3I4NI

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
117
structure length
117
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3i4nI02
2JA5I 1TWAI 2HF1A 1RLYA 4Y7NI 3S14I 2E2JI 4NBEA 3FKII 4NBDA 4A3BI 3VMHA 2PK7A 1SFOI 2NVTI 1ZB8A 3PO3S 4A3DI 2R7ZI 4A3CI 2NVQI 1LQLA 1K83I 4QTTA 2JNYA 2P3YA 1I50I 2AKLA 3HOXI 1QYPA 5CM2M 2DE5A 4A3JI 3LUSA 3GTOI 3GTMS 2R92I 4NBBA 4NOZA 2BJOA 3D6WA 2JA8I 3VB9A 3GTJI 4NBHA 2F4OA 4BBRI 1X3WA 2JA6I 4NB8A 3S16I 3I4NI 1ZB9A 3RZOI 2NVXI 1WW9A 3HOUI 1TWFI 3S2DI 2DE6A 4QTUA 3GKQA 1Y1WI 3M4OI 3H0GI 4A3LI 1L1OC 3RZDI 1VLAA 2K5RA 3I07A 4MH4A 3VMGA 4NB9A 1PFTA 3S1MI 4BBSI 3Q87A 1USPB 3HOWI 4BY7I 3GTLI 2R93I 3U50C 1WCMI 3S17I 3GTKI 5C3EI 3CQZI 1I3QI 3PO3I 1RO4A 2JS4A 2B63I 3GTQI 3S1NI 3VMIA 4NBFA 1Y1VS 1R9TI 4XX2A 2E2II 3S15I 1DL6A 1Y1VI 1TWHI 2J6AA 3GTMI 3HOVI 3S1QI 1X3ZA 3HOZI 2NVYI 4X6AI 5FLMI 4NBCA 4NBAA 4A3FI 2E2HI 4BY1I 1YUAA 4A3GI 1TWCI 4A93I 1NUIA 5IP7I 1TFIA 2VUMI 4A3MI 5C44I 1TWGI 1I6HI 4Y52I 3GTPI 4NBGA 3HOYI 3GCFA 3PO2I 4A3II 5C4JI 3ESWA 5IP9I 3K7AI 2JA7I 4BXXI 4A3KI 1USPA 5C4XI 3EERA 2JR6A 3GTGI 3M3YI 3S2HI 3H3VJ 2DE7A 2RBLA 1N2FA 4A3EI 2F4MA 3S1RI 2KPIA 3I4MI 2YU9I 1ML8A
chains in the Genus database with same CATH superfamily
1Q862 4Y7NI 3G711 2E2JI 2Q51A 4NBDA 3VMHA 1ZB8A 5D1PA 2QKDA 3CMA1 2R7ZI 1Z02A 2GTIA 1VQ61 1LQLA 3JAMb 2QLVB 1YJN1 2JNYA 2GTHA 3NFZA 5CM2M 2QR1B 4NOZA 3CCVZ 1YHQZ 2BJOA 4NBHA 2IZ4A 1K9M2 4NFRA 2RT9A 2QA41 1FDOA 4NB8A 5T67A 3RZOI 2K3RA 3T4NB 4EWCA 4QTUA 3J81f 1K9M1 1KQSZ 2QRCB 1JJ2Z 2IV2X 1RO2A 4E2YA 3CCQ1 1Q16A 3S1MI 3Q87A 2R93I 1Q7Y1 3CCEZ 1WCMI 1S7MA 3MZLB 3CME1 1VQPZ 4RV9A 3TE5B 3G4SZ 1VQM1 1YJWZ 1VQ8Z 2LEXA 3CCE1 1TWHI 3GTMI 3CCQZ 1JJ2Y 5A2Qb 2R6MA 3CCM1 1VQLZ 1YUAA 4A3GI 1TWCI 2OTJZ 4A93I 1TFIA 1M1K2 1QXFA 2NAPA 1NP6A 2PM9A 4NBGA 5T64A 4E30A 5T6BA 3I56Z 4A3KI 1QVGY 1JWHC 3G6EZ 2HU9A 3FQQA 3EERA 3JAMf 2I3CA 2G2KA 1N2FA 2F4MA 1QVFZ 3J80f 1VQP1 3OW2Z 2AYDA 1TWAI 1RLYA 1KD12 1M901 1VQ41 4A3BI 5D1OA 1SFOI 3J7A4 3PO3S 1S721 4E33A 2NVQI 1KD11 1VQ81 1YJW1 2VF1A 4MD9A 3CCJ1 1VQOZ 4QTTA 1QVGZ 1QF8A 1AA6A 2YADA 3HOXI 1K8A1 1QYPA 3CCMZ 4HH4A 3FQMA 1K732 3GTOI 3MONA 2R92I 4E2WA 3CCLZ 1VQ5Z 2V45A 