3HOYF

Complete rna polymerase ii elongation complex vi
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
87
structure length
87
Chain Sequence
LKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 21
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 3hoyF00
4YFXE 4G7ZE 1I3QF 4XSZE 4C3IF 3PO2F 1TWFF 3S14F 5BYHE 2JA6F 2R92F 5C3EF 2PMZK 3HOXF 3S16F 2O5JE 1HQME 4A3JF 4AYBK 1WCMF 3K7AF 4YFKE 3S1RF 4A3GF 5C4XF 1IW7E 5IYCF 4A3KF 2E2JF 3I4NF 1TWCF 4YFNE 3DXJE 4XLPE 2E2IF 3M4OF 5IPLE 4A3IF 1TWHF 2JA8F 4A93F 3GTOF 4Y7NF 1TWAF 4G7OE 4OINE 1SMYE 5M3FF 2WB1I 2B63F 2WAQK 3S1NF 2NVTF 3HOVF 5D4DE 5M3MF 5FLMF 2A6EE 4C3JF 4A3BF 3WODE 1ZYRE 4C2MF 1I50F 2JA7F 2VUMF 2NVXF 3S17F 3S2HF 2BE5E 5C4JF 3PO3F 4BBSF 3S2DF 3GTQF 4LK0E 3M3YF 3GTGF 3GTMF 4C3HF 4A3EF 3HOWF 4MEYE 2A6HE 1K83F 1YNJK 1TWGF 1I6VE 3S1MF 3HOYF 4A3LF 3HOZF 5M5WF 5M5YF 3H3VG 4BY7F 4MQ9E 3S1QF 4G7HE 1Y1WF 2R7ZF 5FJ8F 1I6HF 3EQLE 3GTLF 3CQZF 5D4EE 4Q5SE 4OIRE 3H0GF 4A3DF 4LK1E 2A69E 4BBRF 2NVQF 2PPBE 3HOUF 5E18E 3I4MF 4X6AF 4OIQE 4KN7E 4A3MF 1R9TF 2CW0E 2A68E 4JK1E 3RZOF 4YG2E 2Y0SI 4BXXF 4A3FF 5IP9F 4GZYE 1QKLA 3HKZK 1YNNK 4ZH4E 3S15F 4KMUE 5IYDF 2E2HF 5E17E 1Y1VF 4Q4ZE 3GTKF 4OIOE 5IYBF 3GTPF 2NVYF 4KN4E 2YU9F 5TMCE 4XSXE 2JA5F 2R93F 4LLGE 5D4CE 5TMFE 4OIPE 5C44F 3FKIF 2O5IE 4Y52F 4A3CF 4LJZE 3GTJF 1SFOF 4MEXE 5IP7F 3RZDF 5M5XF 4XLNE 4BY1F
chains in the Genus database with same CATH superfamily
4YFXE 4G7ZE 4BBSE 1I3QF 4XSZE 4C3IF 4Y52E 3PO2F 1TWFF 3S14F 5BYHE 2R92E 3HOUE 2JA6F 3PO2E 2R92F 5C3EF 2PMZK 1DZFA 1TWFE 3HOXF 3S1ME 3S16F 3HOYE 3CQZE 2O5JE 1HQME 4A3JF 4AYBK 1WCMF 3K7AF 2PMZH 4YFKE 3S1RF 4BY1E 3RZOE 4A3BE 4A3GF 5C4XF 1IW7E 3GTME 3HOWE 5IYCF 5IP7E 4A3KF 2B63E 3S14E 2E2JF 3I4NF 1TWCF 4YFNE 4A3IE 2JA8E 4A93E 3DXJE 4BBRE 4XLPE 2E2IF 3H0GE 3M4OF 5IPLE 4QIWK 2NVQE 3GTGE 4BXXE 4A3IF 1TWHF 2JA8F 4A93F 3GTOF 5FLME 4X6AE 1I6HE 4Y7NF 3I4ME 1TWAF 4G7OE 4OINE 1SMYE 5M3FF 2WB1I 4A3KE 2WAQK 2B63F 1Y1VE 3PO3E 2NVYE 3S2DE 2NVTF 3HOVF 4AYBH 4Y7NE 3GTJE 5D4DE 5M3MF 5FLMF 3GTPE 5M3FE 4BY7E 1TWAE 1I50E 2A6EE 4A3JE 4C3JF 3S1RE 4A3BF 5FJ8E 3GTLE 4A3CE 3WODE 1ZYRE 4C3JE 4C2MF 