3HOVI

Complete rna polymerase ii elongation complex ii
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hovI02
3GCFA 5C44I 2E2HI 3HOZI 3ESWA 1TFIA 4A93I 2YU9I 1PFTA 2DE5A 3S14I 4NBHA 3HOWI 1K83I 4BY1I 3VB9A 1DL6A 2HF1A 1I50I 4XX2A 2E2JI 4A3KI 1USPA 4NB9A 1L1OC 2JA5I 3I4MI 4NBCA 4Y52I 3S1MI 4A3JI 1X3ZA 2NVTI 1ZB8A 4A3EI 1TWFI 3S2DI 2RBLA 4A3LI 2NVQI 2F4MA 4NOZA 3M4OI 2P3YA 4A3GI 1Y1VI 5C3EI 1Y1WI 4NBDA 4NBGA 3S1NI 3U50C 4BY7I 1X3WA 3H0GI 3FKII 1VLAA 3H3VJ 4NBEA 3S16I 3HOVI 3S17I 4QTTA 2VUMI 4QTUA 2R7ZI 4NBFA 4NB8A 3I07A 4NBBA 3PO2I 5IP7I 1QYPA 1RO4A 1SFOI 3GTMI 2JA7I 3EERA 2E2II 1TWGI 2R93I 3HOYI 1WCMI 4NBAA 1RLYA 3M3YI 3RZOI 1YUAA 3VMGA 5C4XI 1TWAI 4A3MI 5CM2M 2JA6I 4MH4A 4A3DI 1USPB 3PO3S 3D6WA 4A3BI 2DE7A 1I3QI 4Y7NI 3LUSA 1ML8A 1I6HI 4A3FI 3PO3I 5FLMI 3GTJI 3VMIA 4BBSI 2F4OA 1LQLA 4BBRI 2KPIA 2K5RA 1N2FA 3VMHA 5C4JI 3GTLI 2DE6A 5IP9I 3S2HI 2JA8I 3RZDI 3GTOI 2J6AA 2PK7A 3S1RI 3HOUI 3Q87A 4BXXI 1WW9A 2JR6A 2JS4A 3GTMS 3K7AI 3GTGI 1TWHI 3I4NI 1TWCI 3GTPI 3GTKI 2JNYA 2BJOA 3GKQA 3CQZI 2NVXI 2B63I 1R9TI 2R92I 3S15I 1ZB9A 3S1QI 4X6AI 2AKLA 1NUIA 3HOXI 4A3CI 1Y1VS 2NVYI 4A3II 3GTQI
chains in the Genus database with same CATH superfamily
2M48A 1QVGZ 3CMAZ 3S14I 3CD61 4NBHA 1K83I 4BY1I 2VPYA 2Y0SA 3CC21 2VPWA 1Z03A 2LIYA 1QXFA 1I50I 4E2XA 1S721 3S1MI 4A3JI 2QLVB 2OTJZ 1X3ZA 1YIJ1 1P9NA 4S1TA 1Q811 1QVGY 3S2DI 1Q812 1RO2A 2P3YA 4RVGA 4AYBA 3S1NI 1YJNZ 2G2KA 2QEX1 4NH1C 2GTIA 3HOVI 4HH4A 1YITZ 5LL6f 4QTTA 4QTUA 2QKDA 1N8R1 3CD6Z 2WB1A 4NB8A 4NBBA 5IP7I 3VTNA 1SFOI 3EEDA 3CCE1 5T6BA 2IZ4A 1SIWA 4NBAA 3J81b 3CC41 1YHQ1 1YI21 1RLYA 3RZOI 1TWAI 1USPB 1K732 3D9XA 3CCJZ 1NJI2 3CC2Z 4Y7NI 3LUSA 5FLMI 1RNIA 1VQ41 2O4HA 2WAQA 3VMHA 5C4JI 3BG0B 2JA8I 3NDIA 4E31A 2J6AA 4EWCA 2LEXA 3S1RI 1Q7Y1 4BXXI 1WW9A 2JS4A 3CCM1 1QF8A 1TWHI 3GTKI 2BJOA 2NVXI 3S1QI 1NUIA 3CCQ1 3CME1 3GTQI 2YADA 2VUGA 4DQYB 1FDOA 2ZAEB 1PFTA 3HOWI 3CCS1 2V8IA 5FLXf 1VQ5Z 3CCVZ 2P28A 2JA5I 4NBCA 4Y52I 2GTHA 2OZKA 4A3EI 3FQQA 3NH4A 4E32A 1Y8CA 4A3LI 3IF8A 2NVQI 4NOZA 2RIQA 3M4OI 4A3GI 5C3EI 1Q822 4NBDA 1VQ6Z 5T64A 3CCUZ 1VQ61 3H0GI 1M1K2 1VLAA 2JIRA 3F3FC 3CCR1 3H3VJ 3OW2Z 2W04A 3CPWY 2I3CA 2LFUA 