3I78A

35/99/170/186/220-loops of fxa in sgt
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
229
structure length
229
Chain Sequence
b'VVGGTRAAQGEFPFMVRLINEENEGFCGGALYAQDIVLTAAHCVSGSGNNTSITATGGVVDLQSSSAVKVRSTKVLQAPGFTKETYGKDWALIKLAQPINQPTLKIATTTAYNQGTFTVAGWGANREGGSQQRYLLKANVPFVSDAACRSSSSFILVANEMICAGYDTKQEDTCQGDSGGPMFRKDNADEWVQVGIVSWGEGCARKGKYGVYTEVSTFASAIASAARTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Combinatorial Enzyme Design Probes Allostery and Cooperativity in the Trypsin Fold.
pubmed doi rcsb
source organism Streptomyces griseus
molecule tags Hydrolase
total genus 56
structure length 229
sequence length 229
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3i78A02
1Z8GA 2J9NA 4X2WA 4X2YA 4DGJA 1M9UA 1TALA 1NRRH 2WV4A 3BTME 1TWXB 3MOCA 1O2VA 5GCHG 1GGDC 2XYAA 1Z8JB 4KELA 3AVZA 2Q6FA 5T6GA 1DLKB 3S7HB 1Y3YA 4XSKU 3JZ1B 1O38A 1HIAA 4UFEH 1C5WB 1TIOA 1KDQB 3GY5A 2SGFE 2ZQ2A 2VIQA 1F92A 1OS8A 4WMFA 2UUFB 4WXIA 3M5OA 3SJ8A 4D8NA 2FDAA 1LCYA 1MD8A 2H2ZA 2ZU3A 3LJJA 1CT4E 1MTNB 1AFQC 1T8NA 2A7HA 5K7RA 4K1EA 1C2GA 5AVDA 4NGAH 5IYTA 1C2KA 1C5XB 1A0HB 1RTLA 1SLVB 3BSQA 3S0NA 2ZTXA 5FXLA 2UWLA 1V2ST 1ANBA 2Y5HA 1C1UH 4MLFB 2VVUA 4WMEA 3PWCA 2BDAA 1EPTB 1PPEE 1GBMA 2ZDNA 3LONA 2QV1A 1S6FA 5C5OA 1DUAA 3EA8A 1GVKB 1E0FD 2FYQA 1TMBH 1S82A 1SG8B 3RMOH 3LC5A 1RTFB 2F91A 3QTOH 1C2IA 1E38B 3GY2A 2J4IA 3KF2A 3BTQE 1AU8A 4ESTE 1UJ1A 1O5BB 1TRMA 3RDZA 3ZV8A 1E35B 4AORA 3TK9A 1ANEA 4A7IB 3H5CB 1O35A 3BN9A 1HJAB 4BAMB 1KTSB 1MU6B 2OQ5A 2WINI 1DXPA 1O3KA 1QBOA 2R0KA 1RD3B 1ZYOA 1SGCA 1CA0B 3SQHE 1S0QA 3Q3YA 2QXHA 1C2DA 5E0GA 1TOCB 3BTTE 2CGAA 1A7SA 3PMHB 4DURA 3NUMA 1TB6H 2GT7A 4AOQA 4IW4E 2BD7A 2SGPE 1JRTA 1EB2A 1SGTA 3RC4A 3KN2A 5HXFA 2R2WU 1BTPA 4K1TA 3HGNA 4MNYA 2PKAA 5EXLA 1GCTC 2F9UA 2ZCKP 1HAHH 1SGEE 1NRSH 3LGIA 1DVAH 4ZH8A 2ZIQH 3Q00A 1K1IA 2ZHDA 1K1JA 1QA0A 2BD3A 3ZV9A 4X2XA 1DWCH 3RXPA 1TRNA 4ABAA 3SJ9A 1BTXA 3BTKE 1O30A 3FAOA 2K1QA 2Z9GA 1LKAA 3RXLA 1OX1A 4WMDA 3MFJA 2FOFA 3GYMA 1VZQH 3U98H 5HMAA 4RKOB 1EZSC 1TA6A 4KKDA 5EW1H 3LU9B 4I8JA 1GBCA 3MH5A 3FZZA 4K5ZA 4X6OA 3G01A 4LZ1H 3T28A 2FOGA 3EGKH 4YLUA 1J15A 7GCHG 5LPRA 2DE8A 3P6ZB 1O32A 4JK6A 2VIPA 2FS8A 2LNCA 1Q31A 3PMAB 2Q1JA 4FUGA 5EPNA 4NZLA 4BOHA 1FPCH 4CHAC 2R9PA 3O8DA 1K22H 2BD8A 1NM6A 3PROA 3P95A 1GJ6A 3M5NA 5JPMH 1G2LA 2A4OA 4A1TA 3BTHE 3ELAH 3M3TA 5FBIA 1SGRE 5C20A 2O8TA 1TE0A 2H9HA 3ZZ8A 3EYDA 4Y8XA 1XUGA 1E34B 1NU9A 1AVWA 1O34A 1Z6JH 1GJBB 2OLGA 2GZ9A 3SV2H 5EW2H 4MPWA 1TOMH 3TJVA 1D9IA 4MPVA 2C8XB 3A81A 2GV6A 2A4QA 3GY7A 3TLOA 1TGBA 3RXKA 1W14U 3A89A 3MNXA 2BDYA 2P93A 1CQQA 1WSSH 2ZDLA 3KIDU 4FUHA 2ZGXH 3S9CA 2ALPA 4YM9A 3BG4C 2HOBA 2VIVA 3QUMP 4AG1A 1OWIA 1C5LH 3O8CA 4Y71A 3KQDA 3HATH 2ANWA 2NU3E 1NPMA 3SN8A 1IQNA 2A4RA 4AB9A 4ABHA 1MTSA 2Z3CA 4JZDH 3OU0A 4YTAA 4INLA 4MPXA 1ZTJA 1SMFE 1GHWH 2ZFTA 2GTBA 4H42U 1YCPH 1QRWA 2Y81A 2WPIS 2FLRH 1L4ZA 4IGDA 5DP7A 1Z8IB 3TU7H 3PLKA 2G00A 2I6QA 4NFEA 1H1BA 4OS4A 1ANCA 1BUIA 4INKA 1CGHA 2XBXA 2WYGA 1A5HA 1NRNH 1BMAA 2XRCA 1GL1A 1IQIA 1SQTA 3K9XB 1FDPA 1L1NA 2CXVA 4Q2KA 1V2KT 1OWJA 4GHTA 1IQGA 1F5LA 3T25A 2BLOA 1Y3UA 3DA9B 3QX5H 3MI4A 1J14A 3M36A 3UOUA 1QJ6B 2PV9B 1C1OA 1THPB 3A7YA 5JBBS 3IG6B 3SU2A 1HAPH 3R0FA 4DT7B 1XVOA 1C9TA 3HKJB 5TCCA 1RIWC 3UNRA 2SGQE 4FVDA 1GI4A 3MNCA 1MZAA 2JH6D 4JZEH 1C1QA 3BTEE 2VNTA 1JMOH 4WH8A 3HGPA 1B5GH 5BRRE 2XCNA 1O2ZA 3A80A 3MU8A 3ATMA 4YOGA 3VXFH 1GMHF 3GY8A 4D9QA 1T4UH 1YPKH 1EX3A 2VH6A 1W13U 4XDEA 8GCHG 1RFNA 2BD5A 1YCPM 1QR3E 1GHAG 1NY22 3RLWH 1C1NA 1EATA 3PYHA 5JBTA 1DWEH 4ZHAA 4PROA 5HM2A 3VB6A 1BT7A 3UQOA 4B74A 4MDSA 2Z94A 1CE5A 1PPGE 3URDA 1EXFA 1P2JA 2YNBA 3SJOA 5FPSA 6ESTA 3DFLA 1V2JT 1LVOA 1XMNB 3GISB 5A8XA 3ATWA 1W0ZU 2B7DH 2QF3A 5GPIB 5ETXA 1G30B 2ZHEH 3EDXB 2XCFA 5DJ7A 1P2MA 1SGDE 1HAXB 2UUKB 3D62A 3IWMA 1FZZA 3VEQB 3BEFB 3LGYA 2OC0A 1LTOA 4Y8YA 4ABIA 4NIYA 1DT2A 4B76A 2P16A 4CRCA 5ESTE 2AMPA 1NO9H 2GDEH 2FEQH 1E36B 3SBKA 1JOUB 4BTUB 3MH6A 2G5NA 1CT2E 1WV7H 3RXFA 1EASA 4MNVA 3ZZBA 4JZ1A 4BTIB 4K8YA 1HCGA 4K69A 3SNDA 2P94A 2PW8H 1O3JA 2BXUH 3GCNA 4JYUH 3STJA 5J4QA 2VIOA 1TBRH 2XBWA 1LVBA 3RXMA 2AERH 2FYRA 3FVFB 7LPRA 