 1SMWA 4A93L 4AI0A 4AR5A 3FDJA 1BQ8A 1B71A 4AR4A 2VUML 2XJQA 2Z3QB 4AR3A 4A3EL 4GS7D 4AI1A 1VZGA 1TWFL 3HKZP 4POGA 5GADc 4XXBB 3GTML 5IYCL 2ERJA 1I50L 2K2DA 1T9QA 2L0ZA 3B0AB 1R9TL 3PKJA 1T9OA 4X6AL 1QYBA 5DM61 5C4JL 7RXNA 2E2HL 3MQKB 3GTLL 1NXEA 4RXNA 2AYJA 1RYTA 1OWCA 1Y1VL 1YV1A 5C4XL 2AUSB 3WWNB 3S2HL 3HOVL 4A3LL 5GAEc 4JAFA 3GTOL 5AN9H 5M5XL 1ZRPA 2HR5A 3MSUA 3M3YL 5GAGc 3S1NL 4TVMA 1RYQA 1DX8A 1VCXA 2NVTL 3S17L 1S30A 3SS2A 4AYBP 5MFZA 3S16L 3HOYL 1I6HL 2GMGA 4JADA 1TWHL 5IP7L 5JVH1 1Z92B 3GTQL 5K2ME 1TWAL 3RZOL 3A44A 4V196 3RYGA 5IP9L 3QVDA 1B2JA 1R0GA 4A3ML 2JA6L 1VZHA 1WCML 2EY4E 4LHLA 4Y52L 3H0GL 2XJTA 5FLML 5MFPA 3KYUA 3GTGL 1Y1WL 1CADA 2R7ZL 2NVYL 2J9UB 2JI1A 4YWMA 5M3FL 3PKIA 2PPTA 4G6BA 2V0FA 4A3IL 3ZG6A 4BY1L 3HJYB 1YK5A 3KYXA 4POFA 1B13A 3PO2L 3NFPI 3LNLA 1LTLA 1TWCL 2CR8A 1SFOL 5IY0A 3S1QL 2QL0A 4ZN3B 3S1RL 1OWBA 5AI3A 1NXGA 3S2DL 1BRFA 1FHHA 5M5YL 4A3BL 3WWLA 1I3QL 2LCQA 3FKIL 1FHMA 3HOWL 2KN9A 1R0FA 4AI3A 4WFN1 2M6PA 1S24A 2A6ED 2DSXA 3P2AA 3S1ML 3IU3I 1NNQA 3I4ML 3MPSA 3GTPL 5EINC 2KKDA 2YU9L 2CKCA 1IU6A 4C3HL 4U671 3LWVB 1PFWA 2R93L 1LKMA 3LWOB 4K9FA 1RDVA 3VPBE 3J7Z1 1RB9A 3B08B 2ZIXA 2Y0SP 1BFYA 4C2M1 5M5WL 3RZTA 4C3IL 1YUXA 1WJVA 5MLC3 4AHWA 2R92L 3S15L 4BBSL 1LKPA 4A3JL 3LPEB 2XJVA 1SMUA 2XJPA 3PL5A 2MS3A 3H99A 3H97A 5MF6A 2RFKB 2M6OA 1LKOA 8RXNA 1E8JA 5DM71 2PVXA 2WB1P 3S14L 3PIP1 1IRNA 2E2JL 4A3GL 3RZ6A 4BXXL 2VL6A 2PVEA 2NVXL
chains in the Genus database with same CATH topology
3LWPB 3MQKB 2EY4E 3HJYB 3HJWB 3LWQB 3LWVB 2AQCA 2HVYC 3LWRB 2RFKB 2APOB 3HAXC 3LWOB 2AUSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWP B;  3MQK B;  2EY4 E;  3HJY B;  3HJW B;  3LWQ B;  3LWV B;  2AQC A;  2HVY C;  3LWR B;  2RFK B;  2APO B;  3HAX C;  3LWO B;  2AUS B; 
#chains in the Genus database with same CATH topology
 1JYB A;  2E2I L;  4Y7N L;  3P8B A;  3KYW A;  1IRO A;  3M4O L;  1BE7 A;  4C3J L;  3H9C A;  2JA5 L;  2V3B B;  5AI2 A;  4A3F L;  2M4Y A;  3H3V M;  1BQ9 A;  4BY7 L;  3GTK L;  2Z3R B;  4JAG A;  5MGN A;  4AHX A;  2A68 D;  5EIO C;  2C6A A;  1H7V A;  1YUZ A;  3HAX C;  1P7P A;  2PSM C;  2B63 L;  4AR6 A;  3PO3 L;  3H9B A;  4E6Y A;  4XGH A;  3KYV A;  5RXN A;  4B8C D;  4ME3 A;  3CQZ L;  1ODH A;  3PIO 1;  2A6H D;  4ZN1 B;  2WAQ P;  1TWG L;  3JR7 A;  4LHN A;  3LWP B;  3RZD L;  3PZA A;  4A3C L;  1C09 A;  2PMZ P;  5IYB L;  1RWD A;  4A3D L;  5JVG 1;  1RDG A;  2JI2 A;  1SMM A;  3PWF A;  4AHY A;  3HOU L;  4AI2 A;  2H12 A;  3I4N L;  1YK4 A;  2AQC A;  4YWL A;  2HVY C;  2C6B A;  1PFU A;  3GTJ L;  1QCV A;  3HOX L;  4QIW P;  2ERS A;  3LWR B;  2APO B;  1CAA A;  3J7Y 1;  5IYD L;  2JA8 L;  1K83 L;  4BBR L;  1T9P A;  2PYA A;  3HOZ L;  1R0H A;  1R0J A;  2BE5 D;  4TPU A;  5C44 L;  2NVQ L;  2B5I D;  1DVB A;  