2R7ZI 3KIFA 3PO2I 3NH8A 3NFZA 2VPZA 2Q51A 5IT9f 2JA7I 3CMA1 2E2II 2QRDB 3OW2Y 4RVFA 3CPWZ 3G6E1 3M3YI 1RO0A 4MH4A 4HGZA 3PO3S 2OTJ1 4E30A 1ML8A 3PO3I 3VMIA 4BBSI 3TE5B 4BBRI 4E33A 1N2FA 2DE6A 3S2HI 1K9M2 2PK7A 3Q87A 2GU2A 3CC7Z 3GTMS 3TDHB 4RV9A 2AYDA 5D1OA 3K7AI 3CCLZ 2JIOA 4MONA 3I55Z 3CCL1 1TWCI 4X6AI 1VQOZ 3J7A4 3CCQZ 2AKLA 1YJ91 3MONA 4NFRA 3P5JB 1NJI1 1YJ9Z 2NVYI 4RVHA 2E2HI 3HOZI 3CCEZ 2W03A 1TFIA 4A93I 3IX0A 2YU9I 1YJWZ 1N8R2 1YHQZ 1YI2Z 4HGYA 3G711 3VB9A 1VQM1 1M901 1WJ2A 2OOXB 2E2JI 4A3KI 1L1OC 2Q4ZA 2M6NA 1Q861 2V3VA 3J81f 3G6EZ 2QEXZ 2OTLZ 2VF1A 1TWFI 2IZ3A 1S72Z 2F4MA 1FDIA 2JIMA 3KIHA 1YIJZ 3U50C 3J80b 4BY7I 4CL1A 3T4NB 3FKII 1M902 3S16I 4NBEA 5AN9F 2V45A 3S17I 3IFUA 3MZLB 2NAPA 2VUMI 1AA6A 1VQ91 1VQ9Z 2V8JA 1VQK1 1YJN1 1YUKA 1YIT1 1RQFA 1QYPA 3CMEZ 3GTMI 3EERA 3MZKB 2R93I 2QREB 1WCMI 1Q7Y2 3CCSZ 1JWHC 2OTL1 1Z02A 3VMGA 5C4XI 3CCV1 2JA6I 4A3DI 2H85A 1VQ4Z 4MD8A 3HKZA 4A3BI 4RS4A 4A3FI 3CC4Z 1NP6A 3G4S1 1JJ2Y 2KPIA 2K5RA 5IP9I 5D1PA 3RZDI 3GTOI 3CC71 2QRCB 1VQL1 2K3RA 3HOUI 1VQLZ 2PM9A 2JR6A 3JAMb 3QWUA 4MXUA 3I551 2RT9A 3I4NI 2JIQA 3J80f 1K731 4TNUA 3GKQA 3S15I 2B63I 1R9TI 1ZB9A 2RPRA 1JJ2Z 3HOXI 2KI7B 1KRLA 4MD7A 3CCMZ 1KC81 4MD9A 3GCFA 5C44I 3ESWA 1VQNZ 2O53A 2DE5A 3CXCZ 2QR1B 1DL6A 2JMOA 1VQ71 2IV2X 3G4SZ 1M1K1 2HF1A 1QVFZ 5FLXb 4XX2A 3D2LA 1KD12 1USPA 4NB9A 5IT9b 3I4MI 1WZNA 2NVTI 1VQ51 4E2WA 1ZB8A 3CCRZ 2E9HA 1W2BZ 2RBLA 3CXCY 1Y1VI 1Y1WI 4RVDA 1QVFY 4NBGA 1K9M1 2QA41 1VQP1 3F3PC 2QA4Z 5A2Qf 1X3WA 1S7MA 5D1OB 2R6MA 2E7ZA 1KQSZ 2JIPA 2RHBA 3NDJA 1W2BY 4NBFA 4DGLA 1Z01A 4MRIA 3I07A 3CCU1 1VQ8Z 1X0TA 4DK1A 1RO4A 3NH5A 1TWGI 4E2ZA 3HOYI 3G71Z 1Q16A 1WIIA 1KQSY 1YJW1 3IR7A 3FQMA 2PMZA 1YUAA 1VQN1 4A3MI 5CM2M 2JUBA 1KC82 1K8A2 2HU9A 3I56Z 3D6WA 3I561 1VQPZ 1VQ7Z 2DE7A 1I3QI 4E2YA 1I6HI 3CCJ1 2VPXA 3GTJI 2OOYB 2F4OA 1LQLA 3GTLI 1KD11 1Q821 1Q862 1VQO1 1VQ81 5T67A 3GTGI 3JAMf 1ZH1A 5A2Qb 3GTPI 1K8A1 2JNYA 3CQZI 2R92I 2V8KA 1VQKZ 2EGTA 4A3CI 3BG1B 1Y1VS 4A3II 1VQMZ
chains in the Genus database with same CATH topology