1I50F 2JA7F 2VUMF 5C3EE 2NVXF 3S17F 3S2HF 2BE5E 5C4JF 3PO3F 3S1QE 1SFOE 4QIWH 4BBSF 3S2DF 3S1NE 3GTQF 3HKZH 4LK0E 2JA7E 3S2HE 3S15E 3M3YF 2KRXA 3GTMF 4C3HF 4A3EF 3GTGF 4MEYE 3FKIE 3HOWF 2A6HE 1K83F 1YNJK 1TWGF 1I6VE 5C44E 3S1MF 4C3HE 3HOYF 3M3YE 2R7ZE 4A3LF 3HOZF 2R93E 5M5WF 5M5YF 3H3VG 4BY7F 4MQ9E 3S1QF 4G7HE 1Y1WF 5IYCE 2R7ZF 5M5YE 4A3DE 5FJ8F 1I6HF 3EQLE 3GTLF 3CQZF 5D4EE 4Q5SE 1WCME 3K7AE 4OIRE 5IP9E 3H0GF 3M4OE 3S1NF 4LK1E 2A69E 4BBRF 2NVQF 4A3DF 5M5XE 2PPBE 3HOUF 5E18E 3GTKE 2E2JE 3I4NE 5IYBE 3I4MF 4X6AF 1TWCE 4OIQE 4KN7E 4A3MF 1R9TF 2CW0E 4C2ME 2A68E 2WB1H 4JK1E 2VUME 3RZOF 4YG2E 2Y0SI 4BXXF 4A3FF 5IP9F 3H3VF 4GZYE 3HOXE 1QKLA 3HKZK 1YNNK 4ZH4E 2YU9E 3S15F 4KMUE 5IYDF 2E2HF 2JA5E 5E17E 1Y1VF 4Q4ZE 3GTKF 2NVXE 4OIOE 5IYBF 3GTPF 3S17E 2NVYF 5IYDE 2E2HE 4A3GE 4KN4E 2YU9F 5C4XE 5TMCE 2Y0SH 4XSXE 2JA5F 3HOZE 2R93F 3GTOE 4LLGE 1EIKA 1TWHE 3S16E 2WAQH 5D4CE 4OIPE 5TMFE 4A3FE 4A3EE 1K83E 1TWGE 5C44F 1Y1WE 3FKIF 2O5IE 3RZDE 4Y52F 2E2IE 2NVTE 3HOVE 4A3CF 4LJZE 5M3ME 3GTJF 1SFOF 4MEXE 4A3ME 1R9TE 5C4JE 2JA6E 3GTQE 5IP7F 4A3LE 5M5WE 3RZDF 1I3QE 5M5XF 4C3IE 4XLNE 4BY1F
chains in the Genus database with same CATH topology
4YFXE 4G7ZE 1I3QF 4XSZE 4C3IF 3PO2F 1TWFF 3S14F 5BYHE 2JA6F 2R92F 5C3EF 2PMZK 3HOXF 3S16F 2O5JE 1HQME 4A3JF 4AYBK 1WCMF 3K7AF 4YFKE 3S1RF 4A3GF 5C4XF 1IW7E 5IYCF 4A3KF 2E2JF 3I4NF 1TWCF 4YFNE 3DXJE 4XLPE 2E2IF 3M4OF 5IPLE 4QIWK 4A3IF 1TWHF 2JA8F 4A93F 3GTOF 4Y7NF 1TWAF 4G7OE 4OINE 1SMYE 5M3FF 2WB1I 2B63F 2WAQK 3S1NF 2NVTF 3HOVF 5D4DE 5M3MF 5FLMF 2A6EE 4C3JF 4A3BF 3WODE 1ZYRE 4C2MF 1I50F 2JA7F 2VUMF 2NVXF 3S17F 3S2HF 2BE5E 5C4JF 3PO3F 4BBSF 3S2DF 3GTQF 4LK0E 3M3YF 2KRXA 3GTMF 4C3HF 4A3EF 3GTGF 4MEYE 3HOWF 2A6HE 1K83F 1YNJK 1TWGF 1I6VE 3S1MF 3HOYF 4A3LF 3HOZF 5M5WF 5M5YF 3H3VG 4BY7F 4MQ9E 3S1QF 4G7HE 1Y1WF 2R7ZF 5FJ8F 1I6HF 3EQLE 3GTLF 3CQZF 5D4EE 4Q5SE 4OIRE 3H0GF 4A3DF 4LK1E 2A69E 4BBRF 2NVQF 2PPBE 3HOUF 5E18E 3I4MF 4X6AF 4OIQE 4KN7E 4A3MF 1R9TF 2CW0E 2A68E 4JK1E 3RZOF 4YG2E 2Y0SI 4BXXF 4A3FF 5IP9F 4GZYE 1QKLA 3HKZK 1YNNK 4ZH4E 3S15F 4KMUE 5IYDF 2E2HF 5E17E 1Y1VF 4Q4ZE 3GTKF 4OIOE 5IYBF 3GTPF 2NVYF 