2JA8I 3VB9A 2F4OA 4BBRI 1VQMZ 1NJI2 3CD61 2H85A 2Q4ZA 2JMOA 3I551 1KC81 1VQN1 2JIRA 3GKQA 3BG1B 3H0GI 1VQ6Z 3CD6Z 4MH4A 3CCR1 1PFTA 1N8R2 1QVFY 5IT9b 4TNUA 3S17I 4NH1C 5AN9F 1RO0A 4HGYA 1RO4A 2JS4A 3NH8A 2B63I 3GTQI 3CC2Z 4RVGA 2V3VA 1Y1VS 2VPWA 3CCJZ 4DK1A 1VQO1 1Y1VI 3I561 2M6NA 2NVYI 1WZNA 1YIJZ 4NBCA 1YJ9Z 1VQ91 1YUKA 5FLXb 3G71Z 2VUMI 1ZH1A 1TWGI 3HOYI 3D9XA 2Y0SA 3CCS1 4A3II 1Q7Y2 4HGZA 3ESWA 1YI21 1USPA 5C4XI 3CPWY 3CC4Z 2JR6A 3CXCZ 3M3YI 3OW2Y 3P5JB 1Z03A 2OOYB 3CCRZ 2VUGA 1Q821 2RIQA 3QWUA 2HF1A 3IR7A 2QEXZ 4NBEA 2PK7A 4E2XA 2NVTI 3CC7Z 2VPXA 2EGTA 3F3PC 1Q822 4MD7A 1VQ4Z 3I55Z 2V8JA 2P3YA 2AKLA 1YJ91 2DE5A 4A3JI 4RVFA 3GTMS 3MZKB 3NDIA 4NBBA 4RVDA 3D6WA 3GTJI 2IZ3A 1X3WA 2JA6I 2JUBA 2QRDB 1ZB9A 2LFUA 1W2BY 3HOUI 1VQNZ 3S2DI 2WB1A 4E2ZA 1Y1WI 1W2BZ 4A3LI 2OTJ1 3RZDI 1VLAA 3I07A 4NB9A 4S1TA 4DQYB 3KIHA 1KQSY 2O4HA 1USPB 2O53A 3GTKI 3NH4A 1X0TA 2P28A 3CMEZ 3NH5A 4NBFA 3S15I 1VQ51 2J6AA 3HOVI 3S1QI 1VQL1 1X3ZA 3J80b 3HOZI 5FLMI 5IT9f 2VPYA 2E2HI 4BY1I 1NUIA 2VPZA 4A3MI 4RVHA 1I6HI 4Y52I 3GTPI 3F3FC 3GCFA 2OTLZ 2V8IA 3K7AI 2JA7I 2OZKA 1WIIA 3GTGI 4E31A 1YITZ 5D1OB 2RBLA 4A3EI 3CC21 1M902 3I4MI 3CCU1 2YU9I 2JA5I 1YIT1 4MD8A 3S14I 4E32A 1WJ2A 3FKII 4RS4A 2QREB 4A3DI 1Y8CA 4A3CI 3D2LA 1K83I 1K731 1VQKZ 1Q861 1I50I 3G4S1 2RPRA 2W04A 3LUSA 3CXCY 1NJI1 1KRLA 2V8KA 3CCV1 1YHQ1 1K8A2 1KC82 2E9HA 1YI2Z 2OTL1 3S16I 3I4NI 2PMZA 5LL6f 4MONA 2OOXB 2NVXI 1RNIA 3VTNA 1WW9A 1Z01A 2QEX1 2W03A 1TWFI 2E7ZA 1N8R1 2DE6A 3M4OI 3IFUA 1L1OC 3J81b 3NDJA 2K5RA 3VMGA 1M1K1 5FLXf 4DGLA 4BBSI 3HOWI 4BY7I 4CL1A 3GTLI 2RHBA 3KIFA 3EEDA 3U50C 4AYBA 3CCL1 4MRIA 5C3EI 2M48A 3CQZI 1SIWA 1I3QI 3PO3I 3CCSZ 3S1NI 2WAQA 1YJNZ 2JIMA 3VMIA 1R9TI 2E2II 2LIYA 4XX2A 3CC41 1VQ7Z 1FDIA 1VQK1 1DL6A 3BG0B 1VQ9Z 3CMAZ 1S72Z 4X6AI 1YIJ1 3CC71 4NBAA 4A3FI 2JIPA 2JIOA 3TDHB 5A2Qf 2JIQA 5IP7I 1Q811 3IF8A 1VQ71 5C44I 3CPWZ 3CCUZ 3IX0A 4MXUA 2QA4Z 3PO2I 5C4JI 5IP9I 1Q812 1P9NA 3HKZA 4BXXI 2KI7B 3G6E1 2ZAEB 3S2HI 2GU2A 3H3VJ 2DE7A 1RQFA 2KPIA 3S1RI 1ML8A
chains in the Genus database with same CATH topology