1IW7 D;  1B2O A;  2NYD A;  4UY8 1;  2XJR A;  5FJ8 L;  1PZX A;  1S2Z A;  2RDV A;  3KYY A;  1PFY A;  2M4V A;  2V0E A;  2XJS A;  1F4L A;  5M3M L;  4AHZ A;  2XJU A;  5GAH c;  4JAE A;  1PFV A;  2O5J D;  3K35 A;  1IU5 A;  2CKA A;  3K7A L;  2JI3 A;  2JA7 L;  1R0I A;  5C3E L;  3HJW B;  1QQT A;  3LWQ B;  1VZI A;  4A3K L;  2A69 D;  3QQC E;  6RXN A;  5H1S c;  1SMW A;  4A93 L;  4AI0 A;  4AR5 A;  3FDJ A;  1BQ8 A;  1B71 A;  4AR4 A;  2VUM L;  2XJQ A;  2Z3Q B;  4AR3 A;  4A3E L;  4GS7 D;  4AI1 A;  1VZG A;  1TWF L;  3HKZ P;  4POG A;  5GAD c;  4XXB B;  3GTM L;  5IYC L;  2ERJ A;  1I50 L;  2K2D A;  1T9Q A;  2L0Z A;  3B0A B;  1R9T L;  3PKJ A;  1T9O A;  4X6A L;  1QYB A;  5DM6 1;  5C4J L;  7RXN A;  2E2H L;  3MQK B;  3GTL L;  1NXE A;  4RXN A;  2AYJ A;  1RYT A;  1OWC A;  1Y1V L;  1YV1 A;  5C4X L;  2AUS B;  3WWN B;  3S2H L;  3HOV L;  4A3L L;  5GAE c;  4JAF A;  3GTO L;  5AN9 H;  5M5X L;  1ZRP A;  2HR5 A;  3MSU A;  3M3Y L;  5GAG c;  3S1N L;  4TVM A;  1RYQ A;  1DX8 A;  1VCX A;  2NVT L;  3S17 L;  1S30 A;  3SS2 A;  4AYB P;  5MFZ A;  3S16 L;  3HOY L;  1I6H L;  2GMG A;  4JAD A;  1TWH L;  5IP7 L;  5JVH 1;  1Z92 B;  3GTQ L;  5K2M E;  1TWA L;  3RZO L;  3A44 A;  4V19 6;  3RYG A;  5IP9 L;  3QVD A;  1B2J A;  1R0G A;  4A3M L;  2JA6 L;  1VZH A;  1WCM L;  2EY4 E;  4LHL A;  4Y52 L;  3H0G L;  2XJT A;  5FLM L;  5MFP A;  3KYU A;  3GTG L;  1Y1W L;  1CAD A;  2R7Z L;  2NVY L;  2J9U B;  2JI1 A;  4YWM A;  5M3F L;  3PKI A;  2PPT A;  4G6B A;  2V0F A;  4A3I L;  3ZG6 A;  4BY1 L;  3HJY B;  1YK5 A;  3KYX A;  4POF A;  1B13 A;  3PO2 L;  3NFP I;  3LNL A;  1LTL A;  1TWC L;  2CR8 A;  1SFO L;  5IY0 A;  3S1Q L;  2QL0 A;  4ZN3 B;  3S1R L;  1OWB A;  5AI3 A;  1NXG A;  3S2D L;  1BRF A;  1FHH A;  5M5Y L;  4A3B L;  3WWL A;  1I3Q L;  2LCQ A;  3FKI L;  1FHM A;  3HOW L;  2KN9 A;  1R0F A;  4AI3 A;  4WFN 1;  2M6P A;  1S24 A;  2A6E D;  2DSX A;  3P2A A;  3S1M L;  3IU3 I;  1NNQ A;  3I4M L;  3MPS A;  3GTP L;  5EIN C;  2KKD A;  2YU9 L;  2CKC A;  1IU6 A;  4C3H L;  4U67 1;  3LWV B;  1PFW A;  2R93 L;  1LKM A;  3LWO B;  4K9F A;  1RDV A;  3VPB E;  3J7Z 1;  1RB9 A;  3B08 B;  2ZIX A;  2Y0S P;  1BFY A;  4C2M 1;  5M5W L;  3RZT A;  4C3I L;  1YUX A;  1WJV A;  5MLC 3;  4AHW A;  2R92 L;  3S15 L;  4BBS L;  1LKP A;  4A3J L;  3LPE B;  2XJV A;  1SMU A;  2XJP A;  3PL5 A;  2MS3 A;  3H99 A;  3H97 A;  5MF6 A;  2RFK B;  2M6O A;  1LKO A;  8RXN A;  1E8J A;  5DM7 1;  2PVX A;  2WB1 P;  3S14 L;  3PIP 1;  1IRN A;  2E2J L;  4A3G L;  3RZ6 A;  4BXX L;  2VL6 A;  2PVE A;  2NVX L; 
#chains in the Genus database with same CATH homology
 3LWP B;  3MQK B;  2EY4 E;  3HJY B;  3HJW B;  3LWQ B;  3LWV B;  2AQC A;  2HVY C;  3LWR B;  2RFK B;  2APO B;  3HAX C;  3LWO B;  2AUS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...