2V35A 1A1RA 3LC3A 3TGJE 3T2NA 4D7GA 1CO7E 4X8TH 2M5TA 2ZU5A 2ZPQA 3NPSA 1JWTA 1QHRB 3VB3A 3RM0H 1O39A 1L4DA 1XUIA 3V0XA 1O3EA 1ELGA 1O31A 3KQEA 4NWLA 4JMYA 1T8OA 2OINA 1P0SH 3MWIU 1P10A 2QXIA 3NXPA 1ZTKA 3QTVH 1UTJA 3RXJA 1DDJA 1Z1JA 1ZPCA 3ZVCA 2BDGA 3AASA 4I8HA 1WOFA 3QWCH 1C1TA 1ELTA 4NCYA 4B2AA 2A4GA 2SGEE 2GKVE 2V0BA 1GBHA 5IDKA 1P02A 1PPFE 1CHOF 4MQAA 1OWHA 1W0YH 7GCHF 1J8AA 1CBWB 4AGJA 4U2WA 5JB9S 4B2CA 1FPHH 8ESTE 1MQ5A 2VB0A 2FESH 1BDAA 2WPHS 4ISNA 4OS1A 1O2SA 2QF0A 4H6SB 1GMCF 1P57B 3VGCC 1NTPA 3A85A 1BCUH 1OYQA 2A0QB 4YT7H 1O2QA 4JCNA 4AZ2B 3LGTA 3TK6A 3M3SA 1AVGH 5EODA 1L1GA 1C2FA 3U1JB 4UFGH 1F7ZA 3RXEA 1YPMH 3SUFA 1XUKA 3MU5A 1RXPA 1QIXB 1SGIB 3PV4A 1SHYA 1HBTH 5JBAS 1F5KU 1GHXH 4HTCH 1FN6A 3OSYA 3LGWA 2Z9LA 2BTCE 2VWOA 1AKSB 3K2UA 4BNRA 1TRYA 1AWFH 3ZZDA 3U8TH 2GZ7A 1HV7A 2Q6DA 1P2OA 2A5AA 4SGBE 4XE4A 1SLUB 3A87A 1NROH 1RJXB 1ZJKA 1P06A 3SJKA 1JIMA 2GMTC 1AVXA 3RXDA 1GBDA 2D1JA 1JBUH 1O2MA 3LKWA 2TGTA 2WPKS 2P8OB 2IN2A 3PTBA 1BRUP 1BOQA 3W95A 3H7OA 5TCAA 4NZQA 4E06H 3SQEE 3LOXA 4DCDA 1KXBA 1QCPA 2OC8A 1WQVH 1C9PA 1GBTA 4WJG2 1BQYA 2ZFRH 3SUGA 2FODA 4R8TB 1GDNA 3MHWU 3Q3KA 2GT8A 1JXPA 3PM3A 2OUAA 4TWYA 1C2HA 2FPZA 1C1VH 3RXQA 1P01A 2SGAA 1UHBB 1WTHD 3C27B 1GL0E 1BTWA 2Z9IA 5I46H 4XBBA 1ZMNA 1D4PB 1DXWA 1A61H 1BHXF 1GI6A 2VIDA 1FY4A 4YOJA 3A8CA 3U8RH 3VPKA 2WUBA 1V2UT 1TNGA 4UD9H 3V12A 1UVSH 5EQQA 4LK4A 1YPEH 1GGDB 1NRPH 1IHTH 1U6QA 1V2WT 1TLDA 2Z3EA 1BBRH 4X2VA 1HLTH 3M5LA 5A0BA 1O2IA 2AEIH 1K21H 3ZVBA 1QBVH 1O2WA 2WYJA 1DPOA 1G3EA 4U32A 5A2MH 2A5KA 2D2DA 4AYYB 2OQUA 4O97A 5K0HA 3RXVA 4FU8A 1ZSLA 1O3MA 1SPJA 3SU0A 1UTOA 2HLCA 2PLXA 2P3TB 1O3HA 1O2RA 2ANMH 1AFQB 3SGBE 1QURH 1BIOA 3RXBA 1O3AA 2HNTE 3OX7U 2FMJA 1W7GH 2BY9X 4RN6A 2XC5A 1OSSA 2W5EA 1GHAF 3TITA 5E8EH 1UCYH 1K1MA 5E2PA 3RU4D 2B9LA 3SV7A 1GI1A 2BMGB 1SGNE 2FXRA 2QIQA 5ESBA 4Y7BA 1YYY1 1QA7A 1GMHG 1QJ1B 2EI8A 1CT0E 2IPHA 4ABJA 1XUFA 2O8WA 1ZSJA 1HJ9A 1P2KA 4Y76A 1W3CA 3L3TA 1P11E 3RXHA 5GDSH 1C5VA 4IC6A 4IN1A 3QO6A 3TPIZ 1G2MA 2GP9B 1BMLA 1J16A 3UIRA 2XW9A 3GCTF 4DVAU 1NFXA 2BXTH 2AIQA 1VR1H 3BF6H 2F9PA 4CRGA 3F1SB 5J4SA 1CVWH 5FPTA 2AIPA 1AFEH 3SORA 2V3OH 3ZZ5A 2PTNA 1FI8A 2QCYA 2FOMB 4ZAEA 3RXIA 1QB9A 1YPLH 1VITG 1J9CH 4X1RU 1A4WH 1GCTB 3E0NB 4KGAA 1IOEA 2AGGX 1ZPZA 1MTUA 5FBEA 1LO6A 4FUEA 1BRBE 2YNAA 1MZDA 4UE7H 3I78A 1KIGH 3SHAH 2A7CA 4LXBH 1W2KH 3UPEA 1NRQH 1HAIH 3LH1A 3UR6A 1GCDA 2VVCA 3T26A 4MNXA 4GUXA 1KXAA 2FM2A 2O8LA 5F8XA 3SV8A 2H9TH 3ZVFA 2ZHQH 5CHAC 1C2JA 1T32A 3S9BA 2J2UA 2WUCA 4CBNA 1O3BA 1LQDB 3CS7A 2BD2A 4BTTB 2XBVA 2R3YA 3NWUA 1GI2A 4ZHMU 1O5DH 1BTYA 1P2QA 4X8VH 3OYPA 4RKJB 4CHAB 1V2QT 4NA7A 1BITA 2JH5D 2ODQA 3LH3A 1FIWA 1ZLRA 2G5VA 2QGRA 1ZTLA 4FUBA 3R3GB 4Y8ZA 4E7RG 1P04A 1TPOA 1GJCB 2R3UA 2J94A 2C8WB 1INCA 2JETC 1S81A 4X1NU 1J17T 1V2LT 1NFWA 2PKSC 2HRVA 5DP5A 2HPPH 3MH4A 4AGKA 1Y3VA 1ZRBA 1UCYK 3ZVAA 3SGAE 9ESTA 1AE8H 1SOZA 2FOEA 3MYWA 2ASUB 4X8SH 5FCRA 1K9OE 3E0PB 1DFPA 1H8IH 1IQFA 2LPRA 1G3DA 1O2TA 1HDTH 1N8OC 1CHOG 1EOLA 5DKMA 3BG4B 1O2XA 3UY9A 3NZIA 1UTNA 1SQAA 2W3KA 3BIVH 1HIAB 4D9RA 1W8BH 1C1PA 2BOHB 1V2OT 1F0TA 1YF4A 3E3TA 1P3CA 2FO9A 1GMCG 1MMJN 1O2UA 4GPGA 1ELBA 1PPZA 3QZRA 1QL9A 5T6DA 3VB7A 2BB4A 1ZHMA 3QN7A 1F0UA 5DO4H 4UFFH 1T4VH 2SFAA 4DG4A 3A7TA 3AAUA 1OKXA 5DK1A 3CS0A 1OXGA 2FTLE 2CV3A 1GVLA 1P2NA 2BY6X 1NU7B 1OP2A 2BX4A 4JYTA 1O3PB 1H9IE 2FX6A 4R0IA 1BTZA 2PGQB 4X6NA 2ZPRA 3RUOA 1Y8TA 1YPGH 1RS0A 4F4OC 2STBE 5FCKA 3I77A 4WVPE 2PSYA 1UTQA 2OBOA 4CR9A 2BD9A 2P59A 1KTTB 3PWBA 1FAXA 3FANA 3I29A 3KNXA 4J1YA 2OC1A 4A5TS 1PYTC 2OCVB 4TPYA 1TX6A 1F2SE 3A7ZA 4WY3A 3O8BA 1UVOA 1V2RT 1RIWB 1B0FA 1MAXA 3SNBA 2BVRH 1NN6A 2XXLA 2GX4A 4ZXYH 1TNKA 1KYNA 3GY3A 1NS3A 1CHGA 2Y5GA 2SNVA 3MU1A 3SU3A 3EAJA 3RMLH 4JZIA 3WY8A 3GYLB 4O3UA 2RA0A 5F6MA 5C5NA 2QYIA 3EA9A 1S0RA 1O5AB 3QDZB 3KQCA 3TJUA 4E05H 1GJ9B 2V3HH 4ABFA 4X6PA 4X0WU 1N6YA 1FIZA 3N7OA 2W7UA 1AY6H 3U8OH 2ZGBH 1SQOA 2W3IA 3F9EA 3SU5A 3S69A 3VB4A 4AFQA 1RRKA 1DITH 1ID5H 1LPKB 2HWLB 2A32A 1SGYE 4FUCA 2FP7B 3U9AH 3M7TA 5EQSA 1K1NA 1Q2WA 1UK4A 3FFGA 1HGTH 1K2I1 1KSNA 2C93B 1FLEE 1GHBF 4TYDA 3A83A 3TGKE 2ZU1A 2ANKH 2F3CE 2EC9H 1K1PA 