3I77A

35/99/170-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
230
structure length
230
Chain Sequence
b'VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYPDTGGVDTCQGDSGGPMFRKDNADEWIQVGIVSWGYGCARPGYPGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 56
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i77A02
3RU4D 4AGJA 4BXWA 3SV7A 1G32B 2C90B 4GSOA 3MO3A 1C1MA 1DLKB 1DICA 1TYNA 1P02A 1D3TB 2BHGA 3T5FH 3S9CA 1VGCB 1Y5BT 1GI8B 1T8LA 1HAIH 4NGAH 3PM3A 1FN8A 5K0HA 3OYPA 3BEUA 1O3OA 2ODPA 5L30H 1MTSA 1NY22 3A7WA 1QNJA 2GD4B 1QGFA 1O0DH 4QT8C 2ALPA 2C8YB 2ZIQH 2Z9JA 1XXFA 1Z8JB 3M3SA 2LNCA 1HAGE 3MH5A 3T29A 1BTHH 2Y81A 2PTNA 2C8ZB 4DT7B 2A5KA 1UTKA 4FUGA 4FUEA 3ZZAA 1C1PA 4AYYB 3ODDA 1HCGA 2GCHG 4WXVA 1H8IH 2GTBA 3M3VA 1KDQB 2THFB 2EA3A 3GYLB 1A5GH 1W3CA 1AD8H 3VPKA 2WPJS 1HAOH 1QBVH 1PPEE 1DWDH 1O3EA 5FAHA 1PPZA 1UCYK 4YOJA 2AMQA 3TVJB 2FOHA 5C5OA 1V2TT 5LPRA 1PPHE 3L33A 3MWIU 3HK6B 1VITG 4BANB 1HNEE 2Z9IA 1JOUB 1LVMA 3M36A 4JZFH 4UFGH 4XE4A 1LCYA 1RIWC 5A8XA 1S5SA 4PROA 3RMLH 1TAWA 1L4ZA 3RXLA 3BTKE 1JIRA 4K8YA 1SGFG 5G4BA 4WJG2 4NG9H 1UHBB 2QCYA 1DUAA 1GMCF 1C1QA 1UTOA 1CBWB 2WPHS 2ZP0H 3RXOA 4O97A 1T31A 2A1DB 2EI7A 4TPYA 1O2NA 1DX5M 2OC0A 1SB1H 5EXLA 2YNAA 2G5VA 1BRCE 1GJ7B 2BZAA 1P3EA 2BVSH 1FY1A 2A32A 4A6LA 2G4TA 4BAOB 3DT0H 4ABBA 1QBOA 3SUEA 3U1JB 2V35A 3RXMA 1C2HA 2BMGB 3S9AA 1SGDE 2CMYA 3F9GA 1CE5A 3GY5A 1SGCA 5T6FA 2AIPA 2H5DA 3K6ZA 1NT1A 1MKWK 1TNHA 1YBWA 1G30B 1N6XA 1U6QA 2TGDA 3SV8A 2GP9B 1GHBG 5IDKA 1O3KA 1FQ3A 2YNBA 3F9HA 1ELGA 1LHCH 2D1JA 2SGAA 3SU4A 2WUBA 3ITIA 1FY3A 2BM2A 4Q2KA 1WBGB 3TGKE 2WPMS 3MU8A 1BRAA 1QBNA 1HAYB 1SBWA 2G8TA 3M7UA 1O37A 5EODA 1AFEH 5FHTA 1ID5H 2F9VA 1SGQE 3QZRA 2Z3CA 3A8DA 1K2I1 4GPGA 5DP8A 2A5AA 4CH2B 2C8WB 2PGQB 4KTSA 2BD7A 3RXFA 1GHXH 1S6FA 3RXDA 8KME2 3I77A 2OC1A 1GJDB 2A45B 1EOLA 1C5RA 1BB0B 4A7IB 3MNCA 3BIUH 2ALVA 1CA8B 1O3JA 3A7VA 3GCTG 1QJ6B 2QAAA 5FBIA 2FLBH 3ZV9A 1O2VA 1MH0A 2F9NA 1KIGH 2H2ZA 3PLBA 1GHZA 1IHTH 3CENA 5GDSH 4NCYA 5LPEA 2OC8A 1C1RA 2IPHA 2Q6DA 2CHAC 1SHYA 1H1BA 2OTVA 3OU0A 1BHXF 4DG4A 3UQOA 1DM4B 1F2SE 1F0TA 1O5DH 2ZQ2A 2PV9B 3ZVFA 1IQJA 3M7QA 2ZCKP 1BA8B 1HXFH 4ABHA 4O3TA 1KSNA 1TMBH 1NU9A 2O8UA 1TA6A 3QZQA 1E0FD 2DE9A 2R0KA 1O5GH 3SV2H 5DG6A 3GCHB 5I25A 1HPGA 4ISOA 3U8RH 1HAVA 1LVYA 2ZU1A 1P11E 3KQEA 1EAIA 1L1GA 2C93B 3SUFA 5A2MH 1O38A 2BTCE 3OY5U 5I46H 2BLWA 1GBBA 4I8LA 4TY7A 2UUYA 5DP7A 2GMTC 4BAQB 3M37A 4K2YA 1HB0B 3RMMH 3A8BA 5F8TA 2Q6FA 2VU8E 1S6HA 3QDZB 1TE0A 1DPOA 4FUBA 2NU4E 2BD3A 3LDXH 1MD8A 3STIA 1DVAH 2ZKSA 2OBOA 2M5TA 1EAUA 1OXGA 1ZJKA 1XUKA 2NWNA 3PMJA 4AN7A 3A82A 2QXJA 1NRNH 4MG3A 3SJKA 1PQ5A 5DGJA 3QWCH 3ZZ5A 1DXWA 4ZHLU 1O3IA 1GMHG 1LQDB 3SU5A 2ZHEH 1N8OB 2J34A 3Q76A 2SGPE 3EA9A 3ZZBA 4E7RG 1OSSA 4JYUH 4DURA 1WTGH 4F4OC 2B8OH 4FUDA 1CHGA 3F1SB 1A46H 2F9BH 1P2IA 1BOQA 3HKIB 1W0YH 2FMJA 1P03A 3SJOA 1MTWA 1HDTH 1AZZA 2BDCA 2AS9A 3S9BA 4ZXXH 1LQEA 4XSKU 2JKHA 2BQ6B 1P05A 5A8YA 1WSSH 4WWYA 5EOKA 3LGVA 4AYVB 4Y0ZE 3E3TA 1LTOA 1W7XH 3S0NA 1OWDA 1O31A 3IG6B 4I33A 3RLYH 1C1VH 1TGTA 1GL0E 2BDGA 2OP9A 2IJOB 4JZDH 1CBWC 1ZYOA 3MHWU 4AORA 1AGJA 1NFUA 4FXGH 2BVXH 1P2NA 2ANKH 4X1SU 1EZSC 2BY9X 3LKWA 3V7TA 3UOUA 2I6QA 3QK1A 1ZRBA 2AGIX 1HAHH 4NIXA 5GPIB 1W2KH 1GI6A 5F8XA 2P3TB 3SN8A 5GCHF 1EZQA 3FAOA 3RXVA 2PLXA 1SLVB 2PFEA 2XWAA 4UONA 1HJ9A 3ZZ6A 4ISNA 1YPKH 1F0RA 1MTVA 2VIOA 2BY8X 2GVFA 1C5TA 2B9LA 4IN2A 3B9FH 3HKJB 3SNBA 4MLFB 4BNRA 8ESTE 3P17H 1O35A 4K1SA 3RXAA 5L2YH 4ISHH 1BJUA 2FEQH 1VITH 2ZQ1A 1V2ST 3SJIA 1UVOA 3P70B 1BRUP 1O3DA 1UK4A 4MTBA 3GCNA 1DSTA 2FOBA 3ATIA 1ACBE 3V13A 6GCHF 3MNBA 3HGNA 5LPFA 2ODQA 1P12E 3W95A 1GBJA 1C1WH 1KXEA 5T6GA 2STAE 1A5HA 1BTUA 2SNVA 1CU1A 2UUJB 3QTOH 3OTJE 1P0SH 1QB1A 3A89A 3ZVBA 1NRRH 3G01A 1GI1A 1EAWA 2VJ1A 3DFLA 4LZ4B 1NS3A 2Y80A 1GGDC 1HAVB 1NC6A 1G37A 3AAVA 1W10U 2J95A 2HNTC 2W3KA 3F68H 3UPEA 1SSXA 2ZU3A 3RXGA 1LPGB 1UCYE 1TMUH 4AOQA 4MDSA 1FAXA 1FJSA 3N7OA 1WYKA 4JCNA 3V3MA 3V0XA 2FTLE 1UCYH 3Q3YA 1C5QA 4X8TH 1YLDA 1B0FA 4X8VH 3E90B 4I8HA 1AN1E 5GXPA 5L6NH 4K3JA 1IQHA 4GCHF 3A7XA 2FOMB 4O03A 1Y8TA 4FUJA 4BAMB 1ESAA 1TRMA 3P6ZB 4DIHH 3MNXA 1GI2A 1C1OA 4KELA 2ZHWH 3BTWE 1SMFE 4FUFA 1UMAH 2PHBA 4WMDA 4Z6AH 3Q3XA 2RA0A 2ZFPH 1BJVA 2GZ9A 1ANBA 1THPB 2V3HH 2HNTE 5B6OA 1CA0C 4INLA 4HTCH 3MMGA 1UK2A 2V6NA 1LHGH 3ZVGA 4B73A 5E8EH 1TRYA 4NSVA 5A8ZA 1Y3XA 3BG8A 2VH0A 3PB1E 1LHDH 1VCQA 2CF9H 3UY9A 1TGCA 1XUFA 1O3AA 2VWLA 1D3PB 1WCZA 3QTVH 1LKAA 1AVGH 2R2MB 4D8NA 1Y5UT 4WH6A 4HZHA 4WH8A 5T3HA 5HXFA 3RU4E 2GCHF 4NIWA 4Y0YE 1BTWA 1MKWH 1ABJH 1M9UA 1S0RA 3SUGA 2ZCHP 3LONA 1W13U 1EKBB 1KLJH 3C1KA 1C5MD 2GV7A 2PKAA 4NSYA 1NO9H 1QRWA 2A4QA 3GDVA 2PW8H 2RDLA 3R0FA 3UNQA 1THSH 1KY9A 1J8AA 1VITF 7KMEH 1ANCA 2GX4A 3RXCA 4MPUA 2ZF0H 2O8MA 1A4WH 4AX9H 2FI3E 5DP4A 4K1TA 2GCTC 2QF0A 3SBKA 1ZTLA 3SGQE 4J2YB 2QXIA 1F5RA 4OGYA 3MU1A 1IQNA 1IHSH 1B5GH 3SNCA 1WOFA 1JMOH 1CT4E 2AMDA 3A86A 1BBRK 1HFDA 4ZHMU 1ZSKA 3P92A 4NZQA 1ZHRA 2PUXB 3QN7A 2HPQH 1PQ7A 1XKBC 3MH4A 1O2MA 2O8LA 1L1NA 3NKKA 1P3CA 3U1IB 4FU9A 1EPTB 