2M48A 1QVGZ 3CMAZ 3S14I 3CD61 4NBHA 1K83I 4BY1I 2Y0SA 3CC21 1Z03A 2LIYA 1I50I 4E2XA 1S721 3S1MI 4A3JI 2QLVB 2OTJZ 1X3ZA 1YIJ1 1P9NA 4S1TA 1Q811 1QVGY 3S2DI 1Q812 1RO2A 2P3YA 4RVGA 4AYBA 3S1NI 1YJNZ 2G2KA 2QEX1 4NH1C 2GTIA 3HOVI 4HH4A 1YITZ 5LL6f 4QTTA 4QTUA 2QKDA 1N8R1 3CD6Z 2WB1A 4NB8A 4NBBA 5IP7I 3VTNA 1SFOI 3EEDA 3CCE1 5T6BA 2IZ4A 4NBAA 3J81b 3CC41 1YHQ1 1YI21 1RLYA 3RZOI 1TWAI 1USPB 1K732 3D9XA 3CCJZ 1NJI2 3CC2Z 4Y7NI 3LUSA 5FLMI 1RNIA 1VQ41 2O4HA 2WAQA 3VMHA 5C4JI 3BG0B 2JA8I 3NDIA 4E31A 2J6AA 4EWCA 3S1RI 1Q7Y1 4BXXI 1WW9A 2JS4A 3CCM1 1QF8A 1TWHI 3GTKI 2BJOA 2NVXI 3S1QI 1NUIA 3CCQ1 3CME1 3GTQI 2YADA 2VUGA 4DQYB 2ZAEB 1PFTA 3HOWI 3CCS1 2V8IA 5FLXf 1VQ5Z 3CCVZ 2P28A 2JA5I 4NBCA 4Y52I 2GTHA 2OZKA 4A3EI 3FQQA 3NH4A 4E32A 4A3LI 3IF8A 2NVQI 4NOZA 2RIQA 3M4OI 4A3GI 5C3EI 1Q822 4NBDA 1VQ6Z 5T64A 3CCUZ 1VQ61 3H0GI 1M1K2 1VLAA 3F3FC 3CCR1 3H3VJ 3OW2Z 2W04A 3CPWY 2I3CA 2LFUA 2R7ZI 3KIFA 3PO2I 3NH8A 3NFZA 2Q51A 5IT9f 2JA7I 3CMA1 2E2II 2QRDB 3OW2Y 4RVFA 3CPWZ 3G6E1 3M3YI 1RO0A 4MH4A 4HGZA 3PO3S 2OTJ1 4E30A 1ML8A 3PO3I 3VMIA 4BBSI 3TE5B 4BBRI 4E33A 1N2FA 2DE6A 3S2HI 1K9M2 2PK7A 3Q87A 2GU2A 3CC7Z 3GTMS 3TDHB 4RV9A 5D1OA 3K7AI 3CCLZ 4MONA 3I55Z 3CCL1 1TWCI 4X6AI 1VQOZ 3J7A4 3CCQZ 2AKLA 1YJ91 3MONA 4NFRA 3P5JB 1NJI1 1YJ9Z 2NVYI 4RVHA 2E2HI 3HOZI 3CCEZ 2W03A 1TFIA 4A93I 3IX0A 2YU9I 1YJWZ 1N8R2 1YHQZ 1YI2Z 4HGYA 3G711 3VB9A 1VQM1 1M901 2OOXB 2E2JI 4A3KI 1L1OC 2Q4ZA 2M6NA 1Q861 3J81f 3G6EZ 2QEXZ 2OTLZ 2VF1A 1TWFI 2IZ3A 1S72Z 2F4MA 3KIHA 1YIJZ 3U50C 3J80b 4BY7I 4CL1A 3T4NB 3FKII 1M902 3S16I 4NBEA 5AN9F 3S17I 3IFUA 3MZLB 2VUMI 1VQ91 1VQ9Z 2V8JA 1VQK1 1YJN1 1YUKA 1YIT1 1RQFA 1QYPA 3CMEZ 3GTMI 3EERA 3MZKB 2R93I 2QREB 1WCMI 1Q7Y2 3CCSZ 1JWHC 2OTL1 1Z02A 3VMGA 5C4XI 3CCV1 2JA6I 4A3DI 2H85A 1VQ4Z 4MD8A 3HKZA 4A3BI 4RS4A 4A3FI 3CC4Z 1NP6A 3G4S1 1JJ2Y 2KPIA 2K5RA 5IP9I 5D1PA 3RZDI 3GTOI 3CC71 2QRCB 1VQL1 2K3RA 3HOUI 1VQLZ 2PM9A 2JR6A 3JAMb 3QWUA 4MXUA 3I551 2RT9A 3I4NI 3J80f 1K731 4TNUA 3GKQA 3S15I 2B63I 1R9TI 1ZB9A 2RPRA 1JJ2Z 3HOXI 2KI7B 1KRLA 4MD7A 3CCMZ 1KC81 4MD9A 3GCFA 5C44I 3ESWA 1VQNZ 2O53A 2DE5A 3CXCZ 2QR1B 1DL6A 2JMOA 1VQ71 3G4SZ 1M1K1 2HF1A 1QVFZ 5FLXb 4XX2A 1KD12 1USPA 4NB9A 5IT9b 3I4MI 2NVTI 1VQ51 4E2WA 1ZB8A 3CCRZ 2E9HA 1W2BZ 2RBLA 3CXCY 1Y1VI 1Y1WI 4RVDA 1QVFY 4NBGA 1K9M1 2QA41 