1EJNA 3ZYEA 4UONA 8LPRA 1KXEA 3TH2H 1ZHPA 3QZQA 1T7CA 1F5RA 5FPYA 2BY8X 1Y5BT 3T27A 1V2NT 2ZGCA 2ZZUH 3M3VA 5AF9H 2AH4X 2THFB 2Z9JA 2FI5E 2VWLA 2STAE 4Y7AA 5E2OA 1G9IE 3D23A 3K6ZA 1TGSZ 1BHXB 5EPYA 4Y0YE 4F49A 1TPAE 1FNIA 1PPHE 4CRBA 1VJAU 1SGFG 2Y80A 2W7SA 1IHSH 3SUDA 2BLWA 2NU4E 2YOLA 2Y5FA 2ZHFH 1DX5M 3PB1E 2ZTZA 3ZZCA 1CU1A 2J38A 5I25A 7ESTE 1V2MT 1FY1A 4LZ4B 3HK3B 1O5FH 3BIUH 3GDVA 1TGNA 5L30H 1GI9B 3TH4H 2FTMA 3M7UA 1Q3XA 1QY6A 4AFUA 1DWBH 1PFXC 2GVFA 3GCTG 1WU1A 1NT1A 2ZEBA 1VITF 2GDDA 4AFSA 4Z6AH 5HYOA 2G81E 3SUEA 4KTCA 1O5EH 3ZZAA 1THRH 3DUXH 1DS2E 1GBAA 3EQ0H 1SB1H 1T31A 1PJPA 1VGCB 3QGNB 4NIVA 1Z6EA 3S7KB 4BAQB 4ZKSU 3PLBA 1ARCA 2ZGHA 4XBCA 1K1LA 4I8KA 4DIHH 4INHA 4GAWA 3A86A 3Q76A 6GCHF 4X1PU 1AKSA 1AQ7A 4D7FA 1C5QA 4SGAE 3NCLA 4FVBA 1AZZA 3LGUA 1A3BH 2FOCA 2RDLA 3SGQE 1YCPK 4Y11E 5GIBA 1D6RA 3ENSB 3TGIE 1D6WA 4ABBA 4K60A 1V6DA 1EJAA 1HJ8A 1YLDA 4B1TA 2F9NA 1AGJA 5CE1A 4MG3A 1P09A 1C5NH 1AUJA 2DUCA 3RC5A 1HAVA 2EI6A 1MCTA 3PMBB 3VGCB 4AB8A 1AHTH 1IQJA 1PQAA 1TQ0B 2ZKSA 4YLQH 3P8FA 4RSPA 2BLVA 5L2YH 2XC0A 1VGCC 4FUIA 1O2JA 3BTGE 1H4WA 2UUJB 2PSXA 3BTFE 3E90B 1UHBA 1ELEE 1CA8B 1O2YA 3MU0A 4ZKNU 1ZHRA 2TRMA 4FU7A 2H5CA 3AW1A 1MQ6A 2HNTC 1HRTH 1MKXH 3A88A 3UR9A 4FUDA 1O2HA 2GGVB 4IS5A 4HZHA 2QY0B 3VFEA 4B2BA 1VITH 2ZFQH 3LIWA 1O3CA 4ASHA 4VGCC 4KTSA 1W10U 2GMTB 1A5GH 4Y10E 1AD8H 1LDTT 1Y5AT 1XXFA 2NU0E 4D76A 1EZUC 2BYAX 4NA9H 2QC2A 3M37A 1PPCE 3EA7A 2BVSH 3VB5A 1C5SA 3BEUA 2FS9A 1ZRKA 1AO5A 1GI3A 2CN0H 1BBRE 1P03A 1QB1A 4XFQA 2FLBH 2XBYA 1MH0A 1OP0A 1O36A 1AMHA 1XX9A 1D3DB 1ZGVA 2PR3A 1LPGB 1TA2A 3SW2B 2NU1E 2A2XH 2A5IA 5AFYH 2AMQA 3SO3A 1SHHB 3A7VA 1EB1H 2Y6TA 4DOQA 4GSOA 1YLCA 4ABEA 4OS5A 5A8ZA 1LHGH 3EE0B 2ODPA 2SNWA 3TNTA 4CH2B 1A3EH 1QFKH 1W12U 1UCYE 2ZFPH 1C4U2 1GI8B 1O2PA 2BM2A 2OD3B 5T3HA 1GBKA 3T5FH 5PTPA 3AW0A 1UVTH 1KDQA 1LMWB 4J2YB 1JIRA 1BRAA 1SGPE 4I8LA 1AZ8A 1Y59T 2ZO3H 2VGCC 1TNJA 5JYIA 4YO9A 1MTVA 2OC7A 2QXGA 1WAYB 4CBOA 1O5GH 4H4FA 2H5DA 3RXAA 1TX8A 2BD4A 4UDWH 4BAOB 3Q77A 2DE9A 3MH7A 1C5RA 1PYTD 1GBIA 1K1OA 5C67A 1TNHA 5A09A 2OBQA 1EPTA 1C2EA 4B75A 1EAXA 2JKHA 1N6XA 3UFAA 2F9VA 1SGQE 1AB9C 5SGAE 4Q7XA 2WPMS 1XKAC 3P17H 1TQ7B 2B5TB 2BZ6H 1UTMA 4AX9H 1FONA 3ZZ9A 1O3LA 4ZROA 1A2CH 2G4TA 1THSH 3RXRA 5EOKA 4I8GA 1TMTH 2G51A 4BAKB 1ANDA 1AI8H 1H9HE 1TPPA 1ARBA 1MKXK 1OPHB 3MTYA 3SOSA 2BHGA 3HPTB 2CMYA 1C5ZB 2FI4E 3LJOA 5E0JA 2QAAA 1O0DH 2ESTE 1FY3A 1W7XH 5C1XA 3VXEH 3MO3A 2ZG0H 1GHBG 1E37B 2AYWA 2G55A 5TJXA 3GY4A 1GDUA 3PO1C 3SNCA 1P2IA 1SLWB 5EXNA 2A7JA 2O8UA 5DP8A 3LGVA 2WPLS 1MD7A 4GCHF 4CRAA 1XKBC 3ZVEA 1KY9A 1LVYA 4X1SU 3A84A 1N1LA 1PQ5A 2PHBA 3E16B 3UNQA 3A82A 3NKKA 1B0EA 3U69H 2RA3A 2HNTF 1BJUA 1GPZA 2TGAA 1L0ZA 2ZP0H 3UUZA 3UOPA 4CR5A 6CHAC 4IMQA 3TVJB 1O2KA 3GDSA 1SVPA 2BY7X 4IC5A 2BY5X 1DANH 1HAOH 1ELCA 1Y3XA 1DY9A 1OWKA 1SFQB 3SU6A 3GCOA 1OOKB 1S84A 3JZ2B 1FY5A 1G36A 2ZTYA 2V6NA 2HPQH 1LHDH 3KCGH 2TGDA 2G52A 1HAZB 1NZQH 5CHAB 1QB6A 1TFXA 1GG6C 4MTBA 1DUEA 1TABE 2ZWLH 2C3SA 4FUFA 2BQ6B 1V3XA 2BLQA 4GHQA 1HXFH 4K8BA 1DE7H 1FMGA 3KEEA 1G37A 2QA9E 3F9GA 3TNSA 3O8RA 3L33A 2GCTC 4FUJA 1P05A 3F9HA 1KLJH 1YKTA 4UFDH 9LPRA 1GJAB 1FQ3A 1XUHA 3RXCA 1P8VC 1MU8B 1SI5H 2PGBB 1RTKA 3M5MA 4Y0ZE 3SHCH 3SNAA 4ZKOU 3MO6A 2CHAC 2JETB 3ZVGA 3LT3A 4JZFH 4QT8C 2EA3A 1DWDH 1C1SA 1YPHE 2PKSB 4Q7ZA 3RXOA 5C1YA 2C4FH 1MAYA 1SLXB 2ZPSA 1GJ5H 4BAHB 1O3GA 6GCHG 3UQVA 4U01A 2AS9A 1QJ7B 5DPAA 4X8UH 2ZF0H 1BTHH 1N8OB 3PTNA 5EQRA 4WH6A 3SI3H 1IQKA 1BBRK 1CGIE 1GI0A 4I33A 2Y7XA 3ATLA 4I31A 2ZHWH 1BTUA 2VH0A 3P92A 3BEIB 2NWNA 2GD4B 2VU8E 1UVPA 5A0CA 2VJ1A 3E8LA 1TBQH 2ZDKA 3GY6A 3PMJA 1MTNC 2TGPZ 1S85A 2OXSA 2VWNA 1OWDA 1A5IA 2SGDE 2NU2E 3HKIB 1EJMA 1C5UA 4NFFA 2KAIB 1GHZA 1IQLA 3F6UH 1EAWA 2PFEA 1TX7A 2F9BH 5EU8A 1GJ7B 2HVXA 1EPTC 1DY8A 2QXJA 2ZQ1A 1YGCH 2A45B 2H9EH 4X1QU 1ELDE 2Z7FE 3BTWE 1HUTH 1D3TB 1AIXH 3F9FA 1JRSA 1LHEH 1O3OA 1K28D 5E0HA 1V2PT 2A2QH 3URCA 1GMDG 1AUTC 1VCPA 3P8NA 3S9AA 4CREA 2BX3A 1HFDA 1BZXE 2ZFFH 5JDUB 1IQMA 2P95A 2TBSA 2AMDA 1ZZZA 1ELVA 1HJAC 4MVNA 1O3FA 1QBNA 4KTUA 3LPRA 3FP8E 1CA0C 3ODFA 3A8DA 2BQ7B 2FX4A 1VCWA 1FN8A 2C90B 2ZC9H 4YZUA 3SJIA 2ALVA 1UK3A 