3HOZI

Complete rna polymerase ii elongation complex iv with a t-u mismatch and a frayed rna 3'-guanine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 8
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3hozI02
4BXXI 1Y1VS 2E2JI 3S16I 4QTUA 2BJOA 4NBDA 3FKII 4BY1I 4BBSI 2F4MA 2DE7A 4NBEA 4A3KI 2AKLA 4MH4A 4NB8A 4Y52I 5CM2M 3RZDI 4A3GI 2J6AA 2HF1A 3ESWA 4QTTA 1USPA 1USPB 4A3II 1X3ZA 3GTJI 1TWFI 2JA8I 2NVQI 2E2HI 4A3JI 5IP9I 4NOZA 2R93I 1Y1WI 4A3CI 4BBRI 4A93I 1I6HI 3GTLI 1TWGI 3PO3S 1TWAI 1PFTA 4NB9A 3GCFA 1I3QI 3GTOI 2NVTI 4NBCA 1QYPA 2P3YA 1NUIA 4NBAA 3I4MI 4Y7NI 3M4OI 3RZOI 3S1RI 2RBLA 3PO2I 4A3DI 4A3FI 2VUMI 3VMIA 4XX2A 3U50C 3S15I 4BY7I 3GTMI 2K5RA 3H0GI 4NBHA 3HOXI 1DL6A 1WW9A 2JA7I 4NBBA 1TWCI 3LUSA 3D6WA 1WCMI 2R7ZI 4X6AI 1TWHI 1VLAA 3S1MI 2R92I 1LQLA 1YUAA 4A3BI 1ML8A 5C4XI 1I50I 1N2FA 1ZB9A 3GTGI 2DE6A 2F4OA 1L1OC 1Y1VI 1RLYA 5FLMI 4A3MI 3HOUI 3VB9A 1K83I 3I07A 3PO3I 3EERA 3GTQI 3S14I 3S1NI 5C44I 4NBFA 5C3EI 3GTPI 2E2II 2B63I 3HOYI 3HOWI 1SFOI 1R9TI 5C4JI 3S2HI 4NBGA 4A3EI 2NVYI 3GTMS 2NVXI 3S2DI 3K7AI 3GTKI 3Q87A 1RO4A 2YU9I 3VMHA 5IP7I 2JA6I 3HOVI 3GKQA 3M3YI 2JR6A 2JNYA 1TFIA 2JS4A 3HOZI 3S1QI 3H3VJ 1ZB8A 3S17I 4A3LI 1X3WA 2PK7A 3VMGA 2JA5I 2KPIA 3I4NI 2DE5A 3CQZI
chains in the Genus database with same CATH superfamily
3FQQA 1Y8CA 2BJOA 4BBSI 3CCE1 4NBEA 2QR1B 4MD7A 2AKLA 1YUKA 2IZ4A 4MH4A 4HGYA 5A2Qb 3MZKB 3G4SZ 1VQ4Z 4E31A 2VPYA 3KIFA 1VQMZ 2E2HI 4DQYB 2RIQA 1FDIA 3CD61 2R93I 2OTLZ 1Y1WI 4E2XA 3VTNA 1I6HI 3PO3S 3KIHA 4E33A 1YIJZ 3CMA1 2P3YA 4NBAA 3M4OI 1SIWA 3CCS1 3RZOI 3S1RI 4E32A 4A3FI 3CPWY 1VQM1 1ZH1A 1RO2A 1VQOZ 3U50C 3JAMb 2K5RA 2QRCB 1DL6A 2Y0SA 5AN9F 3CCQZ 1Q811 3CC21 2R6MA 1K8A1 1TWHI 1VQ6Z 3S1MI 3CMAZ 1YIJ1 1I50I 1Y1VI 3CCUZ 5FLMI 4E2ZA 2K3RA 1JWHC 3GTQI 4MXUA 5C44I 2GU2A 3D2LA 3GTPI 2B63I 2OTJZ 1AA6A 3HOYI 5T64A 3NH5A 3J80f 3CCVZ 2QRDB 1VQ51 3CCL1 5T67A 1Q862 1Q16A 2M6NA 3K7AI 3I55Z 3CC7Z 5D1PA 2NAPA 3TE5B 2V45A 3NH8A 3TDHB 2JNYA 2E7ZA 1VQ61 3CC4Z 3HOZI 1ZB8A 3S17I 2PK7A 3CQZI 3P5JB 1N8R1 1VQ5Z 3S16I 1KD12 1KRLA 3FKII 3CD6Z 2IV2X 3JAMf 1K8A2 3NDJA 5CM2M 2PMZA 2G2KA 2HF1A 3ESWA 1USPA 1X3ZA 3GTJI 1TWFI 2GTHA 2JA8I 2NVQI 1KC81 3IX0A 