1AHTH 4IMQA 1OP8A 3BV9B 1SVPA 3RXRA 3TGIE 3BTTE 3URDA 5F8ZA 1BTPA 5T6DA 2ANMH 1OX1A 1BDAA 1SQTA 1ZSLA 2QXHA 2ZGBH 4X6NA 3SHCH 5DP9A 1UTJA 1LVBA 2UWOA 1E34B 2A2QH 3UQVA 4UE7H 3SI4H 3E6PH 1V2RT 2ZHFH 4ABFA 2WV4A 3FFGA 1O2KA 2ZO3H 1MAYA 1SGIB 1C5YB 4DW2U 1XVOA 2G52A 1GMDG 1P2MA 2R2WU 4CR5A 4LZ1H 1AMHA 2Y7XA 3FVFB 4MPXA 1DY8A 1F5KU 4O3UA 5DJ7A 1O36A 3A7TA 5EG4A 1GI7B 1Z1JA 3SNEA 3C27B 1ZPCA 4JMYA 3ATLA 4AG2A 1DFPA 1ANDA 3U8OH 5FXLA 4BTTB 1DITH 4VGCC 1T8MA 2CGAA 1C9TA 2ZU5A 4FU7A 1QL8A 2ZGHA 3RXPA 3NPSA 5JBAS 3UREA 1MD7A 1TFXA 3U9AH 1EB2A 1T8OA 1LVOA 4D7GA 1UVPA 1A0LA 1Z1IA 2HNTF 3I78A 3O8DA 3VXEH 3PLPA 5DO4H 3M5OA 1OWJA 3RLWH 2ZTXA 3GY3A 1ELAA 4XFQA 1GDUA 2JETC 1OWEA 1A0HB 2R9PA 5JB9S 3RXSA 1SGNE 1FY5A 3S7KB 2VIQA 1K1IA 3ZVCA 1DOJA 4AFSA 1VR1H 4GHTA 3GCTF 1A3BH 4INHA 1HAPH 2ZC9H 1JRSA 1CT2E 1INCA 2VVVA 4ZUHA 5L2ZH 4D7FA 3DFJA 3UR6A 3MO9A 2OBQA 3U8TH 4ZAEA 2HALA 1NRSH 4XBBA 1TGBA 4JZIA 1F0SA 3MOCA 1EQ9A 3SV9A 3HK3B 3SNDA 1H8DH 3UWIA 1D9IA 1V2LT 1UVTH 1EJAA 1YPGH 4CRDA 1DT2A 2A7HA 4HGCA 1MZDA 4X8UH 3TJVA 1BIOA 1QRZA 1N6YA 3TK9A 4ABGA 5J4SA 4Y11E 1J16A 1O3NA 3F6UH 1Z71A 2Y7ZA 4UFFH 2VIPA 4K60A 2PKAB 1YCPM 1BUIA 1QR3E 2EC9H 3ZZDA 3TK6A 2ZFTA 2GV6A 1EXFA 3LU9B 3PYHA 1SGYE 8LPRA 2UWLA 1Y59T 3ZZ7A 1QHRB 3UIRA 2V0BA 2WPLS 5DP3A 1GVLA 2DE8A 1E35B 1LHEH 4NWLA 5A0BA 1NPMA 1TPAE 2FI5E 1O3CA 1KXDA 1O3LA 3E91A 5C2ZA 4RKOB 1GBIA 5E2OA 1GVKB 4KP0A 1XUJA 2BLOA 3M35A 1AKSA 1AWHB 1OWHA 2OXSA 1FY8E 2BD2A 1RRKA 3HATH 3RM0H 3NXPA 1K1OA 7GCHF 4TPIZ 1SL3A 3BEFB 1O3BA 1ZPBA 2FOCA 3MU0A 4U01A 4KTCA 4E06H 3PTBA 1F0UA 2KAIA 3ZYEA 1AUJA 2FOGA 1JRTA 1GMHF 1W0ZU 3D23A 2WINI 1LPKB 4KTUA 4Y8YA 5E0HA 4AFQA 1EJNA 1S81A 4IC5A 5ETXA 4FUCA 1P09A 1BMAA 3KHVA 2OINA 2ILNA 1ELCA 4J1YA 1AFQC 1OOKB 2ANWA 2H9EH 1C2FA 3PWBA 3SU0A 3LOXA 1P9SA 2XC5A 1C2JA 3PWCA 2A7CA 4YT7H 1TMTH 1C2KA 2F9UA 2VGCC 1Q31A 5EQQA 1GHVH 1OPHB 1DDJA 1TABE 3ZVDA 1C5NH 4O9VA 2TBSA 2G5NA 2Q1JA 2FTMA 3MH6A 4XDEA 2ZU4A 3URCA 1MTNC 4NIYA 3GY6A 3MO6A 1CQQA 3MU4A 4DY7B 1S84A 4X1PU 4YM9A 1FV9A 1PPCE 1NROH 2P8OB 3LT3A 3RMOH 3BTQE 3VFEA 4I8JA 3EA8A 1L1JA 4CBNA 5EW2H 2BXTH 2FOAA 2NU3E 5C1UA 1W11U 1ANEA 2LPRA 6LPRA 1EPTC 5BRRE 2ZGJA 4CHAB 4ESTE 2CN0H 4SGAE 1FN6A 1T8NA 3NZIA 1OKXA 5AF9H 3D49H 4UD9H 1RD3B 4K69A 4X2WA 5EPYA 3SV6A 4YLQH 1W14U 1DWBH 1E38B 3LH1A 5FCKA 1VZQH 3RXEA 4X1RU 1ZOMA 2CXVA 2D2DA 2P93A 1JWTA 2XWBI 1FLEE 2O9QA 1J15A 5FBEA 3M7TA 3P8FA 5ESBA 1TNGA 1AE8H 2TGPZ 1C5LH 1VGCC 2FS9A 1GI9B 2FOFA 2FO9A 3F9EA 1V3XA 1AVXA 3UNSA 2G00A 3AVZA 4AB8A 1BMMH 3BF6H 3OY6U 1A5IA 4INKA 5E0GA 2JH0D 3TJOA 2A4RA 1YLCA 2TPIZ 4X6MA 1GMCG 1EP6A 1ZGVA 1MCVA 4ZH8A 2ZDAH 1P04A 3TH3H 1ZR0A 1PJPA 1O2JA 1C4U2 3LJOA 1O2WA 1FAKH 1LKBA 1TX7A 4B71A 2Y6TA 1TGSZ 1O5EH 5GJ4B 1DWEH 3IITA 4MNYA 3B8JA 4IMZA 1CVWH 1UK3A 2A2XH 1GBHA 1ORFA 1ELTA 2ZFRH 1C5SA 1C1TA 2GKVE 3KL6A 2AFQB 1TONA 4MPVA 1TIOA 4E05H 2CJIA 1GHAF 1HAXB 2BD4A 5C3NA 1AKSB 3HPTB 2FP7B 3MYWA 1WQSA 3T28A 3BTGE 1BTXA 2UUFB 1SLXB 1AB9B 1HLTH 1KLTA 1O5AB 1BBRE 4CRGA 1OYTH 2KAIB 1V6DA 2Y5GA 2Z94A 2P16A 2HWLB 4WVPE 1C5OH 3LPRA 1B0EA 2O8TA 3TU7H 1BBRH 1G2MA 1S83A 1GBDA 4GLYA 4JZEH 2FI4E 5JPMH 3TGJE 3D65E 3A8CA 5FX6A 1ELDE 3RXJA 2OUAA 1ARCA 2WV5A 2SFAA 4Y7BA 3E0PB 1BITA 1CHOF 1GCTB 2ZTYA 1O2GH 2ZPSA 4B2BA 6CHAB 2W5EA 4TWYA 5DP5A 1P8VC 2G51A 3RDZA 3H5CB 2ZPQA 4OS6A 2J92A 4Y6DA 3RUOA 3VXFH 1Z8GA 3KIDU 1S82A 2FODA 1QL9A 1GDNA 4BAHB 1IQIA 3RMNH 2J9NA 5TCAA 5AFZH 1S0QA 2ZHDA 2ANYA 3E16B 1O5CB 3TJNA 4LK4A 4YOIA 1IQFA 1O32A 3KQBA 1K21H 3DHKH 2XCNA 1MAXA 2P3UB 2BB4A 3LC5A 1AZ8A 1GI3A 3SZNA 2ZU2A 4X6OA 3SU1A 1TX8A 4Z0KA 4CR9A 3DUXH 3JZ1B 3L3TA 1BHXB 3VB5A 1C5VA 3Q00A 1QB9A 1HAZB 2A5IA 4Y10E 2J94A 4NA7A 2ZDMA 4KGAA 3SUDA 1SC8U 3PV4A 2BXUH 2FIRH 4RN6A 1O34A 1XVMA 2EI8A 2R3YA 2F3CE 4AGKA 1KXFA 4YOGA 1Z6JH 3KGPA 4F49A 1OP0A 3SNAA 1C2EA 5GIBA 1Z7KA 4CRBA 1YC0A 2PKSB 1O2QA 1Y3YA 2FLRH 3BN9A 1C5PA 2BY7X 2O8WA 4YZUA 1TA2A 4LOYH 2EEKA 1O2SA 1C1NA 1O2TA 1GCDA 1FONA 3NCLA 1V2NT 4DOQA 5C67A 1IOEA 5AHGH 4B2AA 1RTKA 3LH3A 2C3SA 4TYDA 3SU3A 1FIWA 2QYIA 3PMAB 1LMWB 2P8OC 1VCPA 3LIWA 1HJAB 4DGJA 1C1UH 1MQ6A 2BY6X 1G3CA 3ATWA 1C5UA 2BQ7B 2VIWA 2BVRH 9ESTA 1ESTA 1PPGE 3K6YA 2ZWLH 4JK5A 4OS2A 1BRBE 3H7OA 1NESE 1QA0A 4B75A 2XBXA 1QJ1B 1PQAA 5EQRA 4A1TA 3VGCB 5C20A 1GJ5H 1SR5C 1JXPA 1FUJA 1RIWB 1O3GA 5AFYH 5EU8A 2Q6GA 3NK8A 5LGOA 5HYOA 3GCHC 3AW0A 2FPZA 1GJ6A 2FM2A 4Q7YA 1O2PA 1O3PB 2F83A 3RXIA 2J4IA 2OQUA 1A7SA 1UVSH 4B1TA 3O8RA 3EQ0H 4IBLH 4X1NU 1H9IE 1DE7H 1ZMNA 2FS8A 3TPIZ 5EGMA 3BIVH 1TX6A 1IQLA 1QIXB 1RTLA 1UTLM 2ZFFH 5EXMA 1GDQA 4A1XA 1UTNA 3I29A 4AB9A 3MFJA 4DVAU 2A0QB 1HUTH 1RGQA 1RS0A 1Z6EA 1T32A 2RA3A 1PQ8A 2SGDE 1YF4A 2W3IA 1LHFH 2H1UA 1DY9A 1EAXA 1H9HE 3AW1A 1E37B 4CBOA 4Y7AA 4ZKNU 4BAKB 3P8GA 4U30A 1WAYB 1GPZA 1SPJA 1P06A 3A85A 1AWFH 2RG3A 1ZMLA 2Y5FA 1N8OC 3RXKA 3M5NA 1OWIA 4X8SH 4CRCA 1GBTA 4AFUA 3QGNB 5F6MA 4FU8A 1MBMA 2SGEE 1AI8H 1T4UH 3STJA 4H6SB 1NFWA 3SJ8A 3RXBA 5A09A 1ETTH 2TGAA 1P9UA 3ATKA 1AB9C 1RJXB 1KTSB 5E2PA 3GCOA 5E0JA 1BT7A 3IWMA 1RTFB 2XBYA 1TGNA 4RKJB 4M7GA 3ZZ4A 