1VQP1 3F3PC 2QA4Z 5A2Qf 1X3WA 1S7MA 5D1OB 2R6MA 1KQSZ 2RHBA 3NDJA 1W2BY 4NBFA 4DGLA 1Z01A 4MRIA 3I07A 3CCU1 1VQ8Z 1X0TA 4DK1A 1RO4A 3NH5A 1TWGI 4E2ZA 3HOYI 3G71Z 1WIIA 1KQSY 1YJW1 3FQMA 2PMZA 1YUAA 1VQN1 4A3MI 5CM2M 2JUBA 1KC82 1K8A2 2HU9A 3I56Z 3D6WA 3I561 1VQPZ 1VQ7Z 2DE7A 1I3QI 4E2YA 1I6HI 3CCJ1 3GTJI 2OOYB 2F4OA 1LQLA 3GTLI 1KD11 1Q821 1Q862 1VQO1 1VQ81 5T67A 3GTGI 3JAMf 1ZH1A 5A2Qb 3GTPI 1K8A1 2JNYA 3CQZI 2R92I 2V8KA 1VQKZ 2EGTA 4A3CI 3BG1B 1Y1VS 4A3II 1VQMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCF A;  5C44 I;  2E2H I;  3HOZ I;  3ESW A;  1TFI A;  4A93 I;  2YU9 I;  1PFT A;  2DE5 A;  3S14 I;  4NBH A;  3HOW I;  1K83 I;  4BY1 I;  3VB9 A;  1DL6 A;  2HF1 A;  1I50 I;  4XX2 A;  2E2J I;  4A3K I;  1USP A;  4NB9 A;  1L1O C;  2JA5 I;  3I4M I;  4NBC A;  4Y52 I;  3S1M I;  4A3J I;  1X3Z A;  2NVT I;  1ZB8 A;  4A3E I;  1TWF I;  3S2D I;  2RBL A;  4A3L I;  2NVQ I;  2F4M A;  4NOZ A;  3M4O I;  2P3Y A;  4A3G I;  1Y1V I;  5C3E I;  1Y1W I;  4NBD A;  4NBG A;  3S1N I;  3U50 C;  4BY7 I;  1X3W A;  3H0G I;  3FKI I;  1VLA A;  3H3V J;  4NBE A;  3S16 I;  3HOV I;  3S17 I;  4QTT A;  2VUM I;  4QTU A;  2R7Z I;  4NBF A;  4NB8 A;  3I07 A;  4NBB A;  3PO2 I;  5IP7 I;  1QYP A;  1RO4 A;  1SFO I;  3GTM I;  2JA7 I;  3EER A;  2E2I I;  1TWG I;  2R93 I;  3HOY I;  1WCM I;  4NBA A;  1RLY A;  3M3Y I;  3RZO I;  1YUA A;  3VMG A;  5C4X I;  1TWA I;  4A3M I;  5CM2 M;  2JA6 I;  4MH4 A;  4A3D I;  1USP B;  3PO3 S;  3D6W A;  4A3B I;  2DE7 A;  1I3Q I;  4Y7N I;  3LUS A;  1ML8 A;  1I6H I;  4A3F I;  3PO3 I;  5FLM I;  3GTJ I;  3VMI A;  4BBS I;  2F4O A;  1LQL A;  4BBR I;  2KPI A;  2K5R A;  1N2F A;  3VMH A;  5C4J I;  3GTL I;  2DE6 A;  5IP9 I;  3S2H I;  2JA8 I;  3RZD I;  3GTO I;  2J6A A;  2PK7 A;  3S1R I;  3HOU I;  3Q87 A;  4BXX I;  1WW9 A;  2JR6 A;  2JS4 A;  3GTM S;  3K7A I;  3GTG I;  1TWH I;  3I4N I;  1TWC I;  3GTP I;  3GTK I;  2JNY A;  2BJO A;  3GKQ A;  3CQZ I;  2NVX I;  2B63 I;  1R9T I;  2R92 I;  3S15 I;  1ZB9 A;  3S1Q I;  4X6A I;  2AKL A;  1NUI A;  3HOX I;  4A3C I;  1Y1V S;  2NVY I;  4A3I I;  3GTQ I; 
#chains in the Genus database with same CATH topology