2AYDA 1K732 1TWGI 5FLXf 1NJI2 1Z01A 3GCFA 3G6EZ 1I3QI 1VQK1 2QKDA 1NUIA 1Z02A 2O53A 2VPWA 4A3DI 2LEXA 2V8IA 1VQO1 1KQSY 3VMIA 3CPWZ 3S15I 4BY7I 4E2WA 3GTMI 5FLXb 1WW9A 3FQMA 4CL1A 2GTIA 3J81f 5D1OB 1YJWZ 2Q4ZA 1WCMI 2R7ZI 3CCJ1 2R92I 2QLVB 1VQKZ 2OTJ1 1JJ2Z 2QEX1 4A3BI 4MD9A 4MONA 2VUGA 4RVHA 1Q821 2RT9A 1WJ2A 3CCV1 1QF8A 3HOUI 1Q822 3PO3I 4EWCA 2W04A 2OTL1 4NFRA 3S1NI 3MONA 1VQ41 3HOWI 3CXCY 3CCMZ 1KC82 2QREB 1K9M1 2P28A 2V8KA 2RHBA 1FDOA 5D1OA 2JUBA 2YU9I 4NH1C 1Q7Y2 3CC41 2JA6I 2OOXB 1TFIA 3CCQ1 2JS4A 1KD11 3J80b 3S1QI 3H3VJ 2LFUA 3G711 4A3LI 1X3WA 2QA41 2DE5A 2JMOA 3CCR1 1Y1VS 4MD8A 5IT9b 1RQFA 1YITZ 1YI2Z 4BY1I 2F4MA 2DE7A 3T4NB 4A3KI 3CMEZ 1VQNZ 4NB8A 4Y52I 4A3GI 2J6AA 2WAQA 5T6BA 1Q7Y1 1USPB 3OW2Z 4A3JI 4AYBA 5IP9I 1VQ71 4A3CI 3I561 3IR7A 3CCEZ 1YIT1 1W2BZ 1Z03A 2JIRA 3CME1 2NVTI 4NBCA 1QYPA 4Y7NI 3J81b 2RBLA 3PO2I 3CCU1 1QVFY 3CC71 3I551 3HOXI 2V8JA 4E2YA 5A2Qf 4X6AI 1VLAA 5IT9f 1X0TA 1S721 3CCM1 1ML8A 1ZB9A 2IZ3A 2RPRA 2F4OA 1L1OC 1QVFZ 2W03A 1P9NA 4A3MI 1WZNA 3I07A 1QVGY 5C3EI 2E2II 2LIYA 1QVGZ 1R9TI 4NBGA 1WIIA 2M48A 4A3EI 2Q51A 5LL6f 1S72Z 3GTMS 2NVXI 3S2DI 4TNUA 2VPZA 2E9HA 3QWUA 1JJ2Y 3Q87A 3NFZA 1RO4A 1Q861 4E30A 2HU9A 4DGLA 1QXFA 5IP7I 3GKQA 2EGTA 1RNIA 2QA4Z 4RV9A 3VMGA 2KPIA 1YJ9Z 1W2BY 2I3CA 1VQL1 4BXXI 2VPXA 2E2JI 4DK1A 1YJN1 3D9XA 4QTUA 4S1TA 4NBDA 4HH4A 1NJI1 1YHQ1 3G6E1 3RZDI 4MRIA 4QTTA 3IF8A 4A3II 2V3VA 1VQ81 3I56Z 4NOZA 2PM9A 4BBRI 2JIPA 4A93I 3GTLI 3MZLB 1TWAI 3NH4A 1PFTA 4NB9A 1M902 3GTOI 4RVGA 3I4MI 2VUMI 1YJNZ 1VQLZ 4XX2A 2VF1A 3BG0B 1YHQZ 3H0GI 4NBHA 3IFUA 3CCRZ 2JA7I 2OZKA 4NBBA 1TWCI 3LUSA 1S7MA 1VQPZ 1N8R2 3D6WA 3BG1B 1VQ9Z 3CC2Z 4HGZA 1LQLA 3G71Z 1YUAA 3NDIA 1VQ8Z 1Q812 5C4XI 1N2FA 2JIMA 3GTGI 2DE6A 2KI7B 1RLYA 3F3FC 1KQSZ 3VB9A 1K83I 3CXCZ 4RS4A 3EERA 1VQN1 3S14I 1K731 4NBFA 2WB1A 4RVFA 2H85A 3HKZA 2OOYB 1M1K1 3G4S1 1SFOI 5C4JI 3S2HI 1NP6A 2NVYI 2ZAEB 2JIOA 1VQ7Z 3OW2Y 1YJ91 1VQP1 2JIQA 1YI21 3GTKI 1VQ91 2O4HA 3F3PC 2YADA 3VMHA 1RO0A 1YJW1 3HOVI 3M3YI 2JR6A 3CCJZ 1K9M2 1M901 3J7A4 3CCSZ 3CCLZ 2JA5I 1M1K2 2QEXZ 3I4NI 4RVDA 3EEDA
chains in the Genus database with same CATH topology