1XM1A 2ZGJA 5GJ4B 4Q7YA 3GDUA 1LHFH 1WQSA 1H9LB 2ZFSA 4M7GA 3ODDA 1P12E 1EUFA 3M61U 4YT6H 1HYLA 1PQ7A 1NFYA 1O5CB 1P9UA 4WXVA 5JB8S 2FWWA 2WPJS 4AN7A 1EKBB 3M35A 4GVUA 1OYTH 1KLIH 1C1WH 3E1XB 4UEHH 5FX5A 1EZXC 1BMNH 4HFPB 1LVMA 3V3MA 2BDCA 2C8YB 5G4BA 5F8ZA 1C2LA 1LPZB 1ETRH 2ZU4A 3IITA 2XTTB 4XOJA 3UTUH 5HM9A 1Z7KA 3P8GA 2EI7A 2BVXH 2FI3E 4AYVB 1EAUA 3M7QA 3KGPA 4KP0A 3ZZ6A 3OY5U 2BQWB 3MMGA 7KMEH 1TMUH 2A1DB 2GCHF 1UO6A 2ZA5A 3DD2H 1TONA 2G4UA 2Z3DA 1GHYH 1GJ4H 5FAHA 3SU4A 1UTLM 3STIA 4YESB 2H1UA 2VIWA 1XXDA 3RLYH 1ABIH 2ZCHP 4HI3A 5HGGA 4ISLA 4I32A 1SGFA 2PKAB 1SL3A 1F0RA 4ABGA 2FZZA 3ITIA 2ODYB 3D65E 4OS7A 1Y5UT 4DIIH 3A7XA 3H7TA 3PLPA 3RM2H 1SC8U 1EAIA 1TGTA 1O2NA 2B8OH 1FAKH 2BDBA 1MBMA 3C1KA 4BXSA 3B8JA 3B9FH 3ATKA 4ZKRU 4O3TA 3U1IB 1ZSKA 2PUXB 3FP6E 1S83A 1X7AC 4IBLH 1IAUA 5FX6A 3CP7A 1GBLA 1GJDB 3DFJA 2Z6BD 3A8BA 4YOIA 2CF8H 2A31A 1SOTA 2UWPA 4MNWA 3MNSA 1EQ9A 4Y6DA 2GV7A 4A6LA 1SR5C 2RG3A 1LQEA 3RXTA 3SV9A 1PQ8A 1FUJA 4NIXA 5LPFA 4GCHG 1C4Y2 2FIRH 2PUQH 1EZQA 1BA8B 1QNJA 1TYNA 5GCHF 2O8MA 3KL6A 4BXWA 2J95A 3KQBA 5CMXH 1YBWA 5LH8A 1ESAA 3NK8A 1CSOE 4B73A 1TBZH 1GDQA 4HGCA 1ORFA 2ZDAH 1TNIA 1DLEA 1O33A 1S6HA 1ACBE 3OTJE 1ABJH 1T8MA 1HPGA 3RMNH 1YPJH 3SZNA 1NESE 1GI5A 2I6SA 2CJIA 2UWOA 4CRDA 5EXMA 3ZVDA 1GHVH 1Z8RA 1ETSH 2BOKA 2ZECA 1G3BA 4ISOA 1OWEA 1QRZA 5DG6A 2GZ8A 1D3QB 2R2MB 1LKBA 1VJ9U 1ETTH 1KXCA 4ZHLU 8KME2 3ZYDA 1EP5A 2HALA 3TJNA 5A0AE 5A8YA 2F83A 3T62A 1B7XB 2UUYA 1DSTA 3E6PH 5EG4A 1O3NA 1KXDA 1GBEA 2FOBA 4JK5A 3P70B 5C2ZA 2HGTH 5H4IB 4NWKA 5AHGH 1SBWA 2PTCE 1QL8A 4GLYA 2P3UB 4VGCB 1GBBA 3FP7E 2BDHA 1UTKA 2ZDVH 1HAYB 4ZMAH 1C5PA 1P9SA 3GICB 1WBGB 3A7WA 1TPSA 1ZOMA 4NSVA 4ZUHA 1MUEB 2XWAA 2C8ZB 3MO9A 4CH8B 1O2GH 2D8WA 2F9OA 4OGXA 3QK1A 2TIOA 4THNH 3W94A 3SU1A 1GVZA 5DP9A 1UTPA 1LHCH 1WCZA 5F03A 1G3CA 1C5MD 1C2MA 1GI7B 4ABDA 4I7YH 4IMZA 4B71A 4DY7B 2J92A 1DOJA 2B0FA 1MKWH 1WUNH 2WV5A 4FU9A 4OS6A 3K65B 4Q80A 1DSUA 1C5TA 2OTVA 1QQ4A 4NIWA 1SSXA 3F68H 1EP6A 2ULLA 1WTGH 3ZZ7A 1V2TT 1ZR0A 4K3JA 5ABWA 1GMDF 4LOYH 2JH0D 2BZAA 1L1JA 1QQUA 3A8AA 3UWJH 1W11U 4K1SA 2PWXA 1O3DA 5L6NH 1GBFA 2ZCLP 2J34A 2FOAA 2R0LA 5DP6A 3RXGA 3V7TA 3RP2A 1C4V2 1YC0A 3RC6A 4U30A 1F0SA 1TNLA 5F8TA 1ELAA 3E91A 4MPUA 3SNEA 3RXUA 3TJOA 1FY8E 3QLPH 2ILNA 3RU4E 1EOJA 2VGCB 1NFUA 2ZU2A 1TAWA 4FXGH 1DM4B 1VCQA 3L6PA 1MBQA 1ESTA 3CENA 1QGFA 3GCHB 4OS2A 4CRFA 2VINA 2AGEX 2O9QA 1Y3WA 4K2YA 1G32B 1A0LA 5GXPA 3P8OA 1WYKA 3ESTA 1BB0B 4JYVH 1AB9B 1AN1E 1C5YB 3HK6B 1DICA 1HAGE 1IQEA 2H6MA 3ZZ3A 3MNBA 2P3FH 1FV9A 3UNSA 3SI4H 3FZDA 1GBJA 3D49H 2D26C 4ISIH 3LDXH 1HXEH 1UMAH 3B23B 1Z1IA 3BTDE 3QGJA 4OGYA 2XWBI 3BV9B 1V2VT 2FOHA 1ZMLA 2ZI2H 1IQHA 3ZZ4A 1QL7A 1XVMA 2CF9H 3MU4A 4TPIZ 3OY6U 1FJSA 4NA8A 1YPHC 4A1XA 1UK2A 5LPEA 4TY6A 4DW2U 1O2OA 4A1VA 1H8DH 1CBWC 5B6OA 5DP3A 1YP9A 1QRXA 4IN2A 1O3IA 1OP8A 4ZXXH 3GCHC 2ZNKH 2ZDMA 5JBCS 3V13A 1BRCE 1C1MA 5FHTA 1D3PB 1HAVB 4WF8A 1C5OH 3PO1B 2AFQB 1NC6A 2XC4A 1AE5A 3KHVA 3TIUA 4O03A 4BANB 2GCHG 1ZPBA 5LGOA 3UREA 2OP9A 2Y82A 3TK5A 2G8TA 3SV6A 1GJ8B 5DGJA 1HB0B 1P3EA 1ESBA 1Z71A 5EGMA 2VVVA 6CHAB 4X6MA 5BPEA 2BDIA 2Q6GA 1AWHB 3ATIA 2IJOB 3K6YA 1SFIA 1XUJA 4H6TA 4XBDA 1QTFA 2VWMA 5GWZA 1MTWA 1MKWK 2IOTA 1MCVA 1KXFA 2Z9KA 1ZGIA 1C1RA 4O9VA 1A46H 1S5SA 1CGJE 1ZMJA 5DP4A 1GG6B 1FXYA 3GOVB 4WWYA 1BMMH 5T6FA 4A92A 1YM0A 1PPBH 1GWAA 1RGQA 3RU4T 4Z0KA 2XNIA 1HNEE 4TY7A 3Q3XA 2P8OC 2Y7ZA 4AG2A 3BG8A 4TWWA 1O37A 2ANYA 2RCEA 5L2ZH 3RXSA 3UWIA 3DHKH 2GCTB 4AFZA 1UVUH 1A0JA 1L2EA 1ZJDA 1O2LA 4NG9H 4NSYA 4DJZB 3DT0H 4Y79A 2CHAB 2EEKA 3RMMH 5C3NA 3AAVA 2KAIA 5C1UA 3T29A 1KLTA 6LPRA 2TPIZ 8GCHF 4ISHH 5AFZH 1T8LA 3TH3H 1ELFA 2QN5T 1BJVA 2AGIX 2W26A 1TGCA 4E7NA
chains in the Genus database with same CATH superfamily