1NU7B 1FXYA 3SGBE 2NU1E 5JDUB 7ESTE 1GHYH 1GCTC 4ABJA 2OLGA 1DANH 4K8BA 3UFAA 3NUMA 1UO6A 1G9IE 4Q7XA 2ZI2H 4ZKOU 3LGIA 2VWOA 2C4FH 1AO5A 4ABIA 4IW4E 5HM9A 1O2LA 1UTMA 2BDAA 1GHBF 2CHAB 1MQ5A 3ENSB 3ZZCA 2ZGXH 4XOJA 1XX9A 2BDBA 2JH5D 4I8KA 1CGJE 2QN5T 4HFPB 2ZCLP 5C1YA 1OS8A 4I32A 3FANA 1WU1A 1FIZA 1BTZA 2HPPH 1WQVH 1G2LA 1XMNB 3GOVB 1KYNA 1GBKA 3EA7A 3TITA 2VNTA 1TBZH 2J2UA 1BTYA 1GBMA 3SU2A 4A92A 2BYAX 3EYDA 3RC5A 2XTTB 2XW9A 1ZHPA 5C5NA 5EXNA 4NFEA 4ZMAH 1ABIH 1YYY1 1E36B 2FWWA 4CH8B 3KN2A 2ZFSA 1TALA 4WF8A 1O2RA 2H9TH 2GMTB 2SGFE 1RXPA 2FDAA 4OGXA 4Y71A 2FXRA 2V3OH 3T27A 2VWNA 3CP7A 1TPPA 2BX3A 1FPHH 4B74A 2PKSC 3QGJA 3T62A 2AGGX 3NWUA 1EZUC 1GJCB 3ZYDA 1AVWA 2VB0A 2HRVA 3PROA 2AYWA 4OS4A 1EP5A 2HOBA 2FZZA 1J9CH 4NIVA 1CT0E 1D3QB 1O2HA 1HBTH 4MNVA 4MQAA 3SQHE 2OQ5A 1QRXA 5HGGA 2R3UA 2WUCA 1O2OA 1O39A 4NA8A 1AU8A 1L4DA 4ABDA 1HGTH 1HJAC 2ZPRA 2A4GA 1GWAA 1YKTA 1QQ4A 1YPMH 3TIUA 4YTAA 4GVUA 1ELBA 1MU8B 2ZA5A 1AE5A 1TNLA 3QO6A 5CHAB 5A0CA 3L6PA 3VB4A 4GHQA 3MNSA 4I31A 2VIVA 3M5LA 2OCVB 2ODYB 1H9LB 1QQUA 2HGTH 4ZROA 4LXBH 1FPCH 3BTFE 2ZHQH 1TOCB 1QA7A 4GAWA 4K5ZA 2Z7FE 1TPOA 1G36A 3DA9B 1PPBH 2AGEX 3VGCC 3B23B 5JB8S 1O3MA 3O8CA 1SOZA 1GBFA 3TH4H 3UUZA 1KXBA 4OS7A 1Y3VA 1UTQA 2ASUB 1D3DB 1CGIE 2ZDLA 1A2CH 3RU4T 3FP6E 2XCFA 1C5WB 4FUHA 1EX3A 1YPEH 5F03A 7LPRA 4RSPA 3H7TA 3TK5A 2NU0E 4IGDA 1C2DA 1BMNH 1PYTD 3HGPA 2BZ6H 4JZ1A 2Z9LA 2XC0A 5J4QA 3S7HB 1ZHMA 3A84A 1DLEA 1ZMJA 1T7CA 4CRAA 4BTUB 2Z9KA 1ZTKA 1GBLA 2ZNKH 1O3FA 2IN2A 2VH6A 3GY7A 3MU5A 1X7AC 4X6PA 1YM0A 5SGAE 1CGHA 3K65B 3UNRA 2IOTA 4H6TA 1TNJA 5FCRA 2Z9GA 8GCHG 4A1VA 1V2WT 1EZXC 1ELEE 1DUEA 4IN1A 4X2YA 4ABAA 3UTUH 4CREA 3T25A 3AAUA 2W7UA 1D4PB 4BXSA 2AERH 3OX7U 3FP7E 1YCPK 2QF3A 3LGWA 2VIDA 1QTFA 2XYAA 3RXQA 1O2XA 1H4WA 1Q3XA 5K7RA 1ZTJA 3BTDE 3MI4A 3GICB 5ESTE 1C2MA 1TB6H 3M5MA 3GISB 2STBE 1FMGA 2WPKS 1TNIA 3V12A 3A7ZA 3RC4A 3EE0B 1O2ZA 4IC6A 3SHAH 2PTCE 1THRH 1GGDB 3D62A 4NZLA 3KQCA 1A1RA 2SGQE 1IAUA 2FX6A 3A83A 1IQEA 2P95A 1SQAA 3BSQA 4D76A 1SI5H 1HV7A 2WYJA 1NFXA 1K1JA 2ZDVH 1ZGIA 1GJBB 1YPJH 1DXPA 1DSUA 1FNIA 2ZDNA 4ZKRU 2SNWA 1LO6A 1MKXK 2A4OA 1AIXH 1HJ8A 3ZZ3A 3FZZA 3VEQB 4D9RA 2VWMA 3TNTA 1V2OT 4B76A 1G3DA 1G3BA 5CMXH 3ZZ8A 1K9OE 4Y79A 5ABWA 1WTHD 1W12U 3PLKA 1MTUA 1XM1A 2BY5X 1TNKA 1ZRKA 2ULLA 4GUXA 3QUMP 2BDYA 2XC4A 5HMAA 2PUQH 2B0FA 4OS1A 2GT7A 2Z3DA 4TWWA 1EOJA 1O5BB 2QXGA 3QX5H 1NFYA 1EUFA 4WMFA 1WV7H 2QV1A 2GT8A 2GDEH 1GBEA 1CA0B 1AUTC 2F9PA 2YOLA 1GI5A 1GVZA 2AEIH 2TGTA 4ZKSU 3GDUA 2AMPA 1S85A 2XRCA 5GWZA 3BTHE 1LPZB 5JYIA 1F7ZA 2ESTE 3BG4B 1AQ7A 1K28D 3P8NA 1P01A 2ZECA 5AVDA 1OP2A 4ISLA 1GHWH 1VCWA 3EGKH 4TY6A 4H4FA 2QA9E 1IQMA 1PFXC 1CO7E 1XUIA 3RM2H 1MCTA 3SOSA 2VVUA 3MH7A 1SG8B 1HRTH 1GBCA 2BDIA 1CSOE 2FX4A 3K2UA 3SJ9A 3ZVEA 4WY3A 2BD8A 1KTTB 2P59A 1ZZZA 2F91A 3AASA 3PTNA 4YT6H 1ZPZA 7GCHG 1FI8A 2BD5A 1TOMH 1AY6H 4IS5A 4NWKA 1TRNA 3CS7A 2UWPA 4AFZA 2NU2E 2ZEBA 4BOHA 2XBVA 3LC3A 3FZDA 1Y3UA 2G55A 4OS5A 4DIIH 5TCCA 1K1NA 1B7XB 1NM6A 2BOKA 1JIMA 3A87A 3M3TA 1W8BH 5CHAC 2GCTB 3KQDA 4DCDA 3RXTA 1C4V2 2J38A 1GBAA 1O30A 1QL7A 1LDTT 3KNXA 3A7YA 3P8OA 5H4IB 3T26A 3R3GB 4NFFA 5DP6A 1V2QT 2XNIA 3UWJH 1SOTA 2AH4X 2P94A 4D9QA 3PMBB 5EPNA 1GG6B 2QY0B 1OYQA 2VINA 3SQEE 3SW2B 4JYVH 5PTPA 1A61H 2BDHA 2EI6A 4X2VA 2DUCA 4HI3A 2H5CA 3EDXB 4X2XA 2WYGA 1P2KA 1XUHA 2BLQA 2PSYA 5FPTA 2G4UA 1NRQH 1SFQB 2HLCA 3U98H 2PGBB 3F9FA 1VJAU 1A0JA 4U32A 3UOPA 1HIAA 1DS2E 3KF2A 3GY2A 3VB6A 4XBCA 3PO1B 3RP2A 1SGRE 1IQKA 1QB6A 3A88A 1EATA 2ZG0H 3GYMA 4ZXYH 1D6RA 4AG1A 2I6SA 1V2JT 5BPEA 1WUNH 1HYLA 1KXAA 2GGVB 3GY4A 1C9PA 1C1SA 4MVNA 4ABEA 1TQ0B 2WPIS 2UUKB 2H9HA 1V2PT 2FESH 4YLUA 1F5LA 1SGEE 1GJ8B 2B5TB 4H42U 3O8BA 2P3FH 1NN6A 2BLVA 3TNSA 4VGCB 2OC7A 1EJMA 1QJ7B 2ZZUH 3ZV8A 5CE1A 1NTPA 1EB1H 3TJUA 2PWXA 1P2QA 1L2EA 2Z6BD 1IQGA 1TBQH 1W7GH 1ELVA 1V2KT 1XUGA 2CF8H 1EPTA 1VJ9U 1Z8RA 3M61U 1ARBA 4R8TB 2JETB 3SU6A 2HVXA 2FOEA 1O2YA 1L0ZA 1V2VT 1FZZA 1ETRH 1F92A 1OWKA 5DK1A 4THNH 1TQ7B 2GZ7A 1TWXB 1ZLRA 3JZ2B 3BTEE 1QFKH 3ATMA 3U69H 1SQOA 1BCUH 4ZHAA 3P95A 4YESB 1O3HA 5HM2A 1QURH 2OD3B 2C8XB 1D6WA 2R0LA 4Q80A 2XBWA 4X1QU 1GMDF 4CHAC 1P10A 2K1QA 2B7DH 3E1XB 2BX4A 3MTYA 2D26C 1J17T 4MPWA 2BQWB 1C4Y2 4JK6A 5IYTA 3ZZ9A 4Y76A 1UJ1A 1SGTA 2VVCA 1GHAG 2CV3A 1SLUB 1YGCH 1GJAB 2ZDKA 1A3EH 1TBRH 1K1LA 1QCPA 4UFEH 1O2UA 1YP9A 2AIQA 5FPYA 2GZ8A 1Z8IB 2PR3A 1ETSH 2QC2A 1UTPA 4MNXA 1O2IA 5EQSA 1ZJDA 1KXCA 3KCGH 1O33A 5A0AE 4ASHA 2TRMA 2W26A 1C2GA 3LJJA 3EAJA 4JYTA 4AZ2B 3FP8E 3GY8A 3SO3A 1Y5AT 1FDPA 2A7JA 1MMJN 1KLIH 2GDDA 3SI3H 4FVDA 2Y5HA 1GI0A 4B2CA 1KDQA 3S69A 3WY8A 3OSYA 3ZVAA 5C1XA 1GI4A 4A5TS 3KEEA 2ZGCA 5FPSA 1K1PA 3Q77A 3E0NB 3TH2H 3RXUA 2A31A 3BTME 1CHOG 4Y8XA 3DD2H 3BG4C 2F9OA 2FYRA 3T2NA 4Q7ZA 1Q2WA 3RXHA 1YPLH 1C2IA 5DKMA 1TPSA 4UEHH 4FUIA 3Q3KA 3A80A 1EASA 3K9XB 1NRPH 5TJXA 4U2WA 5GCHG 1BZXE 1TLDA 4ISIH 4I8GA 1C5ZB 3SGAE 1UVUH 4R0IA 4WMEA 1MZAA 1HIAB 4I7YH 2RCEA 3A8AA 1YCPH 3E8LA 4UFDH 1SGPE 4DJZB 1UHBA 3LGUA 2D8WA 2PSXA 3RC6A 3PMHB 1SGFA 1AFQB 2Y82A 1NZQH 2W7SA 2BD9A 2JH6D 4BTIB 1YPHC 2Z3EA 3VB7A 2ZFQH 2QIQA 3LGYA 5JBTA 5EW1H 1XKAC 2BOHB 4E7NA 1V2MT 3LGTA 4Y8ZA 9LPRA 2FYQA 3ODFA 2VGCB 6GCHG 4K1EA 6ESTA 2TIOA 1MUEB 4YO9A 1V2UT 4SGBE 1GJ4H 5LH8A 1GJ9B 1HXEH 1SHHB 3ESTA 1P57B 4FVBA 2QGRA 4X0WU 3SORA 1MTNB 4CRFA 1MBQA 1G3EA 1FY4A 3BEIB 4NA9H 3W94A 1DWCH 1SLWB 6CHAC 1GG6C 1O5FH 4KKDA 3TLOA 3QLPH 1PYTC 1ELFA 1RFNA 1T4VH 1XXDA 1C5XB 5JBBS 1SFIA 1MKXH 3A81A 4MNWA 1P2OA 2H6MA 1Y3WA 3VB3A 1JBUH 5JBCS 1P2JA 3CS0A 3GDSA 1K22H 4XBDA 1QY6A 1BMLA 4UDWH 1C2LA 3ELAH 2XXLA 1K1MA 1YPHE 1GL1A 5DPAA 1BQYA 1ESBA 4GCHG 3PO1C 1PPFE 4WXIA 1MU6B 3UR9A 1J14A 1N1LA 1ZSJA 2ZTZA 5FX5A 8GCHF 2G81E