3FQQA 2BJOA 4BBSI 3CCE1 4NBEA 2QR1B 4MD7A 2AKLA 1YUKA 2IZ4A 4MH4A 4HGYA 5A2Qb 3MZKB 3G4SZ 1VQ4Z 4E31A 3KIFA 1VQMZ 2E2HI 4DQYB 2RIQA 3CD61 2R93I 2OTLZ 1Y1WI 4E2XA 3VTNA 1I6HI 3PO3S 3KIHA 4E33A 1YIJZ 3CMA1 2P3YA 4NBAA 3M4OI 3RZOI 3CCS1 3S1RI 4E32A 4A3FI 3CPWY 1VQM1 1ZH1A 1RO2A 1VQOZ 3U50C 3JAMb 2K5RA 2QRCB 1DL6A 2Y0SA 5AN9F 3CCQZ 1Q811 3CC21 2R6MA 1K8A1 1TWHI 1VQ6Z 3S1MI 3CMAZ 1YIJ1 1I50I 1Y1VI 3CCUZ 5FLMI 4E2ZA 2K3RA 1JWHC 3GTQI 4MXUA 5C44I 2GU2A 3GTPI 2B63I 2OTJZ 3HOYI 5T64A 3NH5A 3J80f 3CCVZ 2QRDB 1VQ51 3CCL1 5T67A 1Q862 2M6NA 3K7AI 3I55Z 3CC7Z 5D1PA 3TE5B 3NH8A 3TDHB 2JNYA 1VQ61 3CC4Z 3HOZI 1ZB8A 3S17I 2PK7A 3CQZI 3P5JB 1N8R1 1VQ5Z 3S16I 1KD12 1KRLA 3FKII 3CD6Z 3JAMf 1K8A2 3NDJA 5CM2M 2PMZA 2G2KA 2HF1A 3ESWA 1USPA 1X3ZA 3GTJI 1TWFI 2GTHA 2JA8I 2NVQI 1KC81 3IX0A 1K732 1TWGI 5FLXf 1NJI2 1Z01A 3GCFA 3G6EZ 1I3QI 1VQK1 2QKDA 1NUIA 1Z02A 2O53A 4A3DI 2V8IA 1VQO1 1KQSY 3VMIA 3CPWZ 3S15I 4BY7I 4E2WA 3GTMI 5FLXb 1WW9A 3FQMA 4CL1A 2GTIA 3J81f 5D1OB 1YJWZ 2Q4ZA 1WCMI 2R7ZI 3CCJ1 2R92I 2QLVB 1VQKZ 2OTJ1 1JJ2Z 2QEX1 4A3BI 4MD9A 4MONA 2VUGA 4RVHA 1Q821 2RT9A 3CCV1 1QF8A 3HOUI 1Q822 3PO3I 4EWCA 2W04A 2OTL1 4NFRA 3S1NI 3MONA 1VQ41 3HOWI 3CXCY 3CCMZ 1KC82 2QREB 1K9M1 2P28A 2V8KA 2RHBA 5D1OA 2JUBA 2YU9I 4NH1C 1Q7Y2 3CC41 2JA6I 2OOXB 1TFIA 3CCQ1 2JS4A 1KD11 3J80b 3S1QI 3H3VJ 2LFUA 3G711 4A3LI 1X3WA 2QA41 2DE5A 2JMOA 3CCR1 1Y1VS 4MD8A 5IT9b 1RQFA 1YITZ 1YI2Z 4BY1I 2F4MA 2DE7A 3T4NB 4A3KI 3CMEZ 1VQNZ 4NB8A 4Y52I 4A3GI 2J6AA 2WAQA 5T6BA 1Q7Y1 1USPB 3OW2Z 4A3JI 4AYBA 5IP9I 1VQ71 4A3CI 3I561 3CCEZ 1YIT1 1W2BZ 1Z03A 3CME1 2NVTI 4NBCA 1QYPA 4Y7NI 3J81b 2RBLA 3PO2I 3CCU1 1QVFY 3CC71 3I551 3HOXI 2V8JA 4E2YA 5A2Qf 4X6AI 1VLAA 5IT9f 1X0TA 1S721 3CCM1 1ML8A 1ZB9A 2IZ3A 2RPRA 2F4OA 1L1OC 1QVFZ 2W03A 1P9NA 4A3MI 3I07A 1QVGY 5C3EI 2E2II 2LIYA 1QVGZ 1R9TI 4NBGA 1WIIA 2M48A 4A3EI 2Q51A 5LL6f 1S72Z 3GTMS 2NVXI 3S2DI 4TNUA 2E9HA 3QWUA 1JJ2Y 3Q87A 3NFZA 1RO4A 1Q861 4E30A 2HU9A 4DGLA 5IP7I 3GKQA 2EGTA 1RNIA 2QA4Z 4RV9A 3VMGA 2KPIA 1YJ9Z 1W2BY 2I3CA 1VQL1 4BXXI 2E2JI 4DK1A 1YJN1 3D9XA 4QTUA 4S1TA 4NBDA 4HH4A 1NJI1 1YHQ1 3G6E1 3RZDI 4MRIA 4QTTA 3IF8A 4A3II 1VQ81 3I56Z 4NOZA 2PM9A 4BBRI 4A93I 3GTLI 3MZLB 1TWAI 3NH4A 1PFTA 4NB9A 1M902 3GTOI 4RVGA 