1Z8GA 2J9NA 4X2WA 4X2YA 4DGJA 1M9UA 1TALA 1NRRH 2WV4A 3BTME 1TWXB 3MOCA 1O2VA 5GCHG 1GGDC 2XYAA 1Z8JB 4KELA 3AVZA 2Q6FA 5T6GA 1DLKB 3S7HB 1Y3YA 4XSKU 3JZ1B 1WXRA 1O38A 1HIAA 4UFEH 2K0QA 1C5WB 1TIOA 1KDQB 3GY5A 2SGFE 3N7DA 2ZQ2A 2VIQA 1F92A 3OEHD 1OS8A 4WMFA 2UUFB 4WXIA 3M5OA 3SJ8A 4D8NA 2FDAA 1LCYA 1MD8A 2H2ZA 2ZU3A 3LJJA 1CT4E 1MTNB 1AFQC 1T8NA 2A7HA 5K7RA 4K1EA 1C2GA 5AVDA 4NGAH 5IYTA 1C2KA 1C5XB 1A0HB 1RTLA 1SLVB 3BSQA 3S0NA 2ZTXA 5FXLA 2UWLA 1V2ST 1ANBA 2Y5HA 1C1UH 4MLFB 2VVUA 4WMEA 3PWCA 2BDAA 1EPTB 1PPEE 1GBMA 2ZDNA 3LONA 2QV1A 1S6FA 5C5OA 3ZIAD 1DUAA 3EA8A 1GVKB 1E0FD 2FYQA 1TMBH 1S82A 1SG8B 3RMOH 3LC5A 1RTFB 2F91A 3QTOH 1C2IA 1E38B 2QE7D 3GY2A 2J4IA 3KF2A 3BTQE 1AU8A 3WW7A 4ESTE 1UJ1A 1O5BB 3OTPA 1TRMA 3RDZA 3ZV8A 1E35B 4AORA 3TK9A 1ANEA 4A7IB 3H5CB 1O35A 3BN9A 2IJD1 1HJAB 4BAMB 1KTSB 1MU6B 2OQ5A 2WINI 1DXPA 1O3KA 1QBOA 2R0KA 1RD3B 1ZYOA 1SGCA 1CA0B 3SQHE 1S0QA 3Q3YA 2QXHA 1C2DA 5E0GA 1TOCB 3BTTE 2CGAA 1A7SA 3PMHB 4DURA 3NUMA 1TB6H 2GT7A 4AOQA 4IW4E 2BD7A 2SGPE 1JRTA 1EB2A 1SGTA 5FL7D 3RC4A 3KN2A 5HXFA 2R2WU 1BTPA 4K1TA 3HGNA 4MNYA 2PKAA 5EXLA 1GCTC 2F9UA 2ZCKP 1HAHH 1SGEE 3FO8D 1NRSH 3LGIA 1DVAH 4ZH8A 2ZIQH 3Q00A 1K1IA 3F2FA 2ZHDA 1K1JA 1QA0A 2BD3A 3ZV9A 4X2XA 1DWCH 3RXPA 1TRNA 4ABAA 3SJ9A 1BTXA 3BTKE 1O30A 3FAOA 2K1QA 2Z9GA 1LKAA 3RXLA 1OX1A 4WMDA 3MFJA 2FOFA 3GYMA 1VZQH 3U98H 5HMAA 4RKOB 1EZSC 1TA6A 4KKDA 5EW1H 3LU9B 4I8JA 1GBCA 3MH5A 3FZZA 4K5ZA 4HG6A 4X6OA 1E79D 3F3BA 3G01A 4LZ1H 3T28A 2FOGA 3EGKH 4YLUA 1J15A 7GCHG 5LPRA 2DE8A 3P6ZB 1O32A 4JK6A 2VIPA 2FS8A 2LNCA 1Q31A 3PMAB 2Q1JA 2WHXA 4FUGA 5EPNA 4NZLA 4BOHA 1FPCH 4CHAC 2R9PA 3O8DA 1K22H 2BD8A 1NM6A 3PROA 3P95A 1GJ6A 3M5NA 5JPMH 1G2LA 2A4OA 2QF4A 4A1TA 3BTHE 3ELAH 3M3TA 1E1RD 5FBIA 1SGRE 5C20A 2O8TA 1TE0A 2H9HA 3ZZ8A 2M2AA 2W6ID 3EYDA 4Y8XA 1XUGA 1E34B 3UAIC 5C94A 1NU9A 1AVWA 1O34A 1Z6JH 2CK3D 1GJBB 2OLGA 2GZ9A 3SV2H 5EW2H 4MPWA 1TOMH 3TJVA 1D9IA 4MPVA 2C8XB 3A81A 3OE7D 2GV6A 2A4QA 3GY7A 3TLOA 1TGBA 3RXKA 1W14U 3A89A 3MNXA 2BDYA 2RDEA 2P93A 1CQQA 4P00A 4M9FA 1WSSH 2ZDLA 3KIDU 4FUHA 1WDIA 1QZ8A 2ZGXH 3S9CA 2ALPA 4YM9A 3BG4C 2HOBA 2VIVA 3QUMP 4AG1A 1OWIA 1C5LH 3O8CA 4Y71A 3KQDA 3HATH 2ANWA 2NU3E 1NPMA 3SN8A 1IQNA 2A4RA 4AB9A 4ABHA 1MTSA 2Z3CA 4JZDH 3OU0A 4YTAA 4INLA 4MPXA 3WWFA 1ZTJA 1SMFE 1GHWH 2ZFTA 2GTBA 4H42U 1YCPH 1QRWA 2Y81A 2WPIS 2FLRH 1L4ZA 4IGDA 5DP7A 1Z8IB 3TU7H 3PLKA 2G00A 2I6QA 4NFEA 1H1BA 4OS4A 1ANCA 1BUIA 4INKA 1CGHA 2XBXA 2WYGA 1A5HA 1NRNH 4I86A 1BMAA 2YMSB 2XRCA 1GL1A 1IQIA 1SQTA 3K9XB 1FDPA 1L1NA 2CXVA 4Q2KA 1V2KT 5EJLA 1OWJA 4GHTA 1IQGA 1F5LA 3T25A 2BLOA 1Y3UA 3DA9B 3QX5H 3MI4A 1J14A 3M36A 3UOUA 1QJ6B 1E1QD 2PV9B 1C1OA 1THPB 3A7YA 5JBBS 4DT4A 3IG6B 3SU2A 1HAPH 3R0FA 4DT7B 1XVOA 1C9TA 3HKJB 5TCCA 1RIWC 3UNRA 2SGQE 4FVDA 1GI4A 3MNCA 1MZAA 2JH6D 4JZEH 1C1QA 3BTEE 2VNTA 1JMOH 4WH8A 3HGPA 1B5GH 5BRRE 2XCNA 1O2ZA 3A80A 3MU8A 3ATMA 4YOGA 3VXFH 1GMHF 3GY8A 4D9QA 1T4UH 1YPKH 1EX3A 2VH6A 2HVYB 1W13U 4XDEA 8GCHG 1RFNA 2BD5A 1YCPM 1QR3E 1GHAG 1NY22 3RLWH 1C1NA 1EATA 3PYHA 5JBTA 1DWEH 4ZHAA 4PROA 5HM2A 3VB6A 1BT7A 3UQOA 4B74A 4MDSA 2Z94A 1CE5A 1PPGE 3URDA 1EXFA 1P2JA 2YNBA 3SJOA 5FPSA 6ESTA 3DFLA 1V2JT 1LVOA 1XMNB 3GISB 5A8XA 3ATWA 1W0ZU 2B7DH 2QF3A 5GPIB 5ETXA 1G30B 2ZHEH 3EDXB 2XCFA 5DJ7A 1P2MA 1SGDE 1HAXB 2UUKB 3D62A 3IWMA 1FZZA 3VEQB 3BEFB 3LGYA 3EE7A 2OC0A 1LTOA 4Y8YA 4ABIA 4NIYA 1DT2A 4B76A 2P16A 4CRCA 5ESTE 2AMPA 1NO9H 2GDEH 2FEQH 1E36B 3SBKA 1JOUB 4BTUB 3MH6A 4OM9A 2G5NA 1CT2E 1WV7H 3RXFA 1EASA 4MNVA 3ZZBA 4JZ1A 4BTIB 1W0KD 4K8YA 1HCGA 4K69A 3SNDA 2P94A 2PW8H 1O3JA 2BXUH 3GCNA 4JYUH 3STJA 5J4QA 2VIOA 1TBRH 2XBWA 1LVBA 3RXMA 2AERH 3DSOA 2FYRA 3FVFB 7LPRA 2V35A 1A1RA 3LC3A 3TGJE 3T2NA 4D7GA 1CO7E 4X8TH 2M5TA 1NBME 2ZU5A 2ZPQA 3NPSA 1JWTA 1QHRB 3VB3A 3RM0H 1O39A 1L4DA 1XUIA 3V0XA 1O3EA 1ELGA 1O31A 3KQEA 4NWLA 4JMYA 1T8OA 2OINA 1P0SH 3MWIU 1P10A 2QXIA 3NXPA 1ZTKA 3QTVH 1UTJA 3RXJA 1DDJA 1Z1JA 1ZPCA 3ZVCA 2BDGA 3AASA 4I8HA 1WOFA 3QWCH 1C1TA 1ELTA 4NCYA 4B2AA 2A4GA 2SGEE 2GKVE 2V0BA 1GBHA 5IDKA 1P02A 1PPFE 1CHOF 4MQAA 1OWHA 1W0YH 7GCHF 1J8AA 1CBWB 4AGJA 4U2WA 5JB9S 4B2CA 1FPHH 4Q63A 8ESTE 1MQ5A 2VB0A 2FESH 4RT1A 2XNDD 1BDAA 2WPHS 4ISNA 4OS1A 1O2SA 2QF0A 4H6SB 1GMCF 1P57B 2JIZD 3VGCC 1NTPA 3A85A 1H8HD 1BCUH 1OYQA 2A0QB 4YT7H 1O2QA 5GNDA 4JCNA 4AZ2B 3LGTA 3TK6A 3M3SA 1AVGH 5EODA 1L1GA 1C2FA 3U1JB 4UFGH 1F7ZA 3RXEA 2F4LA 1YPMH 3F2HA 3SUFA 1XUKA 3MU5A 1RXPA 1QIXB 1SGIB 3PV4A 1SHYA 1HBTH 5JBAS 3DSPA 1YLNA 1F5KU 1GHXH 4HTCH 1FN6A 3OSYA 3LGWA 2Z9LA 2BTCE 2VWOA 1AKSB 3K2UA 3N99A 4BNRA 1TRYA 1AWFH 