4KN4E 2YU9F 5TMCE 4XSXE 2JA5F 2R93F 4LLGE 5D4CE 5TMFE 4OIPE 5C44F 3FKIF 2O5IE 4Y52F 4A3CF 4LJZE 3GTJF 1SFOF 4MEXE 5IP7F 3RZDF 5M5XF 4XLNE 4BY1F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX E;  4G7Z E;  1I3Q F;  4XSZ E;  4C3I F;  3PO2 F;  1TWF F;  3S14 F;  5BYH E;  2JA6 F;  2R92 F;  5C3E F;  2PMZ K;  3HOX F;  3S16 F;  2O5J E;  1HQM E;  4A3J F;  4AYB K;  1WCM F;  3K7A F;  4YFK E;  3S1R F;  4A3G F;  5C4X F;  1IW7 E;  5IYC F;  4A3K F;  2E2J F;  3I4N F;  1TWC F;  4YFN E;  3DXJ E;  4XLP E;  2E2I F;  3M4O F;  5IPL E;  4A3I F;  1TWH F;  2JA8 F;  4A93 F;  3GTO F;  4Y7N F;  1TWA F;  4G7O E;  4OIN E;  1SMY E;  5M3F F;  2WB1 I;  2B63 F;  2WAQ K;  3S1N F;  2NVT F;  3HOV F;  5D4D E;  5M3M F;  5FLM F;  2A6E E;  4C3J F;  4A3B F;  3WOD E;  1ZYR E;  4C2M F;  1I50 F;  2JA7 F;  2VUM F;  2NVX F;  3S17 F;  3S2H F;  2BE5 E;  5C4J F;  3PO3 F;  4BBS F;  3S2D F;  3GTQ F;  4LK0 E;  3M3Y F;  3GTG F;  3GTM F;  4C3H F;  4A3E F;  3HOW F;  4MEY E;  2A6H E;  1K83 F;  1YNJ K;  1TWG F;  1I6V E;  3S1M F;  3HOY F;  4A3L F;  3HOZ F;  5M5W F;  5M5Y F;  3H3V G;  4BY7 F;  4MQ9 E;  3S1Q F;  4G7H E;  1Y1W F;  2R7Z F;  5FJ8 F;  1I6H F;  3EQL E;  3GTL F;  3CQZ F;  5D4E E;  4Q5S E;  4OIR E;  3H0G F;  4A3D F;  4LK1 E;  2A69 E;  4BBR F;  2NVQ F;  2PPB E;  3HOU F;  5E18 E;  3I4M F;  4X6A F;  4OIQ E;  4KN7 E;  4A3M F;  1R9T F;  2CW0 E;  2A68 E;  4JK1 E;  3RZO F;  4YG2 E;  2Y0S I;  4BXX F;  4A3F F;  5IP9 F;  4GZY E;  1QKL A;  3HKZ K;  1YNN K;  4ZH4 E;  3S15 F;  4KMU E;  5IYD F;  2E2H F;  5E17 E;  1Y1V F;  4Q4Z E;  3GTK F;  4OIO E;  5IYB F;  3GTP F;  2NVY F;  4KN4 E;  2YU9 F;  5TMC E;  4XSX E;  2JA5 F;  2R93 F;  4LLG E;  5D4C E;  5TMF E;  4OIP E;  5C44 F;  3FKI F;  2O5I E;  4Y52 F;  4A3C F;  4LJZ E;  3GTJ F;  1SFO F;  4MEX E;  5IP7 F;  3RZD F;  5M5X F;  4XLN E;  4BY1 F; 
#chains in the Genus database with same CATH topology