3I4MI 2VUMI 1YJNZ 1VQLZ 4XX2A 2VF1A 3BG0B 1YHQZ 3H0GI 4NBHA 3IFUA 3CCRZ 2JA7I 2OZKA 4NBBA 1TWCI 3LUSA 1S7MA 1VQPZ 1N8R2 3D6WA 3BG1B 1VQ9Z 3CC2Z 4HGZA 1LQLA 3G71Z 1YUAA 3NDIA 1VQ8Z 1Q812 5C4XI 1N2FA 3GTGI 2DE6A 2KI7B 1RLYA 3F3FC 1KQSZ 3VB9A 1K83I 3CXCZ 4RS4A 3EERA 1VQN1 3S14I 1K731 4NBFA 2WB1A 4RVFA 2H85A 3HKZA 2OOYB 1M1K1 3G4S1 1SFOI 5C4JI 3S2HI 1NP6A 2NVYI 2ZAEB 1VQ7Z 3OW2Y 1YJ91 1VQP1 1YI21 3GTKI 1VQ91 2O4HA 3F3PC 2YADA 3VMHA 1RO0A 1YJW1 3HOVI 3M3YI 2JR6A 3CCJZ 1K9M2 1M901 3J7A4 3CCSZ 3CCLZ 2JA5I 1M1K2 2QEXZ 3I4NI 4RVDA 3EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX I;  1Y1V S;  2E2J I;  3S16 I;  4QTU A;  2BJO A;  4NBD A;  3FKI I;  4BY1 I;  4BBS I;  2F4M A;  2DE7 A;  4NBE A;  4A3K I;  2AKL A;  4MH4 A;  4NB8 A;  4Y52 I;  5CM2 M;  3RZD I;  4A3G I;  2J6A A;  2HF1 A;  3ESW A;  4QTT A;  1USP A;  1USP B;  4A3I I;  1X3Z A;  3GTJ I;  1TWF I;  2JA8 I;  2NVQ I;  2E2H I;  4A3J I;  5IP9 I;  4NOZ A;  2R93 I;  1Y1W I;  4A3C I;  4BBR I;  4A93 I;  1I6H I;  3GTL I;  1TWG I;  3PO3 S;  1TWA I;  1PFT A;  4NB9 A;  3GCF A;  1I3Q I;  3GTO I;  2NVT I;  4NBC A;  1QYP A;  2P3Y A;  1NUI A;  4NBA A;  3I4M I;  4Y7N I;  3M4O I;  3RZO I;  3S1R I;  2RBL A;  3PO2 I;  4A3D I;  4A3F I;  2VUM I;  3VMI A;  4XX2 A;  3U50 C;  3S15 I;  4BY7 I;  3GTM I;  2K5R A;  3H0G I;  4NBH A;  3HOX I;  1DL6 A;  1WW9 A;  2JA7 I;  4NBB A;  1TWC I;  3LUS A;  3D6W A;  1WCM I;  2R7Z I;  4X6A I;  1TWH I;  1VLA A;  3S1M I;  2R92 I;  1LQL A;  1YUA A;  4A3B I;  1ML8 A;  5C4X I;  1I50 I;  1N2F A;  1ZB9 A;  3GTG I;  2DE6 A;  2F4O A;  1L1O C;  1Y1V I;  1RLY A;  5FLM I;  4A3M I;  3HOU I;  3VB9 A;  1K83 I;  3I07 A;  3PO3 I;  3EER A;  3GTQ I;  3S14 I;  3S1N I;  5C44 I;  4NBF A;  5C3E I;  3GTP I;  2E2I I;  2B63 I;  3HOY I;  3HOW I;  1SFO I;  1R9T I;  5C4J I;  3S2H I;  4NBG A;  4A3E I;  2NVY I;  3GTM S;  2NVX I;  3S2D I;  3K7A I;  3GTK I;  3Q87 A;  1RO4 A;  2YU9 I;  3VMH A;  5IP7 I;  2JA6 I;  3HOV I;  3GKQ A;  3M3Y I;  2JR6 A;  2JNY A;  1TFI A;  2JS4 A;  3HOZ I;  3S1Q I;  3H3V J;  1ZB8 A;  3S17 I;  4A3L I;  1X3W A;  2PK7 A;  3VMG A;  2JA5 I;  2KPI A;  3I4N I;  2DE5 A;  3CQZ I; 
#chains in the Genus database with same CATH topology