3ZZDA 3U8TH 2GZ7A 1HV7A 2Q6DA 1P2OA 2A5AA 4SGBE 4XE4A 1SLUB 3A87A 1NROH 1RJXB 1ZJKA 1P06A 3SJKA 1JIMA 2GMTC 1AVXA 3RXDA 1GBDA 2D1JA 2L74A 1JBUH 1O2MA 3LKWA 2TGTA 2WPKS 2P8OB 2IN2A 3PTBA 1BRUP 1BOQA 3W95A 3H7OA 5TCAA 4NZQA 4E06H 3SQEE 3LOXA 4DCDA 1KXBA 1QCPA 2OC8A 1WQVH 1C9PA 1GBTA 1VKYA 4WJG2 1BQYA 2ZFRH 3SUGA 2FODA 4R8TB 1GDNA 3MHWU 3Q3KA 2GT8A 1JXPA 3PM3A 5C0TA 2OUAA 4TWYA 1C2HA 2FPZA 5C0UA 1C1VH 3RXQA 1P01A 2SGAA 1UHBB 1WTHD 3C27B 4Q4LA 1GL0E 1BTWA 2Z9IA 5I46H 4XBBA 1ZMNA 1D4PB 1DXWA 1A61H 1BHXF 1GI6A 2VIDA 1FY4A 4YOJA 3A8CA 3U8RH 3VPKA 2WUBA 1V2UT 1TNGA 4UD9H 3V12A 1UVSH 5EQQA 4LK4A 1YPEH 1GGDB 1NRPH 1IHTH 1U6QA 1V2WT 1TLDA 2Z3EA 1BBRH 4X2VA 1HLTH 3M5LA 5A0BA 1O2IA 2AEIH 1K21H 3ZVBA 1QBVH 1O2WA 2WYJA 1DPOA 1G3EA 4U32A 5A2MH 2A5KA 2D2DA 4AYYB 2OQUA 4O97A 5K0HA 3RXVA 4FU8A 1ZSLA 3PRDA 1O3MA 1SPJA 3SU0A 1UTOA 2HLCA 2PLXA 2P3TB 1O3HA 3AK5A 4TT3D 1O2RA 2ANMH 1AFQB 3FKSD 1QURH 2VBCA 3SGBE 1BIOA 3RXBA 1O3AA 2HNTE 3OX7U 2FMJA 1W7GH 2BY9X 4RN6A 2XC5A 3MQKC 1OSSA 2W5EA 1GHAF 3TITA 5E8EH 1UCYH 1K1MA 5E2PA 3RU4D 2B9LA 2IPQX 3SV7A 1GI1A 2BMGB 1SGNE 2FXRA 2QIQA 5ESBA 4Y7BA 1YYY1 1QA7A 1GMHG 1QJ1B 2EI8A 1CT0E 2IPHA 4ABJA 1XUFA 2O8WA 1ZSJA 1HJ9A 1P2KA 4Y76A 1W3CA 3L3TA 1SQRA 1P11E 2RFKC 3RXHA 5GDSH 1C5VA 4IC6A 4IN1A 3QO6A 2HLDD 5EJ1A 3TPIZ 1G2MA 2GP9B 1EFRD 1BMLA 1J16A 3UIRA 2XW9A 3GCTF 4DVAU 4TSFD 1NFXA 2BXTH 2AIQA 1VR1H 3BF6H 2F9PA 4CRGA 3F1SB 5J4SA 1CVWH 5FPTA 2AIPA 1AFEH 5KGOA 2V3OH 3SORA 2PTNA 3ZZ5A 1FI8A 2QCYA 2FOMB 4ZAEA 3RXIA 1QB9A 1YPLH 1VITG 1J9CH 4X1RU 1A4WH 1GCTB 3E0NB 4KGAA 1IOEA 2AGGX 1ZPZA 1MTUA 5FBEA 1LO6A 4FUEA 1BRBE 2YNAA 1MZDA 4UE7H 3DSGA 3I78A 1KIGH 3SHAH 2A7CA 4LXBH 1W2KH 3UPEA 1NRQH 1HAIH 3LH1A 3UR6A 1GCDA 2VVCA 3T26A 4MNXA 4GUXA 1KXAA 1S6LA 2FM2A 2O8LA 5F8XA 5HIYA 3SV8A 2H9TH 5DN6D 3ZVFA 2ZHQH 5CHAC 1C2JA 1T32A 3S9BA 2J2UA 2WUCA 2F43B 4CBNA 1O3BA 1LQDB 4RT0A 3CS7A 2BD2A 4BTTB 2XBVA 2R3YA 3NWUA 1GI2A 4ZHMU 2PP6A 1O5DH 1BTYA 1P2QA 4X8VH 3OYPA 4RKJB 4CHAB 1V2QT 4NA7A 1BITA 2JH5D 2ODQA 3LH3A 1FIWA 1ZLRA 2G5VA 2QGRA 1ZTLA 4FUBA 3R3GB 4Y8ZA 4E7RG 3OEED 1P04A 1TPOA 1GJCB 2R3UA 2J94A 2C8WB 1INCA 2JETC 1S81A 4X1NU 3SYJA 1J17T 1V2LT 4ACAA 1NFWA 2PKSC 1COWD 2HRVA 5DP5A 2HPPH 3MH4A 4AGKA 1Y3VA 1ZRBA 1UCYK 3ZVAA 3SGAE 9ESTA 1AE8H 1SOZA 2FOEA 3MYWA 2ASUB 4X8SH 5FCRA 1K9OE 3E0PB 1DFPA 1H8IH 1IQFA 2LPRA 1G3DA 1O2TA 1HDTH 1N8OC 1CHOG 1EOLA 5DKMA 3BG4B 1O2XA 3UY9A 3NZIA 1UTNA 1SQAA 2W3KA 3BIVH 1HIAB 4D9RA 1W8BH 1C1PA 2BOHB 1V2OT 1F0TA 1YF4A 3E3TA 1P3CA 2FO9A 1GMCG 1MMJN 1O2UA 4GPGA 1ELBA 1PPZA 3QZRA 1QL9A 5T6DA 3VB7A 2BB4A 1ZHMA 3QN7A 1F0UA 5DO4H 4UFFH 1T4VH 2SFAA 2KCYA 4DG4A 4B6EA 3A7TA 3AAUA 1OKXA 5DK1A 3CS0A 1OXGA 2FTLE 2CV3A 1GVLA 1P2NA 2BY6X 1NU7B 1OP2A 2BX4A 4JYTA 1O3PB 1H9IE 2FX6A 4R0IA 1BTZA 2PGQB 4X6NA 2ZPRA 3RUOA 1Y8TA 1YPGH 1RS0A 4F4OC 2STBE 5FCKA 3I77A 4WVPE 2PSYA 1UTQA 2OBOA 4CR9A 2BD9A 2J97A 2P59A 1KTTB 3PWBA 1FAXA 3FANA 3I29A 3KNXA 3UB0A 4J1YA 2OC1A 4A5TS 1PYTC 2OCVB 4TPYA 1TX6A 1F2SE 5B6LA 3A7ZA 4WY3A 5KECA 3O8BA 1UVOA 1V2RT 2J98B 1RIWB 1B0FA 1MAXA 3SNBA 2BVRH 2W6JD 1NN6A 2XXLA 2GX4A 4ZXYH 1TNKA 1KYNA 3GY3A 1NS3A 1CHGA 2Y5GA 2SNVA 3MU1A 3SU3A 3EAJA 3RMLH 4JZIA 3WY8A 3GYLB 4O3UA 2RA0A 5F6MA 5C5NA 2QYIA 3EA9A 1S0RA 1O5AB 3QDZB 2WV9A 3KQCA 3TJUA 4E05H 1GJ9B 2V3HH 4ABFA 4X6PA 4X0WU 1N6YA 1FIZA 3N7OA 2W7UA 1AY6H 3U8OH 2ZGBH 1SQOA 2W3IA 5EJZA 3F9EA 3SU5A 3S69A 3VB4A 4AFQA 1RRKA 1DITH 1ID5H 1LPKB 2HWLB 2A32A 1SGYE 4FUCA 4YXWD 2FP7B 3U9AH 3M7TA 5EQSA 1K1NA 1Q2WA 1UK4A 3FFGA 1HGTH 1K2I1 1KSNA 2C93B 5F53A 1FLEE 1GHBF 4TYDA 3A83A 3TGKE 2ZU1A 2ANKH 2F3CE 2EC9H 1K1PA 1EJNA 3ZYEA 4UONA 8LPRA 1KXEA 3TH2H 1ZHPA 3QZQA 1T7CA 1F5RA 2LP6A 3KYFA 5FPYA 2BY8X 1Y5BT 3T27A 1V2NT 2ZGCA 2ZZUH 3M3VA 3PRBA 5AF9H 2AH4X 2THFB 2Z9JA 2OK5A 2FI5E 2VWLA 2STAE 4Y7AA 5E2OA 1G9IE 3D23A 3K6ZA 1TGSZ 1BHXB 5EPYA 2KCAA 4Y0YE 4F49A 1TPAE 1FNIA 1PPHE 4CRBA 1VJAU 1SGFG 2Y80A 2W7SA 1IHSH 3SUDA 2BLWA 2NU4E 2YOLA 2Y5FA 2ZHFH 1DX5M 3PB1E 2ZTZA 3ZZCA 1CU1A 2J38A 5I25A 7ESTE 1V2MT 1FY1A 4LZ4B 3HK3B 1O5FH 3BIUH 3GDVA 1TGNA 5L30H 1GI9B 2WZQA 3TH4H 2FTMA 3M7UA 1Q3XA 1QY6A 4AFUA 1DWBH 1PFXC 2GVFA 3GCTG 1WU1A 1NT1A 2ZEBA 