1Q862 4Y7NI 3G711 2E2JI 2Q51A 4NBDA 3VMHA 1ZB8A 5D1PA 2QKDA 3CMA1 2R7ZI 1Z02A 2GTIA 1VQ61 1LQLA 3JAMb 2QLVB 1YJN1 2JNYA 2GTHA 3NFZA 5CM2M 2QR1B 4NOZA 3CCVZ 1YHQZ 2BJOA 4NBHA 2IZ4A 1K9M2 4NFRA 2RT9A 2QA41 4NB8A 5T67A 3RZOI 2K3RA 3T4NB 4EWCA 4QTUA 3J81f 1K9M1 1KQSZ 2QRCB 1JJ2Z 1RO2A 4E2YA 3CCQ1 3S1MI 3Q87A 2R93I 1Q7Y1 3CCEZ 1WCMI 1S7MA 3MZLB 3CME1 1VQPZ 4RV9A 3TE5B 3G4SZ 1VQM1 1YJWZ 1VQ8Z 3CCE1 1TWHI 3GTMI 3CCQZ 1JJ2Y 5A2Qb 2R6MA 3CCM1 1VQLZ 1YUAA 4A3GI 1TWCI 2OTJZ 4A93I 1TFIA 1M1K2 1NP6A 2PM9A 4NBGA 5T64A 4E30A 5T6BA 3I56Z 4A3KI 1QVGY 1JWHC 3G6EZ 2HU9A 3FQQA 3EERA 3JAMf 2I3CA 2G2KA 1N2FA 2F4MA 1QVFZ 3J80f 1VQP1 3OW2Z 1TWAI 1RLYA 1KD12 1M901 1VQ41 4A3BI 5D1OA 1SFOI 3J7A4 3PO3S 1S721 4E33A 2NVQI 1KD11 1VQ81 1YJW1 2VF1A 4MD9A 3CCJ1 1VQOZ 4QTTA 1QVGZ 1QF8A 2YADA 3HOXI 1K8A1 1QYPA 3CCMZ 4HH4A 3FQMA 1K732 3GTOI 3MONA 2R92I 4E2WA 3CCLZ 1VQ5Z 2JA8I 3VB9A 2F4OA 4BBRI 1VQMZ 1NJI2 3CD61 2H85A 2Q4ZA 2JMOA 3I551 1KC81 1VQN1 3GKQA 3BG1B 3H0GI 1VQ6Z 3CD6Z 4MH4A 3CCR1 1PFTA 1N8R2 1QVFY 5IT9b 4TNUA 3S17I 4NH1C 1RO0A 5AN9F 4HGYA 1RO4A 2JS4A 3NH8A 2B63I 3GTQI 3CC2Z 4RVGA 1Y1VS 3CCJZ 4DK1A 1VQO1 1Y1VI 3I561 2M6NA 2NVYI 1YIJZ 4NBCA 1YJ9Z 1VQ91 1YUKA 5FLXb 3G71Z 2VUMI 1ZH1A 1TWGI 3HOYI 3D9XA 2Y0SA 3CCS1 4A3II 1Q7Y2 4HGZA 3ESWA 1YI21 1USPA 5C4XI 3CPWY 3CC4Z 2JR6A 3CXCZ 3M3YI 3OW2Y 3P5JB 1Z03A 2OOYB 3CCRZ 2VUGA 1Q821 2RIQA 3QWUA 2HF1A 2QEXZ 4NBEA 2PK7A 4E2XA 2NVTI 3CC7Z 2EGTA 3F3PC 1Q822 4MD7A 1VQ4Z 3I55Z 2V8JA 2P3YA 2AKLA 1YJ91 2DE5A 4A3JI 4RVFA 3GTMS 3MZKB 3NDIA 4NBBA 4RVDA 3D6WA 3GTJI 2IZ3A 1X3WA 2JA6I 2JUBA 2QRDB 1ZB9A 2LFUA 1W2BY 3HOUI 1VQNZ 3S2DI 2WB1A 4E2ZA 1Y1WI 1W2BZ 4A3LI 2OTJ1 3RZDI 1VLAA 3I07A 4NB9A 4S1TA 4DQYB 3KIHA 1KQSY 2O4HA 1USPB 2O53A 3GTKI 3NH4A 1X0TA 2P28A 3CMEZ 3NH5A 4NBFA 3S15I 1VQ51 2J6AA 3HOVI 3S1QI 1VQL1 1X3ZA 3J80b 3HOZI 5FLMI 5IT9f 2E2HI 4BY1I 1NUIA 4A3MI 4RVHA 1I6HI 4Y52I 3GTPI 3F3FC 3GCFA 2OTLZ 2V8IA 3K7AI 2JA7I 2OZKA 1WIIA 3GTGI 4E31A 1YITZ 5D1OB 2RBLA 4A3EI 3CC21 1M902 3I4MI 3CCU1 2YU9I 2JA5I 1YIT1 4MD8A 3S14I 4E32A 3FKII 4RS4A 2QREB 4A3DI 4A3CI 1K83I 1K731 1VQKZ 1Q861 1I50I 3G4S1 2RPRA 2W04A 3LUSA 3CXCY 1NJI1 1KRLA 2V8KA 3CCV1 1YHQ1 1K8A2 1KC82 2E9HA 1YI2Z 2OTL1 3S16I 3I4NI 2PMZA 5LL6f 4MONA 2OOXB 2NVXI 1RNIA 3VTNA 1WW9A 1Z01A 2W03A 2QEX1 