 3FQQ A;  1Y8C A;  2BJO A;  4BBS I;  3CCE 1;  4NBE A;  2QR1 B;  4MD7 A;  2AKL A;  1YUK A;  2IZ4 A;  4MH4 A;  4HGY A;  5A2Q b;  3MZK B;  3G4S Z;  1VQ4 Z;  4E31 A;  2VPY A;  3KIF A;  1VQM Z;  2E2H I;  4DQY B;  2RIQ A;  1FDI A;  3CD6 1;  2R93 I;  2OTL Z;  1Y1W I;  4E2X A;  3VTN A;  1I6H I;  3PO3 S;  3KIH A;  4E33 A;  1YIJ Z;  3CMA 1;  2P3Y A;  4NBA A;  3M4O I;  1SIW A;  3CCS 1;  3RZO I;  3S1R I;  4E32 A;  4A3F I;  3CPW Y;  1VQM 1;  1ZH1 A;  1RO2 A;  1VQO Z;  3U50 C;  3JAM b;  2K5R A;  2QRC B;  1DL6 A;  2Y0S A;  5AN9 F;  3CCQ Z;  1Q81 1;  3CC2 1;  2R6M A;  1K8A 1;  1TWH I;  1VQ6 Z;  3S1M I;  3CMA Z;  1YIJ 1;  1I50 I;  1Y1V I;  3CCU Z;  5FLM I;  4E2Z A;  2K3R A;  1JWH C;  3GTQ I;  4MXU A;  5C44 I;  2GU2 A;  3D2L A;  3GTP I;  2B63 I;  2OTJ Z;  1AA6 A;  3HOY I;  5T64 A;  3NH5 A;  3J80 f;  3CCV Z;  2QRD B;  1VQ5 1;  3CCL 1;  5T67 A;  1Q86 2;  1Q16 A;  2M6N A;  3K7A I;  3I55 Z;  3CC7 Z;  5D1P A;  2NAP A;  3TE5 B;  2V45 A;  3NH8 A;  3TDH B;  2JNY A;  2E7Z A;  1VQ6 1;  3CC4 Z;  3HOZ I;  1ZB8 A;  3S17 I;  2PK7 A;  3CQZ I;  3P5J B;  1N8R 1;  1VQ5 Z;  3S16 I;  1KD1 2;  1KRL A;  3FKI I;  3CD6 Z;  2IV2 X;  3JAM f;  1K8A 2;  3NDJ A;  5CM2 M;  2PMZ A;  2G2K A;  2HF1 A;  3ESW A;  1USP A;  1X3Z A;  3GTJ I;  1TWF I;  2GTH A;  2JA8 I;  2NVQ I;  1KC8 1;  3IX0 A;  2AYD A;  1K73 2;  1TWG I;  5FLX f;  1NJI 2;  1Z01 A;  3GCF A;  3G6E Z;  1I3Q I;  1VQK 1;  2QKD A;  1NUI A;  1Z02 A;  2O53 A;  2VPW A;  4A3D I;  2LEX A;  2V8I A;  1VQO 1;  1KQS Y;  3VMI A;  3CPW Z;  3S15 I;  4BY7 I;  4E2W A;  3GTM I;  5FLX b;  1WW9 A;  3FQM A;  4CL1 A;  2GTI A;  3J81 f;  5D1O B;  1YJW Z;  2Q4Z A;  1WCM I;  2R7Z I;  3CCJ 1;  2R92 I;  2QLV B;  1VQK Z;  2OTJ 1;  1JJ2 Z;  2QEX 1;  4A3B I;  4MD9 A;  4MON A;  2VUG A;  4RVH A;  1Q82 1;  2RT9 A;  1WJ2 A;  3CCV 1;  1QF8 A;  3HOU I;  1Q82 2;  3PO3 I;  4EWC A;  2W04 A;  2OTL 1;  4NFR A;  3S1N I;  3MON A;  1VQ4 1;  3HOW I;  3CXC Y;  3CCM Z;  1KC8 2;  2QRE B;  1K9M 1;  2P28 A;  2V8K A;  2RHB A;  1FDO A;  5D1O A;  2JUB A;  2YU9 I;  4NH1 C;  1Q7Y 2;  3CC4 1;  2JA6 I;  2OOX B;  1TFI A;  3CCQ 1;  2JS4 A;  1KD1 1;  3J80 b;  3S1Q I;  3H3V J;  2LFU A;  3G71 1;  4A3L