1VITF 2GDDA 4AFSA 4Z6AH 5HYOA 2G81E 3SUEA 4KTCA 1O5EH 3ZZAA 1THRH 3DUXH 1DS2E 1GBAA 3EQ0H 1SB1H 1T31A 1PJPA 1VGCB 3QGNB 4NIVA 1Z6EA 3S7KB 4BAQB 3FOAA 4ZKSU 3PLBA 1ARCA 2ZGHA 4XBCA 1K1LA 4I8KA 4DIHH 4INHA 4GAWA 3A86A 3Q76A 6GCHF 4X1PU 1AKSA 1AQ7A 4D7FA 1C5QA 4SGAE 3NCLA 4FVBA 1AZZA 3LGUA 1A3BH 2FOCA 2RDLA 3SGQE 1YCPK 4Y11E 5GIBA 1D6RA 3ENSB 3TGIE 1D6WA 4ABBA 4K60A 1V6DA 1EJAA 1HJ8A 1YLDA 4B1TA 2F9NA 1AGJA 5CE1A 4MG3A 1P09A 1C5NH 1AUJA 2DUCA 3RC5A 1HAVA 2EI6A 1MCTA 3PMBB 3VGCB 4AB8A 1AHTH 1IQJA 1PQAA 1TQ0B 2ZKSA 4YLQH 3P8FA 4RSPA 2BLVA 5L2YH 2XC0A 1VGCC 4FUIA 1O2JA 3BTGE 1H4WA 2UUJB 2PSXA 3BTFE 3E90B 1UHBA 3OAAD 1ELEE 1CA8B 1O2YA 3MU0A 4ZKNU 1ZHRA 3PV2A 2TRMA 4FU7A 2H5CA 3AW1A 1MQ6A 2HNTC 1HRTH 1MKXH 3A88A 3UR9A 3CNRA 4FUDA 1O2HA 2GGVB 4IS5A 4HZHA 2QY0B 5CHBA 3VFEA 4B2BA 1VITH 2ZFQH 3LIWA 1O3CA 4ASHA 4VGCC 4KTSA 1W10U 2GMTB 1A5GH 4Y10E 5DSFA 1AD8H 1LDTT 1Y5AT 1XXFA 2NU0E 4D76A 1EZUC 2BYAX 4NA9H 2QC2A 3M37A 1PPCE 3EA7A 2L6OA 2BVSH 4XRNA 3VB5A 1C5SA 3BEUA 2FS9A 1ZRKA 1AO5A 1GI3A 2CN0H 1BBRE 1P03A 1QB1A 2JJ2D 4XFQA 2FLBH 2XBYA 1MH0A 1OP0A 1O36A 1AMHA 1XX9A 1D3DB 1ZGVA 2PR3A 1LPGB 1TA2A 3SW2B 2NU1E 2A2XH 2A5IA 5AFYH 2AMQA 3SO3A 1SHHB 3A7VA 1EB1H 4XD7D 2Y6TA 4DOQA 4GSOA 1YLCA 4ABEA 4OS5A 5A8ZA 1LHGH 3EE0B 3H09A 2ODPA 2SNWA 3TNTA 4CH2B 2GJGA 1A3EH 1QFKH 2WSSD 1W12U 1UCYE 2ZFPH 1C4U2 1GI8B 4ASUD 1O2PA 2BM2A 2OD3B 3FN8A 5T3HA 1GBKA 3T5FH 5PTPA 3AW0A 1UVTH 1KDQA 1LMWB 4J2YB 1JIRA 1BRAA 2KR7A 1SGPE 4I8LA 1AZ8A 1Y59T 2ZO3H 2VGCC 1TNJA 5JYIA 4YO9A 1MTVA 2OC7A 2QXGA 1WAYB 4CBOA 1O5GH 4H4FA 2H5DA 3RXAA 1TX8A 2BD4A 4UDWH 4BAOB 3Q77A 2DE9A 3MH7A 1C5RA 1PYTD 2KM0A 3F0OA 1GBIA 1K1OA 5C67A 1TNHA 5A09A 2OBQA 1EPTA 1C2EA 4B75A 1EAXA 2JKHA 1N6XA 3UFAA 2F9VA 1SGQE 1AB9C 5SGAE 4Q7XA 2WPMS 1XKAC 3P17H 1TQ7B 2B5TB 2BZ6H 4ZCNA 1UTMA 4AX9H 1FONA 3ZZ9A 1O3LA 1NBMD 4ZROA 1A2CH 2G4TA 1THSH 3RXRA 5EOKA 4I8GA 1TMTH 2G51A 4BAKB 1ANDA 5T1VA 1AI8H 1H9HE 1TPPA 1ARBA 1MKXK 1OPHB 3MTYA 3SOSA 2BHGA 3HPTB 2CMYA 1C5ZB 2FI4E 3LJOA 5E0JA 2QAAA 1O0DH 2ESTE 1FY3A 1W7XH 5C1XA 3VXEH 3MO3A 2ZG0H 1GHBG 3KYGA 1E37B 2AYWA 2G55A 5TJXA 3GY4A 1GDUA 3PO1C 3SNCA 1P2IA 1SLWB 5EXNA 2A7JA 2O8UA 5DP8A 3LGVA 2WPLS 1MD7A 4GCHF 4CRAA 1XKBC 3ZVEA 1KY9A 1LVYA 4X1SU 2KX4A 3A84A 1N1LA 1PQ5A 2PHBA 3E16B 3UNQA 3A82A 3NKKA 1B0EA 3U69H 2RA3A 2HNTF 1BJUA 1GPZA 2TGAA 1L0ZA 2ZP0H 3UUZA 3UOPA 4CR5A 6CHAC 4IMQA 3TVJB 1O2KA 3GDSA 1SVPA 2BY7X 4IC5A 2BY5X 1DANH 1HAOH 1ELCA 1Y3XA 1DY9A 1OWKA 1SFQB 3SU6A 3GCOA 1OOKB 1S84A 3JZ2B 1FY5A 1G36A 2ZTYA 2V6NA 2HPQH 1LHDH 3KCGH 2TGDA 2G52A 1HAZB 1NZQH 5CHAB 1QB6A 1TFXA 1GG6C 4MTBA 1DUEA 1TABE 2ZWLH 2C3SA 4FUFA 2BQ6B 1V3XA 2BLQA 4GHQA 1HXFH 4K8BA 1DE7H 1FMGA 3KEEA 1G37A 2QA9E 2WPDD 3F9GA 3TNSA 3O8RA 3L33A 2GCTC 4FUJA 1P05A 2YMSD 5IK2D 3F9HA 1KLJH 1YKTA 4UFDH 9LPRA 1GJAB 1FQ3A 1XUHA 3RXCA 1P8VC 1MU8B 1SI5H 2PGBB 1RTKA 3M5MA 4Y0ZE 3SHCH 3SNAA 4ZKOU 3MO6A 2CHAC 2JETB 3ZVGA 3LT3A 4JZFH 4QT8C 2EA3A 1DWDH 1C1SA 1YPHE 2PKSB 4Q7ZA 3RXOA 5C1YA 4F48B 2C4FH 1MAYA 1SLXB 2ZPSA 1GJ5H 4BAHB 1O3GA 6GCHG 3UQVA 4U01A 2AS9A 1QJ7B 5DPAA 4X8UH 2ZF0H 1BTHH 1N8OB 3PTNA 5EQRA 4WH6A 3SI3H 1IQKA 1BBRK 1CGIE 1GI0A 4I33A 2Y7XA 3ATLA 4I31A 2ZHWH 1BTUA 2VH0A 3P92A 3BEIB 2NWNA 2GD4B 2J98A 2VU8E 1UVPA 5A0CA 2VJ1A 3E8LA 1TBQH 2ZDKA 3GY6A 3PMJA 1MTNC 2TGPZ 1S85A 2OXSA 2VWNA 1OWDA 1A5IA 2SGDE 2NU2E 2KZ4A 3HKIB 1EJMA 1C5UA 4NFFA 2KAIB 1GHZA 1IQLA 3F6UH 1EAWA 2PFEA 1TX7A 2F9BH 5EU8A 1GJ7B 2HVXA 1EPTC 1DY8A 2QXJA 2ZQ1A 3W1EA 1YGCH 2A45B 2H9EH 4X1QU 1ELDE 2Z7FE 3BTWE 1HUTH 1D3TB 2EQNA 1AIXH 3F9FA 1JRSA 1LHEH 1O3OA 1K28D 5E0HA 1V2PT 2A2QH 3URCA 1GMDG 1AUTC 1VCPA 3P8NA 3S9AA 4CREA 2BX3A 1HFDA 1BZXE 2ZFFH 5JDUB 1IQMA 2P95A 3KQ5A 2TBSA 2AMDA 1ZZZA 1ELVA 1HJAC 4MVNA 1FX0B 1O3FA 1QBNA 4KTUA 3LPRA 3FP8E 1CA0C 3ODFA 3A8DA 2BQ7B 2FX4A 1VCWA 1FN8A 2C90B 2ZC9H 4YZUA 5KEDA 3SJIA 2ALVA 1UK3A 1XM1A 2ZGJA 5GJ4B 4B6FA 4Q7YA 3GDUA 1LHFH 1WQSA 1H9LB 2V3MA 2ZFSA 4M7GA 3ODDA 1P12E 1EUFA 3M61U 4YT6H 1HYLA 1H8ED 1NFYA 1O5CB 1P9UA 1PQ7A 5HKKD 4WXVA 5JB8S 2FWWA 2WPJS 4AN7A 1EKBB 3M35A 4GVUA 1OYTH 1KLIH 1C1WH 3E1XB 4UEHH 5FX5A 1EZXC 3PV5A 1BMNH 1W0JD 1LVMA 2KCPA 4HFPB 3V3MA 2BDCA 