chains in the Genus database with same CATH superfamily
3RU4D 4AGJA 4BXWA 3SV7A 1G32B 2C90B 4GSOA 3MO3A 1C1MA 1DLKB 1DICA 1TYNA 1P02A 1D3TB 2BHGA 3T5FH 3S9CA 1VGCB 1Y5BT 1GI8B 1T8LA 1HAIH 4NGAH 3PM3A 1FN8A 5K0HA 2K8IA 3OYPA 3BEUA 1O3OA 2ODPA 5L30H 1MTSA 1QZ8A 1NY22 3A7WA 1QNJA 2KFWA 2GD4B 1QGFA 1O0DH 4QT8C 2ALPA 2C8YB 2ZIQH 2Z9JA 1XXFA 1Z8JB 3M3SA 2LNCA 1HAGE 3MH5A 3T29A 1BTHH 2Y81A 2PTNA 2C8ZB 4XD7D 4Q63A 4DT7B 2A5KA 1UTKA 4FUGA 4FUEA 3ZZAA 1C1PA 4AYYB 4DT4A 3ODDA 1HCGA 2GCHG 4WXVA 1H8IH 1SKYE 2GTBA 3M3VA 1KDQB 2THFB 2EA3A 3GYLB 1A5GH 1W3CA 1AD8H 3VPKA 2WPJS 1HAOH 1QBVH 1PPEE 1DWDH 1O3EA 5FAHA 1PPZA 1UCYK 4YOJA 2AMQA 3TVJB 4ACAA 2FOHA 5C5OA 1V2TT 5LPRA 1PPHE 3L33A 3MWIU 3HK6B 1VITG 4BANB 1HNEE 2Z9IA 1JOUB 1LVMA 3M36A 4JZFH 4UFGH 4XE4A 1LCYA 1RIWC 5A8XA 4YXWD 1S5SA 4PROA 3RMLH 1TAWA 1L4ZA 3RXLA 3BTKE 1JIRA 4K8YA 1SGFG 5G4BA 4WJG2 4NG9H 1UHBB 2QCYA 1DUAA 1GMCF 1C1QA 1UTOA 1CBWB 2WPHS 2ZP0H 3RXOA 4O97A 5CHBA 1T31A 2A1DB 2EI7A 4TPYA 1O2NA 1DX5M 2OC0A 1SB1H 5EXLA 2YNAA 2G5VA 1BRCE 1GJ7B 2BZAA 1P3EA 2BVSH 1FY1A 2A32A 4A6LA 2G4TA 4BAOB 3DT0H 4ABBA 1QBOA 3SUEA 1KMHB 2J98A 3U1JB 2V35A 3RXMA 4TT3D 1C2HA 2BMGB 3S9AA 1SGDE 2CMYA 3F9GA 4F55A 1CE5A 3GY5A 1SGCA 5T6FA 2AIPA 2H5DA 3K6ZA 1NT1A 1MKWK 1TNHA 1YBWA 1G30B 1N6XA 1U6QA 2TGDA 3SV8A 2GP9B 1GHBG 5IDKA 1O3KA 1FQ3A 2YNBA 3F9HA 1ELGA 2KCPA 1LHCH 2D1JA 2SGAA 3SU4A 2WUBA 3ITIA 1FY3A 2BM2A 4Q2KA 2JDID 2L74A 1WBGB 3TGKE 2WPMS 5HIZA 3MU8A 1BRAA 1QBNA 1HAYB 1SBWA 2G8TA 3M7UA 1O37A 5EODA 1AFEH 5FHTA 1ID5H 2F9VA 1SGQE 3QZRA 2Z3CA 3A8DA 1K2I1 4GPGA 5DP8A 2A5AA 4CH2B 2C8WB 2PGQB 4KTSA 2BD7A 3RXFA 1GHXH 5C94A 1S6FA 3RXDA 8KME2 3I77A 2OC1A 1GJDB 2A45B 1EOLA 1C5RA 1BB0B 4A7IB 3MNCA 3BIUH 2ALVA 1CA8B 1O3JA 3A7VA 3GCTG 2W6JD 1QJ6B 2QAAA 5FBIA 2FLBH 3ZV9A 1O2VA 1MH0A 2F9NA 1KIGH 2H2ZA 3PLBA 1GHZA 1IHTH 3CENA 5GDSH 4NCYA 3DSPA 5LPEA 2OC8A 1C1RA 2IPHA 2Q6DA 2CHAC 1SHYA 1H1BA 2OTVA 3OU0A 1BHXF 3PRDA 4DG4A 3UQOA 1F2SE 1DM4B 1F0TA 1O5DH 2ZQ2A 2PV9B 3FN8A 3ZVFA 1IQJA 3M7QA 2ZCKP 1BA8B 1HXFH 4ABHA 4O3TA 1KSNA 1TMBH 1NU9A 2O8UA 1TA6A 2QF5A 3QZQA 1E0FD 2DE9A 2R0KA 1O5GH 3SV2H 5DG6A 3GCHB 5I25A 1HPGA 4ISOA 3U8RH 1HAVA 1LVYA 2ZU1A 1P11E 2WPDD 3KQEA 1EAIA 1L1GA 2C93B 3SUFA 5A2MH 1O38A 2BTCE 3OY5U 5I46H 2BLWA 1GBBA 2WHXA 4I8LA 4TY7A 2UUYA 1K0HA 5DP7A 2GMTC 4BAQB 3M37A 4K2YA 1HB0B 3RMMH 3A8BA 5F8TA 2Q6FA 2VU8E 1S6HA 3QDZB 1TE0A 1DPOA 4FUBA 2NU4E 2BD3A 3LDXH 1MD8A 3STIA 1DVAH 2ZKSA 2OBOA 2M5TA 1EAUA 1OXGA 1ZJKA 1XUKA 2NWNA 3PMJA 4AN7A 3A82A 2QXJA 2WV9A 1NRNH 4MG3A 3SJKA 1PQ5A 5DGJA 3QWCH 3ZZ5A 3W1EA 1DXWA 4ZHLU 1O3IA 1GMHG 1LQDB 3SU5A 2ZHEH 1N8OB 2J34A 3DSGA 3Q76A 2J98B 2SGPE 3EA9A 3ZZBA 4E7RG 1OSSA 5EJ1A 4JYUH 4DURA 1WTGH 4F4OC 2B8OH 4FUDA 1CHGA 3F1SB 1A46H 2F9BH 1P2IA 1BOQA 2YMSD 3HKIB 1W0YH 2FMJA 1P03A 3SJOA 1MTWA 1HDTH 1AZZA 2BDCA 2AS9A 3S9BA 4ZXXH 1LQEA 2F4LA 4XSKU 2JKHA 2BQ6B 1P05A 5A8YA 1WSSH 4WWYA 5KEDA 5EOKA 3LGVA 4AYVB 4Y0ZE 3E3TA 1LTOA 1W7XH 3S0NA 4RI0A 4RT1A 1OWDA 1O31A 3IG6B 4I33A 3RLYH 1C1VH 1TGTA 1GL0E 2BDGA 2OP9A 2IJOB 4JZDH 1CBWC 1ZYOA 2L6OA 3MHWU 4AORA 1AGJA 1NFUA 4FXGH 2BVXH 1FX0B 1P2NA 2ANKH 4X1SU 1EZSC 2BY9X 2LELA 3LKWA 3V7TA 3UOUA 2I6QA 3QK1A 1ZRBA 2AGIX 1HAHH 4NIXA 5GPIB 1W2KH 1GI6A 5F8XA 2P3TB 3SN8A 5GCHF 1EZQA 3FAOA 3RXVA 2PLXA 1SLVB 2PFEA 2XWAA 4UONA 1HJ9A 3ZZ6A 4ISNA 1YPKH 1F0RA 1MTVA 2VIOA 5C0UA 2BY8X 2GVFA 1C5TA 1S6LA 2B9LA 4IN2A 3B9FH 3HKJB 3SNBA 4MLFB 4BNRA 8ESTE 3P17H 1O35A 4K1SA 2KR7A 3RXAA 5L2YH 4ISHH 1BJUA 2FEQH 1VITH 1W0KD 2ZQ1A 1V2ST 3SJIA 1UVOA 3P70B 1BRUP 1O3DA 1UK4A 4MTBA 3GCNA 1DSTA 2FOBA 3ATIA 1ACBE 3V13A 6GCHF 3MNBA 3HGNA 5LPFA 2ODQA 4AC9A 1P12E 3W95A 1GBJA 1C1WH 1KXEA 5T6GA 2STAE 1A5HA 1BTUA 2SNVA 1CU1A 2UUJB 3QTOH 3FO8D 1P0SH 1QB1A 3A89A 3OTJE 3ZVBA 4B6EA 1NRRH 3G01A 1GI1A 1EAWA 2VJ1A 3DFLA 4LZ4B 1NS3A 2Y80A 3UB0A 1GGDC 1HAVB 1NC6A 1G37A 3AAVA 1W10U 2J95A 2HNTC 2W3KA 3F68H 3UPEA 1SSXA 2ZU3A 3RXGA 1LPGB 1UCYE 1TMUH 4AOQA 4P00A 4MDSA 1FAXA 1FJSA 3N7OA 1WYKA 4JCNA 3V3MA 3V0XA 2FTLE 1UCYH 3Q3YA 1C5QA 4X8TH 1YLDA 2W6ID 1B0FA 4X8VH 3E90B 4I8HA 1AN1E 5GXPA 5L6NH 4K3JA 1IQHA 4GCHF 3A7XA 2FOMB 4O03A 1Y8TA 4FUJA 4BAMB 1ESAA 1TRMA 3P6ZB 4DIHH 3MNXA 1GI2A 1C1OA 4KELA 2ZHWH 3BTWE 1SMFE 4FUFA 1UMAH 2PHBA 4WMDA 4Z6AH 3Q3XA 2RA0A 2ZFPH 1BJVA 2GZ9A 1ANBA 1THPB 2V3HH 2HNTE 5B6OA 1CA0C 3DSOA 4INLA 4HTCH 3MMGA 1UK2A 2V6NA 1LHGH 3ZVGA 4B73A 5E8EH 1TRYA 4NSVA 5A8ZA 1Y3XA 3BG8A 2VH0A 3PB1E 1LHDH 1VCQA 2CF9H 3UY9A 1TGCA 2JJ2D 2IPQX 1XUFA 1O3AA 2VWLA 5T1VA 1D3PB 1WCZA 3QTVH 1LKAA 1AVGH 2R2MB 4D8NA 1Y5UT 3U28C 4WH6A 4HZHA 5CDFE 4WH8A 5T3HA 5HXFA 3RU4E 4Z1MD 2GCHF 4NIWA 4Y0YE 1BTWA 1MKWH 1ABJH 1M9UA 1S0RA 3SUGA 2ZCHP 3LONA 1W13U 1EKBB 1KLJH 3C1KA 1C5MD 2GV7A 2PKAA 5GNDA 4NSYA 1NO9H 1QRWA 2A4QA 3EE7A 3GDVA 2PW8H 2RDLA 3R0FA 2YMSB 3UNQA 1THSH 1KY9A 1J8AA 1VITF 2XNDD 7KMEH 1ANCA 2GX4A 3RXCA 4MPUA 2ZF0H 2O8MA 1A4WH 4AX9H 3PV5A 2FI3E 5DP4A 4K1TA 4FOUC 2GCTC 2QF0A 3SBKA 1ZTLA 3SGQE 4J2YB 2QXIA 1F5RA 4OGYA 3MU1A 1IQNA 1IHSH 1B5GH 1E79D 3SNCA 1WOFA 1JMOH 1CT4E 2AMDA 3A86A 1BBRK 1HFDA 4ZHMU 1ZSKA 3P92A 4NZQA 1ZHRA 1YY3A 2PUXB 3QN7A 2HPQH 1PQ7A 1XKBC 3MH4A 1O2MA 2O8LA 1L1NA 3NKKA 1P3CA 3U1IB 4FU9A 1EPTB 1AHTH 4IMQA 1OP8A 3BV9B 1SVPA 3RXRA 3TGIE 3BTTE 3URDA 3SYJA 1NBMD 5F8ZA 1BTPA 5T6DA 2ANMH 1OX1A 1BDAA 1SQTA 1ZSLA 2QXHA 2ZGBH 4X6NA 3SHCH 5DP9A 1UTJA 1LVBA 2UWOA 1E34B 2A2QH 3UQVA 4UE7H 3SI4H 3E6PH 1V2RT 2ZHFH 4ABFA 2WV4A 3FFGA 1O2KA 2ZO3H 1MAYA 1SGIB 3PRBA 1C5YB 4DW2U 1XVOA 2G52A 1GMDG 1P2MA 2R2WU 4CR5A 4LZ1H 1AMHA 2Y7XA 3FVFB 4MPXA 1DY8A 1F5KU 4O3UA 5DJ7A 1O36A 3A7TA 5EG4A 1GI7B 1Z1JA 3SNEA 3C27B 1ZPCA 4JMYA 3ATLA 3OFND 4AG2A 1DFPA 1ANDA 5HKKD 3U8OH 5FXLA 4BTTB 1DITH 4VGCC 1T8MA 2CGAA 1C9TA 2ZU5A 2WSSD 4FU7A 1QL8A 2ZGHA 3RXPA 1YWUA 3NPSA 5JBAS 3UREA 1MD7A 1TFXA 3U9AH 1EB2A 1T8OA 1LVOA 4D7GA 1UVPA 1A0LA 1Z1IA 2HNTF 3I78A 3O8DA 3VXEH 3PLPA 3VG8A 5DO4H 3M5OA 1OWJA 3RLWH 2ZTXA 5C0TA 3GY3A 1ELAA 4XFQA 1GDUA 2JETC 1OWEA 1A0HB 2R9PA 5JB9S 3RXSA 1SGNE 1FY5A 3S7KB 2VIQA 1K1IA 3ZVCA 3WW7A 1DOJA 4AFSA 1VR1H 4GHTA 3OE7D 3GCTF 1A3BH 4INHA 1HAPH 2ZC9H 1JRSA 1CT2E 1INCA 2VVVA 4ZUHA 5EIYA 5L2ZH 4D7FA 3DFJA 3UR6A 3MO9A 2OBQA 3U8TH 4ZAEA 2HALA 1NRSH 4XBBA 1TGBA 4JZIA 1F0SA 3MOCA 1EQ9A 3SV9A 3HK3B 3SNDA 1H8DH 3UWIA 1D9IA 1V2LT 1UVTH 1EJAA 1YPGH 4CRDA 1DT2A 2A7HA 4HGCA 1MZDA 4X8UH 3TJVA 4XRNA 1BIOA 1QRZA 1N6YA 3TK9A 4ABGA 5J4SA 4Y11E 1J16A 1O3NA 3F6UH 1Z71A 2Y7ZA 4UFFH 2VIPA 4K60A 2PKAB 1YCPM 1BUIA 1QR3E 2EC9H 3ZZDA 3TK6A 2QF4A 2ZFTA 2GV6A 1EXFA 3LU9B 3PYHA 1SGYE 8LPRA 2UWLA 1Y59T 3ZZ7A 1QHRB 3UIRA 2V0BA 2WPLS 5DP3A 1GVLA 2DE8A 1E35B 1LHEH 4NWLA 4OM9A 5A0BA 1NPMA 1TPAE 2FI5E 1O3CA 1KXDA 1O3LA 3E91A 5C2ZA 1E1RD 4RKOB 1GBIA 5E2OA 1GVKB 4KP0A 1XUJA 2BLOA 3M35A 1AKSA 1AWHB 1OWHA 2OXSA 1FY8E 2BD2A 1RRKA 3HATH 3RM0H 3AK5A 3NXPA 1K1OA 7GCHF 4TPIZ 1SL3A 3BEFB 1O3BA 1ZPBA 2HVYB 2FOCA 3MU0A 4U01A 4KTCA 4E06H 3PTBA 1F0UA 2KAIA 3ZYEA 1AUJA 2FOGA 1JRTA 1GMHF 1W0ZU 3D23A 1SQRA 2WINI 1LPKB 4KTUA 4Y8YA 5E0HA 4AFQA 1EJNA 1S81A 4IC5A 5ETXA 4FUCA 1P09A 1BMAA 3KHVA 2OINA 2ILNA 1ELCA 4J1YA 3F0PA 1AFQC 1OOKB 2ANWA 2H9EH 1C2FA 3PWBA 3SU0A 3LOXA 1P9SA 2XC5A 1C2JA 3PWCA 2A7CA 4YT7H 1TMTH 2KM0A 1C2KA 2F9UA 2VGCC 1Q31A 5EQQA 1GHVH 1OPHB 1DDJA 1TABE 3ZVDA 1C5NH 4O9VA 2TBSA 2G5NA 2Q1JA 2FTMA 3MH6A 4XDEA 2ZU4A 3URCA 1MTNC 4NIYA 3GY6A 3MO6A 1CQQA 3MU4A 4DY7B 1S84A 4X1PU 4YM9A 1FV9A 1PPCE 1NROH 2P8OB 3LT3A 3RMOH 3BTQE 3VFEA 4I8JA 3EA8A 3OTPA 1L1JA 4CBNA 5EW2H 2BXTH 2FOAA 2NU3E 5C1UA 1W11U 1ANEA 2LPRA 6LPRA 1EPTC 5BRRE 2ZGJA 4CHAB 4ESTE 1H8HD 2CN0H 4SGAE 1FN6A 1T8NA 3NZIA 4F48B 1OKXA 5AF9H 3D49H 4UD9H 1RD3B 4K69A 4X2WA 5EPYA 3SV6A 4YLQH 1W14U 1DWBH 4P02A 1E38B 3LH1A 5FCKA 1VZQH 3RXEA 4X1RU 1ZOMA 2CXVA 2D2DA 2P93A 1JWTA 2XWBI 1FLEE 2M2AA 2O9QA 1J15A 5FBEA 3M7TA 3F0OA 3P8FA 5ESBA 1TNGA 1AE8H 2TGPZ 1C5LH 1VGCC 2FS9A 1GI9B 2FOFA 2JJ1D 2FO9A 3F9EA 1V3XA 2PP6A 1AVXA 3UNSA 2G00A 3AVZA 4AB8A 1BMMH 3BF6H 3OY6U 1A5IA 4INKA 5E0GA 2JH0D 3TJOA 2A4RA 1YLCA 2TPIZ 1WDIA 4X6MA 1GMCG 1EP6A 1ZGVA 1MCVA 4ZH8A 2ZDAH 2KCYA 3KYFA 1P04A 3TH3H 1ZR0A 1OHHD 1PJPA 1O2JA 1C4U2 3LJOA 1O2WA 1FAKH 2CK3D 1LKBA 1TX7A 4B71A 2Y6TA 1TGSZ 1O5EH 5GJ4B 1DWEH 3IITA 4MNYA 3B8JA 4IMZA 1CVWH 1UK3A 2A2XH 1GBHA 1ORFA 1ELTA 2ZFRH 1C5SA 1C1TA 2GKVE 3KL6A 2AFQB 1TONA 3OEED 4MPVA 1TIOA 4E05H 2CJIA 1GHAF 1HAXB 2BD4A 5C3NA 1AKSB 2KCAA 3HPTB 2FP7B 3MYWA 1WQSA 3T28A 3BTGE 1BTXA 2UUFB 1SLXB 1AB9B 1HLTH 1KLTA 1O5AB 1BBRE 4CRGA 1OYTH 2KAIB 1V6DA 2Y5GA 2Z94A 2P16A 2HWLB 4WVPE 1C5OH 3LPRA 1B0EA 2O8TA 3TU7H 1BBRH 1G2MA 1S83A 1GBDA 4GLYA 4JZEH 2FI4E 5JPMH 3TGJE 3D65E 3N99A 3A8CA 5FX6A 1ELDE 3RXJA 2OUAA 1ARCA 2WV5A 2SFAA 4Y7BA 3E0PB 1BITA 1CHOF 1GCTB 2ZTYA 1O2GH 2ZPSA 4B2BA 6CHAB 2W5EA 4TWYA 5DP5A 3N7DA 1P8VC 2G51A 3RDZA 3H5CB 2ZPQA 3WWBA 2JIZD 4OS6A 2J92A 4Y6DA 3RUOA 3VXFH 1Z8GA 3KIDU 1S82A 2FODA 1QL9A 1GDNA 4BAHB 3F2GA 1IQIA 2AHME 3RMNH 2J9NA 5TCAA 5AFZH 1S0QA 2ZHDA 2ANYA 3E16B 1O5CB 3TJNA 4LK4A 3NRLA 1IQFA 1O32A 3KQBA 4YOIA 1K21H 3DHKH 2XCNA 1MAXA 2P3UB 2BB4A 3LC5A 1AZ8A 1GI3A 3SZNA 2ZU2A 4X6OA 3SU1A 1EFRD 1TX8A 4Z0KA 4CR9A 3DUXH 3JZ1B 3L3TA 1BHXB 3VB5A 1C5VA 3Q00A 1QB9A 1HAZB 2A5IA 4Y10E 2J94A 4NA7A 2ZDMA 4KGAA 3SUDA 1SC8U 3PV4A 2BXUH 2FIRH 4RN6A 1O34A 1XVMA 2EI8A 2R3YA 2F3CE 4AGKA 1KXFA 4YOGA 1Z6JH 3KGPA 4F49A 4TSFD 1OP0A 3SNAA 1C2EA 5GIBA 1Z7KA 4CRBA 1YC0A 4I86A 2PKSB 1O2QA 1Y3YA 2FLRH 1BMFD 3BN9A 1C5PA 2BY7X 2O8WA 4YZUA 1TA2A 4LOYH 2EEKA 1O2SA 1C1NA 1O2TA 3FKSD 1GCDA 1FONA 3NCLA 1V2NT 4DOQA 5C67A 3F3BA 1IOEA 