I;  1X3W A;  2QA4 1;  2DE5 A;  2JMO A;  3CCR 1;  1Y1V S;  4MD8 A;  5IT9 b;  1RQF A;  1YIT Z;  1YI2 Z;  4BY1 I;  2F4M A;  2DE7 A;  3T4N B;  4A3K I;  3CME Z;  1VQN Z;  4NB8 A;  4Y52 I;  4A3G I;  2J6A A;  2WAQ A;  5T6B A;  1Q7Y 1;  1USP B;  3OW2 Z;  4A3J I;  4AYB A;  5IP9 I;  1VQ7 1;  4A3C I;  3I56 1;  3IR7 A;  3CCE Z;  1YIT 1;  1W2B Z;  1Z03 A;  2JIR A;  3CME 1;  2NVT I;  4NBC A;  1QYP A;  4Y7N I;  3J81 b;  2RBL A;  3PO2 I;  3CCU 1;  1QVF Y;  3CC7 1;  3I55 1;  3HOX I;  2V8J A;  4E2Y A;  5A2Q f;  4X6A I;  1VLA A;  5IT9 f;  1X0T A;  1S72 1;  3CCM 1;  1ML8 A;  1ZB9 A;  2IZ3 A;  2RPR A;  2F4O A;  1L1O C;  1QVF Z;  2W03 A;  1P9N A;  4A3M I;  1WZN A;  3I07 A;  1QVG Y;  5C3E I;  2E2I I;  2LIY A;  1QVG Z;  1R9T I;  4NBG A;  1WII A;  2M48 A;  4A3E I;  2Q51 A;  5LL6 f;  1S72 Z;  3GTM S;  2NVX I;  3S2D I;  4TNU A;  2VPZ A;  2E9H A;  3QWU A;  1JJ2 Y;  3Q87 A;  3NFZ A;  1RO4 A;  1Q86 1;  4E30 A;  2HU9 A;  4DGL A;  1QXF A;  5IP7 I;  3GKQ A;  2EGT A;  1RNI A;  2QA4 Z;  4RV9 A;  3VMG A;  2KPI A;  1YJ9 Z;  1W2B Y;  2I3C A;  1VQL 1;  4BXX I;  2VPX A;  2E2J I;  4DK1 A;  1YJN 1;  3D9X A;  4QTU A;  4S1T A;  4NBD A;  4HH4 A;  1NJI 1;  1YHQ 1;  3G6E 1;  3RZD I;  4MRI A;  4QTT A;  3IF8 A;  4A3I I;  2V3V A;  1VQ8 1;  3I56 Z;  4NOZ A;  2PM9 A;  4BBR I;  2JIP A;  4A93 I;  3GTL I;  3MZL B;  1TWA I;  3NH4 A;  1PFT A;  4NB9 A;  1M90 2;  3GTO I;  4RVG A;  3I4M I;  2VUM I;  1YJN Z;  1VQL Z;  4XX2 A;  2VF1 A;  3BG0 B;  1YHQ Z;  3H0G I;  4NBH A;  3IFU A;  3CCR Z;  2JA7 I;  2OZK A;  4NBB A;  1TWC I;  3LUS A;  1S7M A;  1VQP Z;  1N8R 2;  3D6W A;  3BG1 B;  1VQ9 Z;  3CC2 Z;  4HGZ A;  1LQL A;  3G71 Z;  1YUA A;  3NDI A;  1VQ8 Z;  1Q81 2;  5C4X I;  1N2F A;  2JIM A;  3GTG I;  2DE6 A;  2KI7 B;  1RLY A;  3F3F C;  1KQS Z;  3VB9 A;  1K83 I;  3CXC Z;  4RS4 A;  3EER A;  1VQN 1;  3S14 I;  1K73 1;  4NBF A;  2WB1 A;  4RVF A;  2H85 A;  3HKZ A;  2OOY B;  1M1K 1;  3G4S 1;  1SFO I;  5C4J I;  3S2H I;  1NP6 A;  2NVY I;  2ZAE B;  2JIO A;  1VQ7 Z;  3OW2 Y;  1YJ9 1;  1VQP 1;  2JIQ A;  1YI2 1;  3GTK I;  1VQ9 1;  2O4H A;  3F3P C;  2YAD A;  3VMH A;  1RO0 A;  1YJW 1;  3HOV I;  3M3Y I;  2JR6 A;  3CCJ Z;  1K9M 2;  1M90 1;  3J7A 4;  3CCS Z;  3CCL Z;  2JA5 I;  1M1K 2;  2QEX Z;  3I4N I;  4RVD A;  3EED A; 