1TWFI 1N8R1 2DE6A 3M4OI 3IFUA 1L1OC 3J81b 3NDJA 2K5RA 3VMGA 1M1K1 5FLXf 4DGLA 4BBSI 3HOWI 4BY7I 4CL1A 3GTLI 2RHBA 3KIFA 3EEDA 3U50C 4AYBA 3CCL1 4MRIA 5C3EI 2M48A 3CQZI 1I3QI 3PO3I 3CCSZ 3S1NI 2WAQA 1YJNZ 3VMIA 1R9TI 2E2II 2LIYA 4XX2A 3CC41 1VQ7Z 1VQK1 1DL6A 3BG0B 1VQ9Z 3CMAZ 1S72Z 4X6AI 1YIJ1 3CC71 4NBAA 4A3FI 3TDHB 5A2Qf 5IP7I 1Q811 3IF8A 1VQ71 5C44I 3CPWZ 3CCUZ 3IX0A 4MXUA 2QA4Z 3PO2I 5C4JI 5IP9I 1Q812 1P9NA 3HKZA 4BXXI 2KI7B 3G6E1 2ZAEB 3S2HI 2GU2A 3H3VJ 2DE7A 1RQFA 2KPIA 3S1RI 1ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 I;  1TWA I;  2HF1 A;  1RLY A;  4Y7N I;  3S14 I;  2E2J I;  4NBE A;  3FKI I;  4NBD A;  4A3B I;  3VMH A;  2PK7 A;  1SFO I;  2NVT I;  1ZB8 A;  3PO3 S;  4A3D I;  2R7Z I;  4A3C I;  2NVQ I;  1LQL A;  1K83 I;  4QTT A;  2JNY A;  2P3Y A;  1I50 I;  2AKL A;  3HOX I;  1QYP A;  5CM2 M;  2DE5 A;  4A3J I;  3LUS A;  3GTO I;  3GTM S;  2R92 I;  4NBB A;  4NOZ A;  2BJO A;  3D6W A;  2JA8 I;  3VB9 A;  3GTJ I;  4NBH A;  2F4O A;  4BBR I;  1X3W A;  2JA6 I;  4NB8 A;  3S16 I;  3I4N I;  1ZB9 A;  3RZO I;  2NVX I;  1WW9 A;  3HOU I;  1TWF I;  3S2D I;  2DE6 A;  4QTU A;  3GKQ A;  1Y1W I;  3M4O I;  3H0G I;  4A3L I;  1L1O C;  3RZD I;  1VLA A;  2K5R A;  3I07 A;  4MH4 A;  3VMG A;  4NB9 A;  1PFT A;  3S1M I;  4BBS I;  3Q87 A;  1USP B;  3HOW I;  4BY7 I;  3GTL I;  2R93 I;  3U50 C;  1WCM I;  3S17 I;  3GTK I;  5C3E I;  3CQZ I;  1I3Q I;  3PO3 I;  1RO4 A;  2JS4 A;  2B63 I;  3GTQ I;  3S1N I;  3VMI A;  4NBF A;  1Y1V S;  1R9T I;  4XX2 A;  2E2I I;  3S15 I;  1DL6 A;  1Y1V I;  1TWH I;  2J6A A;  3GTM I;  3HOV I;  3S1Q I;  1X3Z A;  3HOZ I;  2NVY I;  4X6A I;  5FLM I;  4NBC A;  4NBA A;  4A3F I;  2E2H I;  4BY1 I;  1YUA A;  4A3G I;  1TWC I;  4A93 I;  1NUI A;  5IP7 I;  1TFI A;  2VUM I;  4A3M I;  5C44 I;  1TWG I;  1I6H I;  4Y52 I;  3GTP I;  4NBG A;  3HOY I;  3GCF A;  3PO2 I;  4A3I I;  5C4J I;  3ESW A;  5IP9 I;  3K7A I;  2JA7 I;  4BXX I;  4A3K I;  1USP A;  5C4X I;  3EER A;  2JR6 A;  3GTG I;  3M3Y I;  3S2H I;  3H3V J;  2DE7 A;  2RBL A;  1N2F A;  4A3E I;  2F4M A;  3S1R I;  2KPI A;  3I4M I;  2YU9 I;  1ML8 A; 
#chains in the Genus database with same CATH topology