 4YFX E;  4G7Z E;  4BBS E;  1I3Q F;  4XSZ E;  4C3I F;  4Y52 E;  3PO2 F;  1TWF F;  3S14 F;  5BYH E;  2R92 E;  3HOU E;  2JA6 F;  3PO2 E;  2R92 F;  5C3E F;  2PMZ K;  1DZF A;  1TWF E;  3HOX F;  3S1M E;  3S16 F;  3HOY E;  3CQZ E;  2O5J E;  1HQM E;  4A3J F;  4AYB K;  1WCM F;  3K7A F;  2PMZ H;  4YFK E;  3S1R F;  4BY1 E;  3RZO E;  4A3B E;  4A3G F;  5C4X F;  1IW7 E;  3GTM E;  3HOW E;  5IYC F;  5IP7 E;  4A3K F;  2B63 E;  3S14 E;  2E2J F;  3I4N F;  1TWC F;  4YFN E;  4A3I E;  2JA8 E;  4A93 E;  3DXJ E;  4BBR E;  4XLP E;  2E2I F;  3H0G E;  3M4O F;  5IPL E;  4QIW K;  2NVQ E;  3GTG E;  4BXX E;  4A3I F;  1TWH F;  2JA8 F;  4A93 F;  3GTO F;  5FLM E;  4X6A E;  1I6H E;  4Y7N F;  3I4M E;  1TWA F;  4G7O E;  4OIN E;  1SMY E;  5M3F F;  2WB1 I;  4A3K E;  2WAQ K;  2B63 F;  1Y1V E;  3PO3 E;  2NVY E;  3S2D E;  2NVT F;  3HOV F;  4AYB H;  4Y7N E;  3GTJ E;  5D4D E;  5M3M F;  5FLM F;  3GTP E;  5M3F E;  4BY7 E;  1TWA E;  1I50 E;  2A6E E;  4A3J E;  4C3J F;  3S1R E;  4A3B F;  5FJ8 E;  3GTL E;  4A3C E;  3WOD E;  1ZYR E;  4C3J E;  4C2M F;  1I50 F;  2JA7 F;  2VUM F;  5C3E E;  2NVX F;  3S17 F;  3S2H F;  2BE5 E;  5C4J F;  3PO3 F;  3S1Q E;  1SFO E;  4QIW H;  4BBS F;  3S2D F;  3S1N E;  3GTQ F;  3HKZ H;  4LK0 E;  2JA7 E;  3S2H E;  3S15 E;  3M3Y F;  2KRX A;  3GTM F;  4C3H F;  4A3E F;  3GTG F;  4MEY E;  3FKI E;  3HOW F;  2A6H E;  1K83 F;  1YNJ K;  1TWG F;  1I6V E;  5C44 E;  3S1M F;  4C3H E;  3HOY F;  3M3Y E;  2R7Z E;  4A3L F;  3HOZ F;  2R93 E;  5M5W F;  5M5Y F;  3H3V G;  4BY7 F;  4MQ9 E;  3S1Q F;  4G7H E;  1Y1W F;  5IYC E;  2R7Z F;  5M5Y E;  4A3D E;  5FJ8 F;  1I6H F;  3EQL E;  3GTL F;  3CQZ F;  5D4E E;  4Q5S E;  1WCM E;  3K7A E;  4OIR E;  5IP9 E;  3H0G F;  3M4O E;  3S1N F;  4LK1 E;  2A69 E;  4BBR F;  2NVQ F;  4A3D F;  5M5X E;  2PPB E;  3HOU F;  5E18 E;  3GTK E;  2E2J E;  3I4N E;  5IYB E;  3I4M F;  4X6A F;  1TWC E;  4OIQ E;  4KN7 E;  4A3M F;  1R9T F;  2CW0 E;  4C2M E;  2A68 E;  2WB1 H;  4JK1 E;  2VUM E;  3RZO F;  4YG2 E;  2Y0S I;  4BXX F;  4A3F F;  5IP9 F;  3H3V F;  4GZY E;  3HOX E;  1QKL A;  3HKZ K;  1YNN K;  4ZH4 E;  2YU9 E;  3S15 F;  4KMU E;  5IYD F;  2E2H F;  2JA5 E;  5E17 E;  1Y1V F;  4Q4Z E;  3GTK F;  2NVX E;  4OIO E;  5IYB F;  3GTP F;  3S17 E;  2NVY F;  5IYD E;  2E2H E;  4A3G E;  4KN4 E;  2YU9 F;  5C4X E;  5TMC E;  2Y0S H;  4XSX E;  2JA5 F;  3HOZ E;  2R93 F;  3GTO E;  4LLG E;  1EIK