 2M48 A;  1QVG Z;  3CMA Z;  3S14 I;  3CD6 1;  4NBH A;  1K83 I;  4BY1 I;  2VPY A;  2Y0S A;  3CC2 1;  2VPW A;  1Z03 A;  2LIY A;  1QXF A;  1I50 I;  4E2X A;  1S72 1;  3S1M I;  4A3J I;  2QLV B;  2OTJ Z;  1X3Z A;  1YIJ 1;  1P9N A;  4S1T A;  1Q81 1;  1QVG Y;  3S2D I;  1Q81 2;  1RO2 A;  2P3Y A;  4RVG A;  4AYB A;  3S1N I;  1YJN Z;  2G2K A;  2QEX 1;  4NH1 C;  2GTI A;  3HOV I;  4HH4 A;  1YIT Z;  5LL6 f;  4QTT A;  4QTU A;  2QKD A;  1N8R 1;  3CD6 Z;  2WB1 A;  4NB8 A;  4NBB A;  5IP7 I;  3VTN A;  1SFO I;  3EED A;  3CCE 1;  5T6B A;  2IZ4 A;  1SIW A;  4NBA A;  3J81 b;  3CC4 1;  1YHQ 1;  1YI2 1;  1RLY A;  3RZO I;  1TWA I;  1USP B;  1K73 2;  3D9X A;  3CCJ Z;  1NJI 2;  3CC2 Z;  4Y7N I;  3LUS A;  5FLM I;  1RNI A;  1VQ4 1;  2O4H A;  2WAQ A;  3VMH A;  5C4J I;  3BG0 B;  2JA8 I;  3NDI A;  4E31 A;  2J6A A;  4EWC A;  2LEX A;  3S1R I;  1Q7Y 1;  4BXX I;  1WW9 A;  2JS4 A;  3CCM 1;  1QF8 A;  1TWH I;  3GTK I;  2BJO A;  2NVX I;  3S1Q I;  1NUI A;  3CCQ 1;  3CME 1;  3GTQ I;  2YAD A;  2VUG A;  4DQY B;  1FDO A;  2ZAE B;  1PFT A;  3HOW I;  3CCS 1;  2V8I A;  5FLX f;  1VQ5 Z;  3CCV Z;  2P28 A;  2JA5 I;  4NBC A;  4Y52 I;  2GTH A;  2OZK A;  4A3E I;  3FQQ A;  3NH4 A;  4E32 A;  1Y8C A;  4A3L I;  3IF8 A;  2NVQ I;  4NOZ A;  2RIQ A;  3M4O I;  4A3G I;  5C3E I;  1Q82 2;  4NBD A;  1VQ6 Z;  5T64 A;  3CCU Z;  1VQ6 1;  3H0G I;  1M1K 2;  1VLA A;  2JIR A;  3F3F C;  3CCR 1;  3H3V J;  3OW2 Z;  2W04 A;  3CPW Y;  2I3C A;  2LFU A;  2R7Z I;  3KIF A;  3PO2 I;  3NH8 A;  3NFZ A;  2VPZ A;  2Q51 A;  5IT9 f;  2JA7 I;  3CMA 1;  2E2I I;  2QRD B;  3OW2 Y;  4RVF A;  3CPW Z;  3G6E 1;  3M3Y I;  1RO0 A;  4MH4 A;  4HGZ A;  3PO3 S;  2OTJ 1;  4E30 A;  1ML8 A;  3PO3 I;  3VMI A;  4BBS I;  3TE5 B;  4BBR I;  4E33 A;  1N2F A;  2DE6 A;  3S2H I;  1K9M 2;  2PK7 A;  3Q87 A;  2GU2 A;  3CC7 Z;  3GTM S;  3TDH B;  4RV9 A;  2AYD A;  5D1O A;  3K7A I;  3CCL Z;  2JIO A;  4MON A;  3I55 Z;  3CCL 1;  1TWC I;  4X6A I;  1VQO Z;  3J7A 4;  3CCQ Z;  2AKL A;  1YJ9 1;  3MON A;  4NFR A;  3P5J B;  1NJI 1;  1YJ9 Z;  2NVY I;  4RVH A;  2E2H I;  3HOZ I;  3CCE Z;  2W03 A;  1TFI A;  4A93 I;  3IX0 A;  2YU9 I;  1YJW Z;  1N8R 2;  1YHQ Z;  1YI2 Z;  4HGY A;  3G71 1;  3VB9 A;  1VQM 1;  1M90 1;  1WJ2 