 1Q86 2;  4Y7N I;  3G71 1;  2E2J I;  2Q51 A;  4NBD A;  3VMH A;  1ZB8 A;  5D1P A;  2QKD A;  3CMA 1;  2R7Z I;  1Z02 A;  2GTI A;  1VQ6 1;  1LQL A;  3JAM b;  2QLV B;  1YJN 1;  2JNY A;  2GTH A;  3NFZ A;  5CM2 M;  2QR1 B;  4NOZ A;  3CCV Z;  1YHQ Z;  2BJO A;  4NBH A;  2IZ4 A;  1K9M 2;  4NFR A;  2RT9 A;  2QA4 1;  1FDO A;  4NB8 A;  5T67 A;  3RZO I;  2K3R A;  3T4N B;  4EWC A;  4QTU A;  3J81 f;  1K9M 1;  1KQS Z;  2QRC B;  1JJ2 Z;  2IV2 X;  1RO2 A;  4E2Y A;  3CCQ 1;  1Q16 A;  3S1M I;  3Q87 A;  2R93 I;  1Q7Y 1;  3CCE Z;  1WCM I;  1S7M A;  3MZL B;  3CME 1;  1VQP Z;  4RV9 A;  3TE5 B;  3G4S Z;  1VQM 1;  1YJW Z;  1VQ8 Z;  2LEX A;  3CCE 1;  1TWH I;  3GTM I;  3CCQ Z;  1JJ2 Y;  5A2Q b;  2R6M A;  3CCM 1;  1VQL Z;  1YUA A;  4A3G I;  1TWC I;  2OTJ Z;  4A93 I;  1TFI A;  1M1K 2;  1QXF A;  2NAP A;  1NP6 A;  2PM9 A;  4NBG A;  5T64 A;  4E30 A;  5T6B A;  3I56 Z;  4A3K I;  1QVG Y;  1JWH C;  3G6E Z;  2HU9 A;  3FQQ A;  3EER A;  3JAM f;  2I3C A;  2G2K A;  1N2F A;  2F4M A;  1QVF Z;  3J80 f;  1VQP 1;  3OW2 Z;  2AYD A;  1TWA I;  1RLY A;  1KD1 2;  1M90 1;  1VQ4 1;  4A3B I;  5D1O A;  1SFO I;  3J7A 4;  3PO3 S;  1S72 1;  4E33 A;  2NVQ I;  1KD1 1;  1VQ8 1;  1YJW 1;  2VF1 A;  4MD9 A;  3CCJ 1;  1VQO Z;  4QTT A;  1QVG Z;  1QF8 A;  1AA6 A;  2YAD A;  3HOX I;  1K8A 1;  1QYP A;  3CCM Z;  4HH4 A;  3FQM A;  1K73 2;  3GTO I;  3MON A;  2R92 I;  4E2W A;  3CCL Z;  1VQ5 Z;  2V45 A;  2JA8 I;  3VB9 A;  2F4O A;  4BBR I;  1VQM Z;  1NJI 2;  3CD6 1;  2H85 A;  2Q4Z A;  2JMO A;  3I55 1;  1KC8 1;  1VQN 1;  2JIR A;  3GKQ A;  3BG1 B;  3H0G I;  1VQ6 Z;  3CD6 Z;  4MH4 A;  3CCR 1;  1PFT A;  1N8R 2;  1QVF Y;  5IT9 b;  4TNU A;  3S17 I;  4NH1 C;  5AN9 F;  1RO0 A;  4HGY A;  1RO4 A;  2JS4 A;  3NH8 A;  2B63 I;  3GTQ I;  3CC2 Z;  4RVG A;  2V3V A;  1Y1V S;  2VPW A;  3CCJ Z;  4DK1 A;  1VQO 1;  1Y1V I;  3I56 1;  2M6N A;  2NVY I;  1WZN A;  1YIJ Z;  4NBC A;  1YJ9 Z;  1VQ9 1;  1YUK A;  5FLX b;  3G71 Z;  2VUM I;  1ZH1 A;  1TWG I;  3HOY I;  3D9X A;  2Y0S A;  3CCS 1;  4A3I I;  1Q7Y 2;  4HGZ A;  3ESW A;  1YI2 1;  1USP A;  5C4X I;  3CPW Y;  3CC4 Z;  2JR6 A;  3CXC Z;  3M3Y I;  3OW2 Y;  3P5J B;  1Z03 A;  2OOY B;  3CCR Z;  2VUG A;  1Q82 1;  2RIQ A;  3QWU A;  2HF1 