A;  1TWH E;  3S16 E;  2WAQ H;  5D4C E;  4OIP E;  5TMF E;  4A3F E;  4A3E E;  1K83 E;  1TWG E;  5C44 F;  1Y1W E;  3FKI F;  2O5I E;  3RZD E;  4Y52 F;  2E2I E;  2NVT E;  3HOV E;  4A3C F;  4LJZ E;  5M3M E;  3GTJ F;  1SFO F;  4MEX E;  4A3M E;  1R9T E;  5C4J E;  2JA6 E;  3GTQ E;  5IP7 F;  4A3L E;  5M5W E;  3RZD F;  1I3Q E;  5M5X F;  4C3I E;  4XLN E;  4BY1 F; 
#chains in the Genus database with same CATH homology
 4YFX E;  4G7Z E;  1I3Q F;  4XSZ E;  4C3I F;  3PO2 F;  1TWF F;  3S14 F;  5BYH E;  2JA6 F;  2R92 F;  5C3E F;  2PMZ K;  3HOX F;  3S16 F;  2O5J E;  1HQM E;  4A3J F;  4AYB K;  1WCM F;  3K7A F;  4YFK E;  3S1R F;  4A3G F;  5C4X F;  1IW7 E;  5IYC F;  4A3K F;  2E2J F;  3I4N F;  1TWC F;  4YFN E;  3DXJ E;  4XLP E;  2E2I F;  3M4O F;  5IPL E;  4QIW K;  4A3I F;  1TWH F;  2JA8 F;  4A93 F;  3GTO F;  4Y7N F;  1TWA F;  4G7O E;  4OIN E;  1SMY E;  5M3F F;  2WB1 I;  2B63 F;  2WAQ K;  3S1N F;  2NVT F;  3HOV F;  5D4D E;  5M3M F;  5FLM F;  2A6E E;  4C3J F;  4A3B F;  3WOD E;  1ZYR E;  4C2M F;  1I50 F;  2JA7 F;  2VUM F;  2NVX F;  3S17 F;  3S2H F;  2BE5 E;  5C4J F;  3PO3 F;  4BBS F;  3S2D F;  3GTQ F;  4LK0 E;  3M3Y F;  2KRX A;  3GTM F;  4C3H F;  4A3E F;  3GTG F;  4MEY E;  3HOW F;  2A6H E;  1K83 F;  1YNJ K;  1TWG F;  1I6V E;  3S1M F;  3HOY F;  4A3L F;  3HOZ F;  5M5W F;  5M5Y F;  3H3V G;  4BY7 F;  4MQ9 E;  3S1Q F;  4G7H E;  1Y1W F;  2R7Z F;  5FJ8 F;  1I6H F;  3EQL E;  3GTL F;  3CQZ F;  5D4E E;  4Q5S E;  4OIR E;  3H0G F;  4A3D F;  4LK1 E;  2A69 E;  4BBR F;  2NVQ F;  2PPB E;  3HOU F;  5E18 E;  3I4M F;  4X6A F;  4OIQ E;  4KN7 E;  4A3M F;  1R9T F;  2CW0 E;  2A68 E;  4JK1 E;  3RZO F;  4YG2 E;  2Y0S I;  4BXX F;  4A3F F;  5IP9 F;  4GZY E;  1QKL A;  3HKZ K;  1YNN K;  4ZH4 E;  3S15 F;  4KMU E;  5IYD F;  2E2H F;  5E17 E;  1Y1V F;  4Q4Z E;  3GTK F;  4OIO E;  5IYB F;  3GTP F;  2NVY F;  4KN4 E;  2YU9 F;  5TMC E;  4XSX E;  2JA5 F;  2R93 F;  4LLG E;  5D4C E;  5TMF E;  4OIP E;  5C44 F;  3FKI F;  2O5I E;  4Y52 F;  4A3C F;  4LJZ E;  3GTJ F;  1SFO F;  4MEX E;  5IP7 F;  3RZD F;  5M5X F;  4XLN E;  4BY1 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...