#chains in the Genus database with same CATH homology
 3FQQ A;  2BJO A;  4BBS I;  3CCE 1;  4NBE A;  2QR1 B;  4MD7 A;  2AKL A;  1YUK A;  2IZ4 A;  4MH4 A;  4HGY A;  5A2Q b;  3MZK B;  3G4S Z;  1VQ4 Z;  4E31 A;  3KIF A;  1VQM Z;  2E2H I;  4DQY B;  2RIQ A;  3CD6 1;  2R93 I;  2OTL Z;  1Y1W I;  4E2X A;  3VTN A;  1I6H I;  3PO3 S;  3KIH A;  4E33 A;  1YIJ Z;  3CMA 1;  2P3Y A;  4NBA A;  3M4O I;  3RZO I;  3CCS 1;  3S1R I;  4E32 A;  4A3F I;  3CPW Y;  1VQM 1;  1ZH1 A;  1RO2 A;  1VQO Z;  3U50 C;  3JAM b;  2K5R A;  2QRC B;  1DL6 A;  2Y0S A;  5AN9 F;  3CCQ Z;  1Q81 1;  3CC2 1;  2R6M A;  1K8A 1;  1TWH I;  1VQ6 Z;  3S1M I;  3CMA Z;  1YIJ 1;  1I50 I;  1Y1V I;  3CCU Z;  5FLM I;  4E2Z A;  2K3R A;  1JWH C;  3GTQ I;  4MXU A;  5C44 I;  2GU2 A;  3GTP I;  2B63 I;  2OTJ Z;  3HOY I;  5T64 A;  3NH5 A;  3J80 f;  3CCV Z;  2QRD B;  1VQ5 1;  3CCL 1;  5T67 A;  1Q86 2;  2M6N A;  3K7A I;  3I55 Z;  3CC7 Z;  5D1P A;  3TE5 B;  3NH8 A;  3TDH B;  2JNY A;  1VQ6 1;  3CC4 Z;  3HOZ I;  1ZB8 A;  3S17 I;  2PK7 A;  3CQZ I;  3P5J B;  1N8R 1;  1VQ5 Z;  3S16 I;  1KD1 2;  1KRL A;  3FKI I;  3CD6 Z;  3JAM f;  1K8A 2;  3NDJ A;  5CM2 M;  2PMZ A;  2G2K A;  2HF1 A;  3ESW A;  1USP A;  1X3Z A;  3GTJ I;  1TWF I;  2GTH A;  2JA8 I;  2NVQ I;  1KC8 1;  3IX0 A;  1K73 2;  1TWG I;  5FLX f;  1NJI 2;  1Z01 A;  3GCF A;  3G6E Z;  1I3Q I;  1VQK 1;  2QKD A;  1NUI A;  1Z02 A;  2O53 A;  4A3D I;  2V8I A;  1VQO 1;  1KQS Y;  3VMI A;  3CPW Z;  3S15 I;  4BY7 I;  4E2W A;  3GTM I;  5FLX b;  1WW9 A;  3FQM A;  4CL1 A;  2GTI A;  3J81 f;  5D1O B;  1YJW Z;  2Q4Z A;  1WCM I;  2R7Z I;  3CCJ 1;  2R92 I;  2QLV B;  1VQK Z;  2OTJ 1;  1JJ2 Z;  2QEX 1;  4A3B I;  4MD9 A;  4MON A;  2VUG A;  4RVH A;  1Q82 1;  2RT9 A;  3CCV 1;  1QF8 A;  3HOU I;  1Q82 2;  3PO3 I;  4EWC A;  2W04 A;  2OTL 1;  4NFR A;  3S1N I;  3MON A;  1VQ4 1;  3HOW I;  3CXC Y;  3CCM Z;  1KC8 2;  2QRE B;  1K9M 1;  2P28 A;  2V8K A;  2RHB A;  5D1O A;  2JUB A;  2YU9 I;  4NH1 C;  1Q7Y 2;  3CC4 1;  2JA6 I;  2OOX B;  1TFI A;  3CCQ 1;  2JS4 A;  1KD1 1;  3J80 b;  3S1Q I;  3H3V J;  2LFU A;  3G71 1;  4A3L I;  1X3W A;  2QA4 1;  2DE5 