A;  3IR7 A;  2QEX Z;  4NBE A;  2PK7 A;  4E2X A;  2NVT I;  3CC7 Z;  2VPX A;  2EGT A;  3F3P C;  1Q82 2;  4MD7 A;  1VQ4 Z;  3I55 Z;  2V8J A;  2P3Y A;  2AKL A;  1YJ9 1;  2DE5 A;  4A3J I;  4RVF A;  3GTM S;  3MZK B;  3NDI A;  4NBB A;  4RVD A;  3D6W A;  3GTJ I;  2IZ3 A;  1X3W A;  2JA6 I;  2JUB A;  2QRD B;  1ZB9 A;  2LFU A;  1W2B Y;  3HOU I;  1VQN Z;  3S2D I;  2WB1 A;  4E2Z A;  1Y1W I;  1W2B Z;  4A3L I;  2OTJ 1;  3RZD I;  1VLA A;  3I07 A;  4NB9 A;  4S1T A;  4DQY B;  3KIH A;  1KQS Y;  2O4H A;  1USP B;  2O53 A;  3GTK I;  3NH4 A;  1X0T A;  2P28 A;  3CME Z;  3NH5 A;  4NBF A;  3S15 I;  1VQ5 1;  2J6A A;  3HOV I;  3S1Q I;  1VQL 1;  1X3Z A;  3J80 b;  3HOZ I;  5FLM I;  5IT9 f;  2VPY A;  2E2H I;  4BY1 I;  1NUI A;  2VPZ A;  4A3M I;  4RVH A;  1I6H I;  4Y52 I;  3GTP I;  3F3F C;  3GCF A;  2OTL Z;  2V8I A;  3K7A I;  2JA7 I;  2OZK A;  1WII A;  3GTG I;  4E31 A;  1YIT Z;  5D1O B;  2RBL A;  4A3E I;  3CC2 1;  1M90 2;  3I4M I;  3CCU 1;  2YU9 I;  2JA5 I;  1YIT 1;  4MD8 A;  3S14 I;  4E32 A;  1WJ2 A;  3FKI I;  4RS4 A;  2QRE B;  4A3D I;  1Y8C A;  4A3C I;  3D2L A;  1K83 I;  1K73 1;  1VQK Z;  1Q86 1;  1I50 I;  3G4S 1;  2RPR A;  2W04 A;  3LUS A;  3CXC Y;  1NJI 1;  1KRL A;  2V8K A;  3CCV 1;  1YHQ 1;  1K8A 2;  1KC8 2;  2E9H A;  1YI2 Z;  2OTL 1;  3S16 I;  3I4N I;  2PMZ A;  5LL6 f;  4MON A;  2OOX B;  2NVX I;  1RNI A;  3VTN A;  1WW9 A;  1Z01 A;  2QEX 1;  2W03 A;  1TWF I;  2E7Z A;  1N8R 1;  2DE6 A;  3M4O I;  3IFU A;  1L1O C;  3J81 b;  3NDJ A;  2K5R A;  3VMG A;  1M1K 1;  5FLX f;  4DGL A;  4BBS I;  3HOW I;  4BY7 I;  4CL1 A;  3GTL I;  2RHB A;  3KIF A;  3EED A;  3U50 C;  4AYB A;  3CCL 1;  4MRI A;  5C3E I;  2M48 A;  3CQZ I;  1SIW A;  1I3Q I;  3PO3 I;  3CCS Z;  3S1N I;  2WAQ A;  1YJN Z;  2JIM A;  3VMI A;  1R9T I;  2E2I I;  2LIY A;  4XX2 A;  3CC4 1;  1VQ7 Z;  1FDI A;  1VQK 1;  1DL6 A;  3BG0 B;  1VQ9 Z;  3CMA Z;  1S72 Z;  4X6A I;  1YIJ 1;  3CC7 1;  4NBA A;  4A3F I;  2JIP A;  2JIO A;  3TDH B;  5A2Q f;  2JIQ A;  5IP7 I;  1Q81 1;  3IF8 A;  1VQ7 1;  5C44 I;  3CPW Z;  3CCU Z;  3IX0 A;  4MXU A;  2QA4 Z;  3PO2 I;  5C4J I;  5IP9 I;  1Q81 2;  1P9N A;  3HKZ A;  4BXX I;  2KI7 B;  3G6E 1;  2ZAE B;  3S2H I;  2GU2 A;  3H3V J;  2DE7 A;  1RQF A;  2KPI A;  3S1R I;  1ML8 A; 