5AHGH 4B2AA 3KYGA 1RTKA 5DSFA 3LH3A 2C3SA 4TYDA 3SU3A 1FIWA 2QYIA 3PMAB 1LMWB 2P8OC 1VCPA 3LIWA 1HJAB 4DGJA 1C1UH 1MQ6A 2BY6X 1G3CA 3ATWA 1C5UA 2BQ7B 2VIWA 1H8ED 2BVRH 9ESTA 1UW7A 1ESTA 1PPGE 3K6YA 2QE7D 2ZWLH 4JK5A 4OS2A 1BRBE 3H7OA 1NESE 1QA0A 4B75A 2F43B 2HLDD 2XBXA 1QJ1B 1PQAA 5EQRA 4A1TA 3VGCB 5C20A 4B6FA 1GJ5H 1SR5C 1JXPA 1FUJA 1RIWB 1O3GA 5AFYH 5EU8A 2Q6GA 3NK8A 5LGOA 5HYOA 3GCHC 3AW0A 2FPZA 1GJ6A 2FM2A 4Q7YA 4ASUD 1O2PA 1O3PB 2F83A 3RXIA 2J4IA 2OQUA 1A7SA 1NBME 1UVSH 4B1TA 3O8RA 3EQ0H 4IBLH 4X1NU 1H9IE 1DE7H 1ZMNA 2FS8A 3TPIZ 5EGMA 3BIVH 1TX6A 1IQLA 1QIXB 1RTLA 1UTLM 2ZFFH 5EXMA 1GDQA 4A1XA 1UTNA 3I29A 4AB9A 3MFJA 4DVAU 2A0QB 1HUTH 1RGQA 1RS0A 1Z6EA 1T32A 2RA3A 1PQ8A 2SGDE 3F2FA 1YF4A 2W3IA 1LHFH 2H1UA 1DY9A 1EAXA 1H9HE 3AW1A 1E37B 4CBOA 4Y7AA 4ZKNU 4BAKB 3P8GA 4U30A 1WAYB 1GPZA 1SPJA 1P06A 3A85A 1AWFH 2RG3A 1ZMLA 2Y5FA 1N8OC 3RXKA 3M5NA 1OWIA 4X8SH 4CRCA 1GBTA 4AFUA 3QGNB 5F6MA 4FU8A 1MBMA 2SGEE 1AI8H 1T4UH 3STJA 4H6SB 1NFWA 3SJ8A 3RXBA 5A09A 1ETTH 2TGAA 1P9UA 3ATKA 1AB9C 1RJXB 1KTSB 4Q4LA 5E2PA 3MQKC 3GCOA 5E0JA 2EQNA 1BT7A 3IWMA 1RTFB 2XBYA 1TGNA 4RKJB 4M7GA 3ZZ4A 1MABB 1NU7B 1FXYA 3SGBE 2NU1E 5JDUB 7ESTE 1GHYH 5KGOA 1GCTC 1E1QD 4ABJA 2OLGA 1DANH 4K8BA 3UFAA 3NUMA 1UO6A 1G9IE 4Q7XA 2ZI2H 4ZKOU 3LGIA 2VWOA 2C4FH 1AO5A 4ABIA 4IW4E 2KX4A 5HM9A 1O2LA 1UTMA 2BDAA 1GHBF 2CHAB 1MQ5A 3ENSB 2EY4C 3ZZCA 2ZGXH 4XOJA 1XX9A 2BDBA 2JH5D 4I8KA 1CGJE 4ZCNA 2QN5T 2KCOA 4HFPB 2ZCLP 5C1YA 1OS8A 4I32A 3FANA 1WU1A 1FIZA 1BTZA 2HPPH 1WQVH 1G2LA 1XMNB 3GOVB 1KYNA 1GBKA 3EA7A 3TITA 2VNTA 1TBZH 2J2UA 1BTYA 1GBMA 5HIYA 3SU2A 4A92A 2BYAX 3EYDA 3RC5A 2XTTB 2XW9A 1ZHPA 5C5NA 5EXNA 4NFEA 4ZMAH 1WXRA 1ABIH 1YYY1 1E36B 2FWWA 4CH8B 3KN2A 2ZFSA 1TALA 4WF8A 1O2RA 2H9TH 2GMTB 2SGFE 1RXPA 2FDAA 4OGXA 4Y71A 2FXRA 2V3OH 3T27A 2VWNA 3CP7A 1TPPA 3WWFA 2BX3A 1FPHH 4B74A 2PKSC 3QGJA 3T62A 2AGGX 3NWUA 1EZUC 1GJCB 5F53A 3ZYDA 1AVWA 2VB0A 2HRVA 3PROA 2AYWA 4OS4A 1EP5A 2HOBA 2FZZA 1J9CH 4NIVA 1CT0E 1D3QB 1O2HA 1HBTH 4MNVA 4MQAA 3SQHE 2OQ5A 1QRXA 5HGGA 2R3UA 2WUCA 1O2OA 1O39A 4NA8A 1AU8A 1L4DA 5DN6D 4ABDA 1HGTH 5C17A 1HJAC 2ZPRA 2A4GA 1GWAA 1YKTA 1QQ4A 1YPMH 3TIUA 4YTAA 4GVUA 1ELBA 1MU8B 2ZA5A 1AE5A 1TNLA 2GJGA 3QO6A 5CHAB 5A0CA 3L6PA 3VB4A 4GHQA 3MNSA 4I31A 2VIVA 3M5LA 2OCVB 2ODYB 1H9LB 1QQUA 2HGTH 4ZROA 4LXBH 1FPCH 3BTFE 2ZHQH 1TOCB 1QA7A 4GAWA 4K5ZA 2Z7FE 1TPOA 1G36A 3DA9B 1PPBH 2AGEX 3VGCC 3B23B 5JB8S 1O3MA 3OEHD 3O8CA 1SOZA 1GBFA 3TH4H 3UUZA 1KXBA 4OS7A 1Y3VA 1UTQA 2ASUB 1D3DB 4FETA 5B6LA 1CGIE 2ZDLA 1A2CH 3RU4T 3FP6E 2XCFA 1C5WB 4FUHA 1EX3A 1YPEH 5F03A 7LPRA 4RSPA 3H7TA 3TK5A 2NU0E 3SZEA 4ACBA 4IGDA 1C2DA 1BMNH 1PYTD 2V7QD 3HGPA 2BZ6H 4JZ1A 2RDEA 2Z9LA 2XC0A 5J4QA 3S7HB 1ZHMA 3A84A 1DLEA 1ZMJA 1T7CA 4CRAA 4BTUB 2Z9KA 1ZTKA 1GBLA 2ZNKH 1O3FA 5EJLA 2IN2A 2VH6A 3GY7A 3MU5A 1X7AC 4X6PA 1YM0A 5SGAE 1CGHA 3K65B 3UNRA 2IOTA 3CNRA 4H6TA 1TNJA 5FCRA 2Z9GA 8GCHG 4A1VA 2YMSC 1V2WT 1EZXC 1ELEE 1DUEA 4IN1A 4X2YA 4ABAA 3UTUH 4CREA 3T25A 3AAUA 5FL7D 2W7UA 1D4PB 4BXSA 2AERH 3OX7U 3FP7E 1YCPK 2QF3A 3LGWA 2VIDA 1QTFA 2XYAA 3RXQA 1O2XA 1H4WA 1Q3XA 5K7RA 1ZTJA 3BTDE 3MI4A 2K0QA 3GICB 2RFKC 5ESTE 1C2MA 1TB6H 3M5MA 3GISB 2STBE 1FMGA 2WPKS 1TNIA 3V12A 3A7ZA 4HG6A 3RC4A 3EE0B 1O2ZA 4IC6A 3SHAH 2PTCE 1THRH 2J97A 1GGDB 3D62A 4NZLA 3KQCA 1A1RA 2SGQE 1IAUA 2FX6A 3A83A 1IQEA 2P95A 1SQAA 3BSQA 4D76A 1SI5H 1HV7A 2KZ4A 2WYJA 1NFXA 1K1JA 2ZDVH 4RT0A 1ZGIA 1GJBB 1YPJH 1DXPA 1DSUA 1FNIA 2ZDNA 4ZKRU 2SNWA 1LO6A 1MKXK 2A4OA 1AIXH 1HJ8A 3ZZ3A 3FZZA 3VEQB 4D9RA 2VWMA 3TNTA 1V2OT 4B76A 1G3DA 1G3BA 5CMXH 3ZZ8A 1K9OE 4Y79A 5ABWA 1WTHD 1W12U 3PLKA 1MTUA 1XM1A 2BY5X 1TNKA 1ZRKA 2ULLA 4GUXA 3QUMP 2BDYA 2XC4A 5HMAA 2PUQH 2B0FA 4OS1A 2GT7A 2Z3DA 4TWWA 1EOJA 1O5BB 2QXGA 3QX5H 1NFYA 1EUFA 4WMFA 1WV7H 2QV1A 2GT8A 2GDEH 1GBEA 1CA0B 1AUTC 2F9PA 2YOLA 1GI5A 1GVZA 2AEIH 2TGTA 4ZKSU 3GDUA 2AMPA 1S85A 2XRCA 5GWZA 3BTHE 1LPZB 5JYIA 1F7ZA 2ESTE 3BG4B 1AQ7A 1K28D 3P8NA 1P01A 2ZECA 5AVDA 1OP2A 4ISLA 1GHWH 1VCWA 3EGKH 4TY6A 4H4FA 2QA9E 1IQMA 1PFXC 1CO7E 1XUIA 3RM2H 1MCTA 3SOSA 2VVUA 3MH7A 1SG8B 1HRTH 1GBCA 2BDIA 1CSOE 3F2HA 2FX4A 3K2UA 3SJ9A 3ZVEA 4WY3A 2BD8A 1KTTB 2P59A 1ZZZA 2F91A 3AASA 3PTNA 4YT6H 1ZPZA 7GCHG 1FI8A 2BD5A 1TOMH 1AY6H 4IS5A 4NWKA 5EJZA 1TRNA 3CS7A 2UWPA 4AFZA 2NU2E 2ZEBA 5KECA 4BOHA 2XBVA 3LC3A 3FZDA 1Y3UA 2G55A 4OS5A 4DIIH 5TCCA 1K1NA 3UAIC 1B7XB 1NM6A 2BOKA 1JIMA 3A87A 3M3TA 1W8BH 5CHAC 2GCTB 3KQDA 4DCDA 3RXTA 1C4V2 2J38A 1GBAA 1O30A 1QL7A 3GS9A 1LDTT 3KNXA 3A7YA 2V3MA 3P8OA 5H4IB 3T26A 3R3GB 4NFFA 5DP6A 1V2QT 2XNIA 3UWJH 1SOTA 2AH4X 2P94A 4D9QA 3PMBB 5EPNA 1GG6B 2QY0B 1OYQA 2VINA 3SQEE 3SW2B 4JYVH 5PTPA 1A61H 2BDHA 2EI6A 4X2VA 2DUCA 4HI3A 2H5CA 3EDXB 4X2XA 2WYGA 1P2KA 1XUHA 2BLQA 2PSYA 3PV2A 5FPTA 2G4UA 1NRQH 1SFQB 2HLCA 3U98H 2PGBB 3F9FA 1VJAU 1A0JA 4U32A 3UOPA 1HIAA 1DS2E 2IJD1 3KF2A 3N7EA 3GY2A 3VB6A 4XBCA 3PO1B 3H09A 3RP2A 1SGRE 1IQKA 1QB6A 3A88A 1EATA 2ZG0H 3GYMA 4ZXYH 1D6RA 4AG1A 2I6SA 1V2JT 4M9FA 5BPEA 1WUNH 1HYLA 1KXAA 2GGVB 3GY4A 1C9PA 1C1SA 4MVNA 4ABEA 1TQ0B 2WPIS 