A;  2OOX B;  2E2J I;  4A3K I;  1L1O C;  2Q4Z A;  2M6N A;  1Q86 1;  2V3V A;  3J81 f;  3G6E Z;  2QEX Z;  2OTL Z;  2VF1 A;  1TWF I;  2IZ3 A;  1S72 Z;  2F4M A;  1FDI A;  2JIM A;  3KIH A;  1YIJ Z;  3U50 C;  3J80 b;  4BY7 I;  4CL1 A;  3T4N B;  3FKI I;  1M90 2;  3S16 I;  4NBE A;  5AN9 F;  2V45 A;  3S17 I;  3IFU A;  3MZL B;  2NAP A;  2VUM I;  1AA6 A;  1VQ9 1;  1VQ9 Z;  2V8J A;  1VQK 1;  1YJN 1;  1YUK A;  1YIT 1;  1RQF A;  1QYP A;  3CME Z;  3GTM I;  3EER A;  3MZK B;  2R93 I;  2QRE B;  1WCM I;  1Q7Y 2;  3CCS Z;  1JWH C;  2OTL 1;  1Z02 A;  3VMG A;  5C4X I;  3CCV 1;  2JA6 I;  4A3D I;  2H85 A;  1VQ4 Z;  4MD8 A;  3HKZ A;  4A3B I;  4RS4 A;  4A3F I;  3CC4 Z;  1NP6 A;  3G4S 1;  1JJ2 Y;  2KPI A;  2K5R A;  5IP9 I;  5D1P A;  3RZD I;  3GTO I;  3CC7 1;  2QRC B;  1VQL 1;  2K3R A;  3HOU I;  1VQL Z;  2PM9 A;  2JR6 A;  3JAM b;  3QWU A;  4MXU A;  3I55 1;  2RT9 A;  3I4N I;  2JIQ A;  3J80 f;  1K73 1;  4TNU A;  3GKQ A;  3S15 I;  2B63 I;  1R9T I;  1ZB9 A;  2RPR A;  1JJ2 Z;  3HOX I;  2KI7 B;  1KRL A;  4MD7 A;  3CCM Z;  1KC8 1;  4MD9 A;  3GCF A;  5C44 I;  3ESW A;  1VQN Z;  2O53 A;  2DE5 A;  3CXC Z;  2QR1 B;  1DL6 A;  2JMO A;  1VQ7 1;  2IV2 X;  3G4S Z;  1M1K 1;  2HF1 A;  1QVF Z;  5FLX b;  4XX2 A;  3D2L A;  1KD1 2;  1USP A;  4NB9 A;  5IT9 b;  3I4M I;  1WZN A;  2NVT I;  1VQ5 1;  4E2W A;  1ZB8 A;  3CCR Z;  2E9H A;  1W2B Z;  2RBL A;  3CXC Y;  1Y1V I;  1Y1W I;  4RVD A;  1QVF Y;  4NBG A;  1K9M 1;  2QA4 1;  1VQP 1;  3F3P C;  2QA4 Z;  5A2Q f;  1X3W A;  1S7M A;  5D1O B;  2R6M A;  2E7Z A;  1KQS Z;  2JIP A;  2RHB A;  3NDJ A;  1W2B Y;  4NBF A;  4DGL A;  1Z01 A;  4MRI A;  3I07 A;  3CCU 1;  1VQ8 Z;  1X0T A;  4DK1 A;  1RO4 A;  3NH5 A;  1TWG I;  4E2Z A;  3HOY I;  3G71 Z;  1Q16 A;  1WII A;  1KQS Y;  1YJW 1;  3IR7 A;  3FQM A;  2PMZ A;  1YUA A;  1VQN 1;  4A3M I;  5CM2 M;  2JUB A;  1KC8 2;  1K8A 2;  2HU9 A;  3I56 Z;  3D6W A;  3I56 1;  1VQP Z;  1VQ7 Z;  2DE7 A;  1I3Q I;  4E2Y A;  1I6H I;  3CCJ 1;  2VPX A;  3GTJ I;  2OOY B;  2F4O A;  1LQL A;  3GTL I;  1KD1 1;  1Q82 1;  1Q86 2;  1VQO 1;  1VQ8 1;  5T67 A;  3GTG I;  3JAM f;  1ZH1 A;  5A2Q b;  3GTP I;  1K8A 1;  2JNY A;  3CQZ I;  2R92 I;  2V8K A;  1VQK Z;  2EGT A;  4A3C I;  3BG1 B;  1Y1V S;  4A3I I;  1VQM Z; 