A;  2JMO A;  3CCR 1;  1Y1V S;  4MD8 A;  5IT9 b;  1RQF A;  1YIT Z;  1YI2 Z;  4BY1 I;  2F4M A;  2DE7 A;  3T4N B;  4A3K I;  3CME Z;  1VQN Z;  4NB8 A;  4Y52 I;  4A3G I;  2J6A A;  2WAQ A;  5T6B A;  1Q7Y 1;  1USP B;  3OW2 Z;  4A3J I;  4AYB A;  5IP9 I;  1VQ7 1;  4A3C I;  3I56 1;  3CCE Z;  1YIT 1;  1W2B Z;  1Z03 A;  3CME 1;  2NVT I;  4NBC A;  1QYP A;  4Y7N I;  3J81 b;  2RBL A;  3PO2 I;  3CCU 1;  1QVF Y;  3CC7 1;  3I55 1;  3HOX I;  2V8J A;  4E2Y A;  5A2Q f;  4X6A I;  1VLA A;  5IT9 f;  1X0T A;  1S72 1;  3CCM 1;  1ML8 A;  1ZB9 A;  2IZ3 A;  2RPR A;  2F4O A;  1L1O C;  1QVF Z;  2W03 A;  1P9N A;  4A3M I;  3I07 A;  1QVG Y;  5C3E I;  2E2I I;  2LIY A;  1QVG Z;  1R9T I;  4NBG A;  1WII A;  2M48 A;  4A3E I;  2Q51 A;  5LL6 f;  1S72 Z;  3GTM S;  2NVX I;  3S2D I;  4TNU A;  2E9H A;  3QWU A;  1JJ2 Y;  3Q87 A;  3NFZ A;  1RO4 A;  1Q86 1;  4E30 A;  2HU9 A;  4DGL A;  5IP7 I;  3GKQ A;  2EGT A;  1RNI A;  2QA4 Z;  4RV9 A;  3VMG A;  2KPI A;  1YJ9 Z;  1W2B Y;  2I3C A;  1VQL 1;  4BXX I;  2E2J I;  4DK1 A;  1YJN 1;  3D9X A;  4QTU A;  4S1T A;  4NBD A;  4HH4 A;  1NJI 1;  1YHQ 1;  3G6E 1;  3RZD I;  4MRI A;  4QTT A;  3IF8 A;  4A3I I;  1VQ8 1;  3I56 Z;  4NOZ A;  2PM9 A;  4BBR I;  4A93 I;  3GTL I;  3MZL B;  1TWA I;  3NH4 A;  1PFT A;  4NB9 A;  1M90 2;  3GTO I;  4RVG A;  3I4M I;  2VUM I;  1YJN Z;  1VQL Z;  4XX2 A;  2VF1 A;  3BG0 B;  1YHQ Z;  3H0G I;  4NBH A;  3IFU A;  3CCR Z;  2JA7 I;  2OZK A;  4NBB A;  1TWC I;  3LUS A;  1S7M A;  1VQP Z;  1N8R 2;  3D6W A;  3BG1 B;  1VQ9 Z;  3CC2 Z;  4HGZ A;  1LQL A;  3G71 Z;  1YUA A;  3NDI A;  1VQ8 Z;  1Q81 2;  5C4X I;  1N2F A;  3GTG I;  2DE6 A;  2KI7 B;  1RLY A;  3F3F C;  1KQS Z;  3VB9 A;  1K83 I;  3CXC Z;  4RS4 A;  3EER A;  1VQN 1;  3S14 I;  1K73 1;  4NBF A;  2WB1 A;  4RVF A;  2H85 A;  3HKZ A;  2OOY B;  1M1K 1;  3G4S 1;  1SFO I;  5C4J I;  3S2H I;  1NP6 A;  2NVY I;  2ZAE B;  1VQ7 Z;  3OW2 Y;  1YJ9 1;  1VQP 1;  1YI2 1;  3GTK I;  1VQ9 1;  2O4H A;  3F3P C;  2YAD A;  3VMH A;  1RO0 A;  1YJW 1;  3HOV I;  3M3Y I;  2JR6 A;  3CCJ Z;  1K9M 2;  1M90 1;  3J7A 4;  3CCS Z;  3CCL Z;  2JA5 I;  1M1K 2;  2QEX Z;  3I4N I;  4RVD A;  3EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...