2UUKB 2H9HA 1V2PT 2FESH 4YLUA 1F5LA 1SGEE 1GJ8B 2B5TB 4H42U 3O8BA 2P3FH 1NN6A 2BLVA 3ZIAD 3TNSA 4VGCB 2OC7A 1EJMA 1QJ7B 2ZZUH 3ZV8A 5CE1A 1NTPA 1EB1H 3TJUA 2PWXA 1P2QA 1L2EA 2Z6BD 1IQGA 1TBQH 1W7GH 1ELVA 1V2KT 1XUGA 2CF8H 1EPTA 1VJ9U 1Z8RA 3M61U 1ARBA 4R8TB 2JETB 3SU6A 1W0JD 2HVXA 2FOEA 1O2YA 1L0ZA 1V2VT 1FZZA 1ETRH 1F92A 1OWKA 5DK1A 4THNH 1TQ7B 2GZ7A 1TWXB 1ZLRA 3JZ2B 3BTEE 1QFKH 3ATMA 3U69H 1SQOA 1BCUH 4ZHAA 3P95A 4YESB 1O3HA 5HM2A 1QURH 2OD3B 2C8XB 1D6WA 2R0LA 4Q80A 2XBWA 4X1QU 1GMDF 4CHAC 1P10A 2K1QA 2B7DH 3E1XB 2BX4A 3MTYA 1COWD 3KQ5A 2D26C 1J17T 4MPWA 2BQWB 1C4Y2 4JK6A 5IYTA 3ZZ9A 4Y76A 1UJ1A 1SGTA 2VVCA 1GHAG 2CV3A 1SLUB 1YGCH 1GJAB 2ZDKA 1A3EH 1TBRH 1K1LA 2J5UA 1QCPA 4UFEH 1O2UA 1YP9A 2AIQA 5FPYA 2GZ8A 1Z8IB 2PR3A 1ETSH 2QC2A 1UTPA 4MNXA 1O2IA 5EQSA 1ZJDA 1KXCA 3KCGH 1O33A 5A0AE 4ASHA 2TRMA 2W26A 1C2GA 3LJJA 3EAJA 4JYTA 4AZ2B 3FP8E 2VBCA 3GY8A 3SO3A 1Y5AT 1FDPA 2A7JA 1MMJN 1KLIH 2GDDA 3SI3H 4FVDA 2Y5HA 1GI0A 4B2CA 1KDQA 3S69A 2XOKD 3WY8A 3OSYA 3ZVAA 5C1XA 1GI4A 4A5TS 3KEEA 2ZGCA 5FPSA 1K1PA 3Q77A 3E0NB 3TH2H 3RXUA 2A31A 3BTME 1CHOG 4Y8XA 3DD2H 3BG4C 2F9OA 2FYRA 3T2NA 4Q7ZA 1Q2WA 3RXHA 1YPLH 1C2IA 5DKMA 1TPSA 4UEHH 4FUIA 3Q3KA 3A80A 1EASA 3K9XB 1NRPH 5TJXA 4U2WA 5GCHG 1BZXE 1TLDA 4ISIH 1YLNA 2WZQA 4I8GA 1C5ZB 3SGAE 1UVUH 4R0IA 4WMEA 3OAAD 1MZAA 1HIAB 4I7YH 2RCEA 3A8AA 1YCPH 3E8LA 4UFDH 1SGPE 4DJZB 1UHBA 3LGUA 2D8WA 2PSXA 3RC6A 3PMHB 1SGFA 1AFQB 2Y82A 1NZQH 2W7SA 2BD9A 2JH6D 4BTIB 1YPHC 2Z3EA 3VB7A 2ZFQH 2QIQA 3LGYA 5JBTA 5EW1H 1XKAC 2BOHB 4E7NA 1VKYA 1V2MT 3LGTA 4Y8ZA 9LPRA 2FYQA 3ODFA 2VGCB 6GCHG 4K1EA 6ESTA 2TIOA 3FOAA 1MUEB 4YO9A 1V2UT 4SGBE 1GJ4H 5LH8A 1GJ9B 1HXEH 1SHHB 3ESTA 1P57B 4FVBA 2QGRA 4X0WU 3SORA 1MTNB 4CRFA 1MBQA 1G3EA 1FY4A 3BEIB 4NA9H 3W94A 1DWCH 1SLWB 6CHAC 1GG6C 1O5FH 4KKDA 3TLOA 3QLPH 1PYTC 1ELFA 1RFNA 1T4VH 1XXDA 1C5XB 5IK2D 5JBBS 1SFIA 1MKXH 3A81A 4MNWA 1P2OA 2H6MA 1Y3WA 3VB3A 1JBUH 5JBCS 1P2JA 3CS0A 3GDSA 1K22H 4XBDA 1QY6A 1BMLA 4UDWH 1C2LA 3ELAH 2XXLA 1K1MA 1YPHE 2OK5A 1GL1A 3DCLA 5DPAA 1BQYA 1ESBA 4GCHG 3PO1C 1PPFE 4WXIA 1MU6B 2LP6A 3UR9A 1J14A 1N1LA 1ZSJA 2ZTZA 5FX5A 8GCHF 2G81E
chains in the Genus database with same CATH topology
3RU4D 4AGJA 4BXWA 3SV7A 1G32B 2C90B 4GSOA 3MO3A 1C1MA 1DLKB 1DICA 1TYNA 1P02A 1D3TB 2BHGA 3T5FH 3S9CA 1VGCB 1Y5BT 1GI8B 1T8LA 1HAIH 4NGAH 3PM3A 1FN8A 5K0HA 3OYPA 3BEUA 1O3OA 2ODPA 5L30H 1MTSA 1NY22 3A7WA 1QNJA 2GD4B 1QGFA 1O0DH 4QT8C 2ALPA 2C8YB 2ZIQH 2Z9JA 1XXFA 1Z8JB 3M3SA 2LNCA 1HAGE 3MH5A 3T29A 1BTHH 2Y81A 2PTNA 2C8ZB 4DT7B 2A5KA 1UTKA 4FUGA 4FUEA 3ZZAA 1C1PA 4AYYB 3ODDA 1HCGA 2GCHG 4WXVA 1H8IH 2GTBA 3M3VA 1KDQB 2THFB 2EA3A 3GYLB 1A5GH 1W3CA 1AD8H 3VPKA 2WPJS 1HAOH 1QBVH 1PPEE 1DWDH 1O3EA 5FAHA 1PPZA 1UCYK 4YOJA 2AMQA 3TVJB 2FOHA 5C5OA 1V2TT 5LPRA 1PPHE 3L33A 3MWIU 3HK6B 1VITG 4BANB 1HNEE 2Z9IA 1JOUB 1LVMA 3M36A 4JZFH 4UFGH 4XE4A 1LCYA 1RIWC 5A8XA 1S5SA 4PROA 3RMLH 1TAWA 1L4ZA 3RXLA 3BTKE 1JIRA 4K8YA 1SGFG 5G4BA 4WJG2 4NG9H 1UHBB 2QCYA 1DUAA 1GMCF 1C1QA 1UTOA 1CBWB 2WPHS 2ZP0H 3RXOA 4O97A 1T31A 2A1DB 2EI7A 4TPYA 1O2NA 1DX5M 2OC0A 1SB1H 5EXLA 2YNAA 2G5VA 1BRCE 1GJ7B 2BZAA 1P3EA 2BVSH 1FY1A 2A32A 4A6LA 2G4TA 4BAOB 3DT0H 4ABBA 1QBOA 3SUEA 3U1JB 2V35A 3RXMA 1C2HA 2BMGB 3S9AA 1SGDE 2CMYA 3F9GA 1CE5A 3GY5A 1SGCA 5T6FA 2AIPA 2H5DA 3K6ZA 1NT1A 1MKWK 1TNHA 1YBWA 1G30B 1N6XA 1U6QA 2TGDA 3SV8A 2GP9B 1GHBG 5IDKA 1O3KA 1FQ3A 2YNBA 3F9HA 1ELGA 1LHCH 2D1JA 2SGAA 3SU4A 2WUBA 3ITIA 1FY3A 2BM2A 4Q2KA 1WBGB 3TGKE 2WPMS 3MU8A 1BRAA 1QBNA 1HAYB 1SBWA 2G8TA 3M7UA 1O37A 5EODA 1AFEH 5FHTA 1ID5H 2F9VA 1SGQE 3QZRA 2Z3CA 3A8DA 1K2I1 4GPGA 5DP8A 2A5AA 4CH2B 2C8WB 2PGQB 4KTSA 2BD7A 3RXFA 1GHXH 1S6FA 3RXDA 8KME2 3I77A 2OC1A 1GJDB 2A45B 1EOLA 1C5RA 1BB0B 4A7IB 3MNCA 3BIUH 2ALVA 1CA8B 1O3JA 3A7VA 3GCTG 1QJ6B 2QAAA 5FBIA 2FLBH 3ZV9A 1O2VA 1MH0A 2F9NA 1KIGH 2H2ZA 3PLBA 1GHZA 1IHTH 3CENA 5GDSH 4NCYA 5LPEA 2OC8A 1C1RA 2IPHA 2Q6DA 2CHAC 1SHYA 1H1BA 2OTVA 3OU0A 1BHXF 4DG4A 3UQOA 1DM4B 1F2SE 1F0TA 1O5DH 2ZQ2A 2PV9B 3ZVFA 1IQJA 3M7QA 2ZCKP 1BA8B 1HXFH 4ABHA 4O3TA 1KSNA 1TMBH 1NU9A 2O8UA 1TA6A 3QZQA 1E0FD 2DE9A 2R0KA 1O5GH 3SV2H 5DG6A 3GCHB 5I25A 1HPGA 4ISOA 3U8RH 1HAVA 1LVYA 2ZU1A 1P11E 3KQEA 1EAIA 1L1GA 2C93B 3SUFA 5A2MH 1O38A 2BTCE 3OY5U 5I46H 2BLWA 1GBBA 4I8LA 4TY7A 2UUYA 5DP7A 2GMTC 4BAQB 3M37A 4K2YA 1HB0B 3RMMH 3A8BA 5F8TA 2Q6FA 2VU8E 1S6HA 3QDZB 1TE0A 1DPOA 4FUBA 2NU4E 2BD3A 3LDXH 1MD8A 3STIA 1DVAH 2ZKSA 2OBOA 2M5TA 1EAUA 1OXGA 1ZJKA 1XUKA 2NWNA 3PMJA 4AN7A 3A82A 2QXJA 1NRNH 4MG3A 3SJKA 1PQ5A 5DGJA 3QWCH 3ZZ5A 1DXWA 4ZHLU 1O3IA 1GMHG 1LQDB 3SU5A 2ZHEH 1N8OB 2J34A 3Q76A 2SGPE 3EA9A 3ZZBA 4E7RG 1OSSA 4JYUH 4DURA 1WTGH 4F4OC 2B8OH 4FUDA 1CHGA 3F1SB 1A46H 2F9BH 1P2IA 1BOQA 3HKIB 1W0YH 2FMJA 1P03A 3SJOA 1MTWA 1HDTH 1AZZA 2BDCA 2AS9A 3S9BA 4ZXXH 1LQEA 4XSKU 2JKHA 2BQ6B 1P05A 5A8YA 1WSSH 4WWYA 5EOKA 3LGVA 4AYVB 4Y0ZE 3E3TA 1LTOA 1W7XH 3S0NA 1OWDA 1O31A 3IG6B 4I33A 3RLYH 1C1VH 1TGTA 1GL0E 2BDGA 2OP9A 2IJOB 4JZDH 1CBWC 1ZYOA 3MHWU 4AORA 1AGJA 1NFUA 4FXGH 2BVXH 1P2NA 2ANKH 4X1SU 1EZSC 2BY9X 