#chains in the Genus database with same CATH homology
 2M48 A;  1QVG Z;  3CMA Z;  3S14 I;  3CD6 1;  4NBH A;  1K83 I;  4BY1 I;  2Y0S A;  3CC2 1;  1Z03 A;  2LIY A;  1I50 I;  4E2X A;  1S72 1;  3S1M I;  4A3J I;  2QLV B;  2OTJ Z;  1X3Z A;  1YIJ 1;  1P9N A;  4S1T A;  1Q81 1;  1QVG Y;  3S2D I;  1Q81 2;  1RO2 A;  2P3Y A;  4RVG A;  4AYB A;  3S1N I;  1YJN Z;  2G2K A;  2QEX 1;  4NH1 C;  2GTI A;  3HOV I;  4HH4 A;  1YIT Z;  5LL6 f;  4QTT A;  4QTU A;  2QKD A;  1N8R 1;  3CD6 Z;  2WB1 A;  4NB8 A;  4NBB A;  5IP7 I;  3VTN A;  1SFO I;  3EED A;  3CCE 1;  5T6B A;  2IZ4 A;  4NBA A;  3J81 b;  3CC4 1;  1YHQ 1;  1YI2 1;  1RLY A;  3RZO I;  1TWA I;  1USP B;  1K73 2;  3D9X A;  3CCJ Z;  1NJI 2;  3CC2 Z;  4Y7N I;  3LUS A;  5FLM I;  1RNI A;  1VQ4 1;  2O4H A;  2WAQ A;  3VMH A;  5C4J I;  3BG0 B;  2JA8 I;  3NDI A;  4E31 A;  2J6A A;  4EWC A;  3S1R I;  1Q7Y 1;  4BXX I;  1WW9 A;  2JS4 A;  3CCM 1;  1QF8 A;  1TWH I;  3GTK I;  2BJO A;  2NVX I;  3S1Q I;  1NUI A;  3CCQ 1;  3CME 1;  3GTQ I;  2YAD A;  2VUG A;  4DQY B;  2ZAE B;  1PFT A;  3HOW I;  3CCS 1;  2V8I A;  5FLX f;  1VQ5 Z;  3CCV Z;  2P28 A;  2JA5 I;  4NBC A;  4Y52 I;  2GTH A;  2OZK A;  4A3E I;  3FQQ A;  3NH4 A;  4E32 A;  4A3L I;  3IF8 A;  2NVQ I;  4NOZ A;  2RIQ A;  3M4O I;  4A3G I;  5C3E I;  1Q82 2;  4NBD A;  1VQ6 Z;  5T64 A;  3CCU Z;  1VQ6 1;  3H0G I;  1M1K 2;  1VLA A;  3F3F C;  3CCR 1;  3H3V J;  3OW2 Z;  2W04 A;  3CPW Y;  2I3C A;  2LFU A;  2R7Z I;  3KIF A;  3PO2 I;  3NH8 A;  3NFZ A;  2Q51 A;  5IT9 f;  2JA7 I;  3CMA 1;  2E2I I;  2QRD B;  3OW2 Y;  4RVF A;  3CPW Z;  3G6E 1;  3M3Y I;  1RO0 A;  4MH4 A;  4HGZ A;  3PO3 S;  2OTJ 1;  4E30 A;  1ML8 A;  3PO3 I;  3VMI A;  4BBS I;  3TE5 B;  4BBR I;  4E33 A;  1N2F A;  2DE6 A;  3S2H I;  1K9M 2;  2PK7 A;  3Q87 A;  2GU2 A;  3CC7 Z;  3GTM S;  3TDH B;  4RV9 A;  5D1O A;  3K7A I;  3CCL Z;  4MON A;  3I55 Z;  3CCL 1;  1TWC I;  4X6A I;  1VQO Z;  3J7A 4;  3CCQ Z;  2AKL A;  1YJ9 1;  3MON A;  4NFR A;  3P5J B;  1NJI 1;  1YJ9 Z;  2NVY I;  4RVH A;  2E2H I;  3HOZ I;  3CCE Z;  2W03 A;  1TFI A;  4A93 I;  3IX0 A;  2YU9 I;  1YJW Z;  1N8R 2;  1YHQ Z;  1YI2 Z;  4HGY A;  