#chains in the Genus database with same CATH homology
 1Q86 2;  4Y7N I;  3G71 1;  2E2J I;  2Q51 A;  4NBD A;  3VMH A;  1ZB8 A;  5D1P A;  2QKD A;  3CMA 1;  2R7Z I;  1Z02 A;  2GTI A;  1VQ6 1;  1LQL A;  3JAM b;  2QLV B;  1YJN 1;  2JNY A;  2GTH A;  3NFZ A;  5CM2 M;  2QR1 B;  4NOZ A;  3CCV Z;  1YHQ Z;  2BJO A;  4NBH A;  2IZ4 A;  1K9M 2;  4NFR A;  2RT9 A;  2QA4 1;  4NB8 A;  5T67 A;  3RZO I;  2K3R A;  3T4N B;  4EWC A;  4QTU A;  3J81 f;  1K9M 1;  1KQS Z;  2QRC B;  1JJ2 Z;  1RO2 A;  4E2Y A;  3CCQ 1;  3S1M I;  3Q87 A;  2R93 I;  1Q7Y 1;  3CCE Z;  1WCM I;  1S7M A;  3MZL B;  3CME 1;  1VQP Z;  4RV9 A;  3TE5 B;  3G4S Z;  1VQM 1;  1YJW Z;  1VQ8 Z;  3CCE 1;  1TWH I;  3GTM I;  3CCQ Z;  1JJ2 Y;  5A2Q b;  2R6M A;  3CCM 1;  1VQL Z;  1YUA A;  4A3G I;  1TWC I;  2OTJ Z;  4A93 I;  1TFI A;  1M1K 2;  1NP6 A;  2PM9 A;  4NBG A;  5T64 A;  4E30 A;  5T6B A;  3I56 Z;  4A3K I;  1QVG Y;  1JWH C;  3G6E Z;  2HU9 A;  3FQQ A;  3EER A;  3JAM f;  2I3C A;  2G2K A;  1N2F A;  2F4M A;  1QVF Z;  3J80 f;  1VQP 1;  3OW2 Z;  1TWA I;  1RLY A;  1KD1 2;  1M90 1;  1VQ4 1;  4A3B I;  5D1O A;  1SFO I;  3J7A 4;  3PO3 S;  1S72 1;  4E33 A;  2NVQ I;  1KD1 1;  1VQ8 1;  1YJW 1;  2VF1 A;  4MD9 A;  3CCJ 1;  1VQO Z;  4QTT A;  1QVG Z;  1QF8 A;  2YAD A;  3HOX I;  1K8A 1;  1QYP A;  3CCM Z;  4HH4 A;  3FQM A;  1K73 2;  3GTO I;  3MON A;  2R92 I;  4E2W A;  3CCL Z;  1VQ5 Z;  2JA8 I;  3VB9 A;  2F4O A;  4BBR I;  1VQM Z;  1NJI 2;  3CD6 1;  2H85 A;  2Q4Z A;  2JMO A;  3I55 1;  1KC8 1;  1VQN 1;  3GKQ A;  3BG1 B;  3H0G I;  1VQ6 Z;  3CD6 Z;  4MH4 A;  3CCR 1;  1PFT A;  1N8R 2;  1QVF Y;  5IT9 b;  4TNU A;  3S17 I;  4NH1 C;  1RO0 A;  5AN9 F;  4HGY A;  1RO4 A;  2JS4 A;  3NH8 A;  2B63 I;  3GTQ I;  3CC2 Z;  4RVG A;  1Y1V S;  3CCJ Z;  4DK1 A;  1VQO 1;  1Y1V I;  3I56 1;  2M6N A;  2NVY I;  1YIJ Z;  4NBC A;  1YJ9 Z;  1VQ9 1;  1YUK A;  5FLX b;  3G71 Z;  2VUM I;  1ZH1 A;  1TWG I;  3HOY I;  3D9X A;  2Y0S A;  3CCS 1;  4A3I I;  1Q7Y 2;  4HGZ A;  3ESW A;  1YI2 1;  1USP A;  5C4X I;  3CPW Y;  3CC4 Z;  2JR6 A;  3CXC Z;  3M3Y I;  3OW2 Y;  3P5J B;  1Z03 A;  2OOY B;  3CCR Z;  2VUG A;  1Q82 1;  2RIQ A;  3QWU A;  2HF1 A;  2QEX Z;  4NBE A;  2PK7 A;  4E2X A;  2NVT I;  3CC7 Z;  2EGT A;  3F3P C;  1Q82 2;  4MD7 A;  1VQ4 Z;  3I55 Z;  2V8J A;  2P3Y A;  2AKL A;  1YJ9 1;  2DE5 A;  4A3J I;  4RVF A;  3GTM S;  3MZK B;  3NDI A;  4NBB A;  4RVD A;  3D6W A;  3GTJ I;  2IZ3 A;  1X3W A;  2JA6 I;  2JUB A;  2QRD B;  1ZB9 A;  2LFU A;  1W2B Y;  3HOU I;  1VQN Z;  3S2D I;  2WB1 A;  4E2Z A;  1Y1W I;  1W2B Z;  4A3L I;  2OTJ 1;  3RZD I;  1VLA A;  3I07 A;  4NB9 A;  4S1T A;  4DQY B;  3KIH A;  1KQS Y;  2O4H A;  1USP B;  2O53 A;  3GTK I;  3NH4 A;  1X0T A;  2P28 A;  3CME Z;  3NH5 A;  4NBF A;  3S15 I;  1VQ5 1;  2J6A A;  3HOV I;  3S1Q I;  1VQL 1;  1X3Z A;  3J80 b;  3HOZ I;  5FLM I;  5IT9 f;  2E2H I;  4BY1 I;  1NUI A;  4A3M I;  4RVH A;  1I6H I;  4Y52 I;  3GTP I;  3F3F C;  3GCF A;  2OTL Z;  2V8I A;  3K7A I;  2JA7 I;  2OZK A;  1WII A;  3GTG I;  4E31 A;  1YIT Z;  5D1O B;  2RBL A;  4A3E I;  3CC2 1;  1M90 2;  3I4M I;  3CCU 1;  2YU9 I;  2JA5 I;  1YIT 1;  4MD8 A;  3S14 I;  4E32 A;  3FKI I;  4RS4 A;  2QRE B;  4A3D I;  4A3C I;  1K83 I;  1K73 1;  1VQK Z;  1Q86 1;  1I50 I;  3G4S 1;  2RPR A;  2W04 A;  3LUS A;  3CXC Y;  1NJI 1;  1KRL A;  2V8K A;  3CCV 1;  1YHQ 1;  1K8A 2;  1KC8 2;  2E9H A;  1YI2 Z;  2OTL 1;  3S16 I;  3I4N I;  2PMZ A;  5LL6 f;  4MON A;  2OOX B;  2NVX I;  1RNI A;  3VTN A;  1WW9 A;  1Z01 A;  2W03 A;  2QEX 1;  1TWF I;  1N8R 1;  2DE6 A;  3M4O I;  3IFU A;  1L1O C;  3J81 b;  3NDJ A;  2K5R A;  3VMG A;  1M1K 1;  5FLX f;  4DGL A;  4BBS I;  3HOW I;  4BY7 I;  4CL1 A;  3GTL I;  2RHB A;  3KIF A;  3EED A;  3U50 C;  4AYB A;  3CCL 1;  4MRI A;  5C3E I;  2M48 A;  3CQZ I;  1I3Q I;  3PO3 I;  3CCS Z;  3S1N I;  2WAQ A;  1YJN Z;  3VMI A;  1R9T I;  2E2I I;  2LIY A;  4XX2 A;  3CC4 1;  1VQ7 Z;  1VQK 1;  1DL6 A;  3BG0 B;  1VQ9 Z;  3CMA Z;  1S72 Z;  4X6A I;  1YIJ 1;  3CC7 1;  4NBA A;  4A3F I;  3TDH B;  5A2Q f;  5IP7 I;  1Q81 1;  3IF8 A;  1VQ7 1;  5C44 I;  3CPW Z;  3CCU Z;  3IX0 A;  4MXU A;  2QA4 Z;  3PO2 I;  5C4J I;  5IP9 I;  1Q81 2;  1P9N A;  3HKZ A;  4BXX I;  2KI7 B;  3G6E 1;  2ZAE B;  3S2H I;  2GU2 A;  3H3V J;  2DE7 A;  1RQF A;  2KPI A;  3S1R I;  1ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...