3LKWA 3V7TA 3UOUA 2I6QA 3QK1A 1ZRBA 2AGIX 1HAHH 4NIXA 5GPIB 1W2KH 1GI6A 5F8XA 2P3TB 3SN8A 5GCHF 1EZQA 3FAOA 3RXVA 2PLXA 1SLVB 2PFEA 2XWAA 4UONA 1HJ9A 3ZZ6A 4ISNA 1YPKH 1F0RA 1MTVA 2VIOA 2BY8X 2GVFA 1C5TA 2B9LA 4IN2A 3B9FH 3HKJB 3SNBA 4MLFB 4BNRA 8ESTE 3P17H 1O35A 4K1SA 3RXAA 5L2YH 4ISHH 1BJUA 2FEQH 1VITH 2ZQ1A 1V2ST 3SJIA 1UVOA 3P70B 1BRUP 1O3DA 1UK4A 4MTBA 3GCNA 1DSTA 2FOBA 3ATIA 1ACBE 3V13A 6GCHF 3MNBA 3HGNA 5LPFA 2ODQA 1P12E 3W95A 1GBJA 1C1WH 1KXEA 5T6GA 2STAE 1A5HA 1BTUA 2SNVA 1CU1A 2UUJB 3QTOH 3OTJE 1P0SH 1QB1A 3A89A 3ZVBA 1NRRH 3G01A 1GI1A 1EAWA 2VJ1A 3DFLA 4LZ4B 1NS3A 2Y80A 1GGDC 1HAVB 1NC6A 1G37A 3AAVA 1W10U 2J95A 2HNTC 2W3KA 3F68H 3UPEA 1SSXA 2ZU3A 3RXGA 1LPGB 1UCYE 1TMUH 4AOQA 4MDSA 1FAXA 1FJSA 3N7OA 1WYKA 4JCNA 3V3MA 3V0XA 2FTLE 1UCYH 3Q3YA 1C5QA 4X8TH 1YLDA 1B0FA 4X8VH 3E90B 4I8HA 1AN1E 5GXPA 5L6NH 4K3JA 1IQHA 4GCHF 3A7XA 2FOMB 4O03A 1Y8TA 4FUJA 4BAMB 1ESAA 1TRMA 3P6ZB 4DIHH 3MNXA 1GI2A 1C1OA 4KELA 2ZHWH 3BTWE 1SMFE 4FUFA 1UMAH 2PHBA 4WMDA 4Z6AH 3Q3XA 2RA0A 2ZFPH 1BJVA 2GZ9A 1ANBA 1THPB 2V3HH 2HNTE 5B6OA 1CA0C 4INLA 4HTCH 3MMGA 1UK2A 2V6NA 1LHGH 3ZVGA 4B73A 5E8EH 1TRYA 4NSVA 5A8ZA 1Y3XA 3BG8A 2VH0A 3PB1E 1LHDH 1VCQA 2CF9H 3UY9A 1TGCA 1XUFA 1O3AA 2VWLA 1D3PB 1WCZA 3QTVH 1LKAA 1AVGH 2R2MB 4D8NA 1Y5UT 4WH6A 4HZHA 4WH8A 5T3HA 5HXFA 3RU4E 2GCHF 4NIWA 4Y0YE 1BTWA 1MKWH 1ABJH 1M9UA 1S0RA 3SUGA 2ZCHP 3LONA 1W13U 1EKBB 1KLJH 3C1KA 1C5MD 2GV7A 2PKAA 4NSYA 1NO9H 1QRWA 2A4QA 3GDVA 2PW8H 2RDLA 3R0FA 3UNQA 1THSH 1KY9A 1J8AA 1VITF 7KMEH 1ANCA 2GX4A 3RXCA 4MPUA 2ZF0H 2O8MA 1A4WH 4AX9H 2FI3E 5DP4A 4K1TA 2GCTC 2QF0A 3SBKA 1ZTLA 3SGQE 4J2YB 2QXIA 1F5RA 4OGYA 3MU1A 1IQNA 1IHSH 1B5GH 3SNCA 1WOFA 1JMOH 1CT4E 2AMDA 3A86A 1BBRK 1HFDA 4ZHMU 1ZSKA 3P92A 4NZQA 1ZHRA 2PUXB 3QN7A 2HPQH 1PQ7A 1XKBC 3MH4A 1O2MA 2O8LA 1L1NA 3NKKA 1P3CA 3U1IB 4FU9A 1EPTB 1AHTH 4IMQA 1OP8A 3BV9B 1SVPA 3RXRA 3TGIE 3BTTE 3URDA 5F8ZA 1BTPA 5T6DA 2ANMH 1OX1A 1BDAA 1SQTA 1ZSLA 2QXHA 2ZGBH 4X6NA 3SHCH 5DP9A 1UTJA 1LVBA 2UWOA 1E34B 2A2QH 3UQVA 4UE7H 3SI4H 3E6PH 1V2RT 2ZHFH 4ABFA 2WV4A 3FFGA 1O2KA 2ZO3H 1MAYA 1SGIB 1C5YB 4DW2U 1XVOA 2G52A 1GMDG 1P2MA 2R2WU 4CR5A 4LZ1H 1AMHA 2Y7XA 3FVFB 4MPXA 1DY8A 1F5KU 4O3UA 5DJ7A 1O36A 3A7TA 5EG4A 1GI7B 1Z1JA 3SNEA 3C27B 1ZPCA 4JMYA 3ATLA 4AG2A 1DFPA 1ANDA 3U8OH 5FXLA 4BTTB 1DITH 4VGCC 1T8MA 2CGAA 1C9TA 2ZU5A 4FU7A 1QL8A 2ZGHA 3RXPA 3NPSA 5JBAS 3UREA 1MD7A 1TFXA 3U9AH 1EB2A 1T8OA 1LVOA 4D7GA 1UVPA 1A0LA 1Z1IA 2HNTF 3I78A 3O8DA 3VXEH 3PLPA 5DO4H 3M5OA 1OWJA 3RLWH 2ZTXA 3GY3A 1ELAA 4XFQA 1GDUA 2JETC 1OWEA 1A0HB 2R9PA 5JB9S 3RXSA 1SGNE 1FY5A 3S7KB 2VIQA 1K1IA 3ZVCA 1DOJA 4AFSA 1VR1H 4GHTA 3GCTF 1A3BH 4INHA 1HAPH 2ZC9H 1JRSA 1CT2E 1INCA 2VVVA 4ZUHA 5L2ZH 4D7FA 3DFJA 3UR6A 3MO9A 2OBQA 3U8TH 4ZAEA 2HALA 1NRSH 4XBBA 1TGBA 4JZIA 1F0SA 3MOCA 1EQ9A 3SV9A 3HK3B 3SNDA 1H8DH 3UWIA 1D9IA 1V2LT 1UVTH 1EJAA 1YPGH 4CRDA 1DT2A 2A7HA 4HGCA 1MZDA 4X8UH 3TJVA 1BIOA 1QRZA 1N6YA 3TK9A 4ABGA 5J4SA 4Y11E 1J16A 1O3NA 3F6UH 1Z71A 2Y7ZA 4UFFH 2VIPA 4K60A 2PKAB 1YCPM 1BUIA 1QR3E 2EC9H 3ZZDA 3TK6A 2ZFTA 2GV6A 1EXFA 3LU9B 3PYHA 1SGYE 8LPRA 2UWLA 1Y59T 3ZZ7A 1QHRB 3UIRA 2V0BA 2WPLS 5DP3A 1GVLA 2DE8A 1E35B 1LHEH 4NWLA 5A0BA 1NPMA 1TPAE 2FI5E 1O3CA 1KXDA 1O3LA 3E91A 5C2ZA 4RKOB 1GBIA 5E2OA 1GVKB 4KP0A 1XUJA 2BLOA 3M35A 1AKSA 1AWHB 1OWHA 2OXSA 1FY8E 2BD2A 1RRKA 3HATH 3RM0H 3NXPA 1K1OA 7GCHF 4TPIZ 1SL3A 3BEFB 1O3BA 1ZPBA 2FOCA 3MU0A 4U01A 4KTCA 4E06H 3PTBA 1F0UA 2KAIA 3ZYEA 1AUJA 2FOGA 1JRTA 1GMHF 1W0ZU 3D23A 2WINI 1LPKB 4KTUA 4Y8YA 5E0HA 4AFQA 1EJNA 1S81A 4IC5A 5ETXA 4FUCA 1P09A 1BMAA 3KHVA 2OINA 2ILNA 1ELCA 4J1YA 1AFQC 1OOKB 2ANWA 2H9EH 1C2FA 3PWBA 3SU0A 3LOXA 1P9SA 2XC5A 1C2JA 3PWCA 2A7CA 4YT7H 1TMTH 1C2KA 2F9UA 2VGCC 1Q31A 5EQQA 1GHVH 1OPHB 1DDJA 1TABE 3ZVDA 1C5NH 4O9VA 2TBSA 2G5NA 2Q1JA 2FTMA 3MH6A 4XDEA 2ZU4A 3URCA 1MTNC 4NIYA 3GY6A 3MO6A 1CQQA 3MU4A 4DY7B 1S84A 4X1PU 4YM9A 1FV9A 1PPCE 1NROH 2P8OB 3LT3A 3RMOH 3BTQE 3VFEA 4I8JA 3EA8A 1L1JA 4CBNA 5EW2H 2BXTH 2FOAA 2NU3E 5C1UA 1W11U 1ANEA 2LPRA 6LPRA 1EPTC 5BRRE 2ZGJA 4CHAB 4ESTE 2CN0H 4SGAE 1FN6A 1T8NA 3NZIA 1OKXA 5AF9H 3D49H 4UD9H 1RD3B 4K69A 4X2WA 5EPYA 3SV6A 4YLQH 1W14U 1DWBH 1E38B 3LH1A 5FCKA 1VZQH 3RXEA 4X1RU 1ZOMA 2CXVA 2D2DA 2P93A 1JWTA 2XWBI 1FLEE 2O9QA 1J15A 5FBEA 3M7TA 3P8FA 5ESBA 1TNGA 1AE8H 2TGPZ 1C5LH 1VGCC 2FS9A 1GI9B 2FOFA 2FO9A 3F9EA 1V3XA 1AVXA 3UNSA 2G00A 3AVZA 4AB8A 1BMMH 3BF6H 3OY6U 1A5IA 4INKA 5E0GA 2JH0D 3TJOA 2A4RA 1YLCA 2TPIZ 4X6MA 1GMCG 1EP6A 1ZGVA 1MCVA 4ZH8A 2ZDAH 1P04A 3TH3H 1ZR0A 1PJPA 1O2JA 1C4U2 3LJOA 1O2WA 1FAKH 1LKBA 1TX7A 4B71A 2Y6TA 1TGSZ 1O5EH 5GJ4B 1DWEH 3IITA 4MNYA 3B8JA 4IMZA 1CVWH 1UK3A 2A2XH 1GBHA 1ORFA 1ELTA 2ZFRH 1C5SA 1C1TA 2GKVE 3KL6A 2AFQB 1TONA 4MPVA 1TIOA 4E05H 2CJIA 1GHAF 1HAXB 2BD4A 5C3NA 1AKSB 3HPTB 2FP7B 3MYWA 1WQSA 3T28A 3BTGE 1BTXA 2UUFB 1SLXB 1AB9B 1HLTH 1KLTA 1O5AB 1BBRE 4CRGA 1OYTH 2KAIB 1V6DA 2Y5GA 2Z94A 2P16A 2HWLB 4WVPE 1C5OH 3LPRA 1B0EA 2O8TA 3TU7H 1BBRH 1G2MA 1S83A 1GBDA 4GLYA 4JZEH 2FI4E 5JPMH 3TGJE 3D65E 3A8CA 5FX6A 1ELDE 3RXJA 2OUAA