3G71 1;  3VB9 A;  1VQM 1;  1M90 1;  2OOX B;  2E2J I;  4A3K I;  1L1O C;  2Q4Z A;  2M6N A;  1Q86 1;  3J81 f;  3G6E Z;  2QEX Z;  2OTL Z;  2VF1 A;  1TWF I;  2IZ3 A;  1S72 Z;  2F4M A;  3KIH A;  1YIJ Z;  3U50 C;  3J80 b;  4BY7 I;  4CL1 A;  3T4N B;  3FKI I;  1M90 2;  3S16 I;  4NBE A;  5AN9 F;  3S17 I;  3IFU A;  3MZL B;  2VUM I;  1VQ9 1;  1VQ9 Z;  2V8J A;  1VQK 1;  1YJN 1;  1YUK A;  1YIT 1;  1RQF A;  1QYP A;  3CME Z;  3GTM I;  3EER A;  3MZK B;  2R93 I;  2QRE B;  1WCM I;  1Q7Y 2;  3CCS Z;  1JWH C;  2OTL 1;  1Z02 A;  3VMG A;  5C4X I;  3CCV 1;  2JA6 I;  4A3D I;  2H85 A;  1VQ4 Z;  4MD8 A;  3HKZ A;  4A3B I;  4RS4 A;  4A3F I;  3CC4 Z;  1NP6 A;  3G4S 1;  1JJ2 Y;  2KPI A;  2K5R A;  5IP9 I;  5D1P A;  3RZD I;  3GTO I;  3CC7 1;  2QRC B;  1VQL 1;  2K3R A;  3HOU I;  1VQL Z;  2PM9 A;  2JR6 A;  3JAM b;  3QWU A;  4MXU A;  3I55 1;  2RT9 A;  3I4N I;  3J80 f;  1K73 1;  4TNU A;  3GKQ A;  3S15 I;  2B63 I;  1R9T I;  1ZB9 A;  2RPR A;  1JJ2 Z;  3HOX I;  2KI7 B;  1KRL A;  4MD7 A;  3CCM Z;  1KC8 1;  4MD9 A;  3GCF A;  5C44 I;  3ESW A;  1VQN Z;  2O53 A;  2DE5 A;  3CXC Z;  2QR1 B;  1DL6 A;  2JMO A;  1VQ7 1;  3G4S Z;  1M1K 1;  2HF1 A;  1QVF Z;  5FLX b;  4XX2 A;  1KD1 2;  1USP A;  4NB9 A;  5IT9 b;  3I4M I;  2NVT I;  1VQ5 1;  4E2W A;  1ZB8 A;  3CCR Z;  2E9H A;  1W2B Z;  2RBL A;  3CXC Y;  1Y1V I;  1Y1W I;  4RVD A;  1QVF Y;  4NBG A;  1K9M 1;  2QA4 1;  1VQP 1;  3F3P C;  2QA4 Z;  5A2Q f;  1X3W A;  1S7M A;  5D1O B;  2R6M A;  1KQS Z;  2RHB A;  3NDJ A;  1W2B Y;  4NBF A;  4DGL A;  1Z01 A;  4MRI A;  3I07 A;  3CCU 1;  1VQ8 Z;  1X0T A;  4DK1 A;  1RO4 A;  3NH5 A;  1TWG I;  4E2Z A;  3HOY I;  3G71 Z;  1WII A;  1KQS Y;  1YJW 1;  3FQM A;  2PMZ A;  1YUA A;  1VQN 1;  4A3M I;  5CM2 M;  2JUB A;  1KC8 2;  1K8A 2;  2HU9 A;  3I56 Z;  3D6W A;  3I56 1;  1VQP Z;  1VQ7 Z;  2DE7 A;  1I3Q I;  4E2Y A;  1I6H I;  3CCJ 1;  3GTJ I;  2OOY B;  2F4O A;  1LQL A;  3GTL I;  1KD1 1;  1Q82 1;  1Q86 2;  1VQO 1;  1VQ8 1;  5T67 A;  3GTG I;  3JAM f;  1ZH1 A;  5A2Q b;  3GTP I;  1K8A 1;  2JNY A;  3CQZ I;  2R92 I;  2V8K A;  1VQK Z;  2EGT A;  4A3C I;  3BG1 B;  1Y1V S;  4A3I I;  1VQM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...