2C8YB 5G4BA 5F8ZA 1C2LA 1LPZB 1ETRH 2ZU4A 3IITA 2XTTB 4XOJA 3UTUH 5HM9A 1Z7KA 3P8GA 2EI7A 2BVXH 2FI3E 4AYVB 1EAUA 3M7QA 3KGPA 4KP0A 2JJ1D 3ZZ6A 3OY5U 2BQWB 3MMGA 7KMEH 1KMHB 1TMUH 2A1DB 2GCHF 1UO6A 2ZA5A 3DD2H 4AC9A 1TONA 2G4UA 2Z3DA 1GHYH 1GJ4H 5FAHA 3SU4A 1UTLM 3STIA 4YESB 2H1UA 2VIWA 1XXDA 2V7QD 3RLYH 1ABIH 2ZCHP 4HI3A 5HGGA 3U28C 4ISLA 4I32A 1SGFA 2PKAB 1SL3A 1F0RA 4ABGA 2FZZA 3ITIA 2ODYB 3D65E 4OS7A 1Y5UT 4DIIH 3A7XA 3H7TA 3PLPA 3RM2H 1SC8U 1EAIA 1TGTA 1O2NA 2B8OH 1FAKH 2BDBA 1MBMA 3C1KA 4BXSA 3B8JA 3B9FH 3ATKA 4ZKRU 4O3TA 3U1IB 1ZSKA 2PUXB 3FP6E 3OFND 1S83A 1X7AC 4IBLH 1IAUA 5FX6A 3CP7A 1GBLA 1GJDB 3DFJA 2Z6BD 3A8BA 4YOIA 2CF8H 2A31A 1SOTA 2UWPA 4MNWA 3MNSA 1EQ9A 4Y6DA 2GV7A 4A6LA 1SR5C 2RG3A 1LQEA 3RXTA 3SV9A 1PQ8A 1FUJA 4NIXA 5LPFA 2XOKD 4GCHG 1C4Y2 2FIRH 2PUQH 1EZQA 1BA8B 1QNJA 1TYNA 5GCHF 2O8MA 3KL6A 4BXWA 2J95A 3KQBA 5CMXH 1YBWA 2JDID 5LH8A 1ESAA 3NK8A 1CSOE 4B73A 1TBZH 1GDQA 3F2GA 1ORFA 4HGCA 2ZDAH 1TNIA 1DLEA 1O33A 1S6HA 1ACBE 3OTJE 1ABJH 1T8MA 2YMSC 1HPGA 3RMNH 2AHME 1YPJH 2KFWA 1SKYE 3SZNA 1NESE 1GI5A 2I6SA 2CJIA 2UWOA 4CRDA 5EXMA 3ZVDA 1OHHD 1GHVH 1Z8RA 1ETSH 4RI0A 2BOKA 2ZECA 1G3BA 4ISOA 1OWEA 1QRZA 5DG6A 2GZ8A 1D3QB 2R2MB 1LKBA 1VJ9U 3SZEA 1ETTH 1KXCA 4ZHLU 8KME2 3ZYDA 3F0PA 1EP5A 2HALA 3TJNA 5A0AE 5A8YA 2F83A 3T62A 1B7XB 2UUYA 1DSTA 3E6PH 5EG4A 1O3NA 1KXDA 1GBEA 2FOBA 4JK5A 3P70B 5C2ZA 2HGTH 5H4IB 4NWKA 5AHGH 1SBWA 2PTCE 1QL8A 4GLYA 2P3UB 4VGCB 1GBBA 3FP7E 2BDHA 1UTKA 2ZDVH 1HAYB 4ZMAH 3DCLA 1C5PA 1P9SA 3GICB 1WBGB 3A7WA 1TPSA 1ZOMA 4NSVA 4ZUHA 1MUEB 2XWAA 2C8ZB 3MO9A 4CH8B 2QF5A 1O2GH 2D8WA 2F9OA 4OGXA 3QK1A 2TIOA 4THNH 3W94A 3SU1A 1GVZA 5DP9A 1UTPA 1LHCH 1WCZA 5F03A 1G3CA 1C5MD 1C2MA 1GI7B 4ABDA 4I7YH 4IMZA 4B71A 4DY7B 2J92A 1DOJA 2B0FA 1MKWH 1WUNH 2WV5A 4FU9A 4OS6A 3K65B 4Q80A 1DSUA 1C5TA 2OTVA 1QQ4A 4NIWA 1SSXA 3F68H 1EP6A 2ULLA 1WTGH 3ZZ7A 1V2TT 1ZR0A 4K3JA 5ABWA 1GMDF 4LOYH 2JH0D 2BZAA 1L1JA 1QQUA 3A8AA 3UWJH 1W11U 4K1SA 2PWXA 1O3DA 5L6NH 1GBFA 2ZCLP 2J34A 2FOAA 2R0LA 5DP6A 3RXGA 3V7TA 3RP2A 1C4V2 1YC0A 3RC6A 4U30A 1F0SA 1TNLA 5F8TA 1ELAA 3E91A 4MPUA 3SNEA 3RXUA 3TJOA 1FY8E 3QLPH 2ILNA 3RU4E 1EOJA 2VGCB 1NFUA 2ZU2A 1TAWA 4FXGH 1DM4B 1VCQA 3L6PA 1MBQA 1ESTA 3CENA 3WWBA 1QGFA 3GCHB 4OS2A 4CRFA 2EY4C 2VINA 2AGEX 2O9QA 1Y3WA 4K2YA 1G32B 1A0LA 5GXPA 3P8OA 4P02A 1WYKA 3ESTA 1BB0B 4JYVH 1AB9B 4FOUC 1AN1E 1C5YB 3HK6B 1DICA 1HAGE 1IQEA 1MABB 2H6MA 3ZZ3A 2J5UA 3MNBA 2P3FH 1FV9A 3UNSA 1YWUA 3VG8A 3SI4H 3FZDA 1GBJA 3D49H 2D26C 4ISIH 3LDXH 1HXEH 1UMAH 3B23B 1Z1IA 3BTDE 3QGJA 4OGYA 2XWBI 3BV9B 5CDFE 1V2VT 2FOHA 2K8IA 4Z1MD 1ZMLA 2ZI2H 4F55A 1IQHA 3ZZ4A 1QL7A 1BMFD 1XVMA 2CF9H 3MU4A 4TPIZ 3OY6U 1FJSA 4NA8A 1YPHC 4A1XA 1UK2A 5LPEA 4TY6A 4DW2U 1O2OA 4A1VA 1H8DH 1CBWC 5B6OA 5DP3A 1YP9A 1QRXA 4IN2A 1O3IA 1OP8A 4ZXXH 3GCHC 2ZNKH 3GS9A 2ZDMA 5JBCS 3V13A 1BRCE 1C1MA 5FHTA 1D3PB 1HAVB 4WF8A 1C5OH 3PO1B 2AFQB 1NC6A 2XC4A 1AE5A 3KHVA 3TIUA 4O03A 4BANB 2GCHG 1ZPBA 5LGOA 3UREA 4ACBA 2OP9A 2Y82A 3TK5A 3NRLA 2G8TA 3SV6A 1GJ8B 1YY3A 5DGJA 2KCOA 1HB0B 1P3EA 1ESBA 1Z71A 3N7EA 5EGMA 2VVVA 6CHAB 4X6MA 5BPEA 2BDIA 2Q6GA 1AWHB 1UW7A 3ATIA 2IJOB 3K6YA 1SFIA 1XUJA 4H6TA 4XBDA 1QTFA 2VWMA 5GWZA 1MTWA 1MKWK 2IOTA 1MCVA 5C17A 1KXFA 2Z9KA 1ZGIA 1C1RA 4O9VA 1A46H 1S5SA 1CGJE 1ZMJA 5DP4A 1GG6B 1FXYA 3GOVB 4WWYA 1BMMH 5T6FA 4A92A 1YM0A 1PPBH 1GWAA 1RGQA 3RU4T 4Z0KA 2XNIA 1HNEE 4TY7A 3Q3XA 2P8OC 2Y7ZA 4AG2A 4FETA 3BG8A 4TWWA 1O37A 2ANYA 2RCEA 5L2ZH 3RXSA 3UWIA 3DHKH 2GCTB 4AFZA 1UVUH 1A0JA 1L2EA 1ZJDA 1O2LA 4NG9H 2LELA 5EIYA 4NSYA 1K0HA 4DJZB 3DT0H 4Y79A 2CHAB 2EEKA 3RMMH 5C3NA 3AAVA 2KAIA 5C1UA 3T29A 1KLTA 6LPRA 2TPIZ 8GCHF 5HIZA 4ISHH 5AFZH 1T8LA 3TH3H 1ELFA 2QN5T 1BJVA 2AGIX 2W26A 1TGCA 4E7NA
chains in the Genus database with same CATH topology
1Z8GA 2J9NA 4X2WA 4X2YA 4DGJA 1M9UA 1TALA 1NRRH 2WV4A 3BTME 1TWXB 3MOCA 1O2VA 5GCHG 1GGDC 2XYAA 1Z8JB 4KELA 3AVZA 2Q6FA 5T6GA 1DLKB 3S7HB 1Y3YA 4XSKU 3JZ1B 1O38A 1HIAA 4UFEH 1C5WB 1TIOA 1KDQB 3GY5A 2SGFE 2ZQ2A 2VIQA 1F92A 1OS8A 4WMFA 2UUFB 4WXIA 3M5OA 3SJ8A 4D8NA 2FDAA 1LCYA 1MD8A 2H2ZA 2ZU3A 3LJJA 1CT4E 1MTNB 1AFQC 1T8NA 2A7HA 5K7RA 4K1EA 1C2GA 5AVDA 4NGAH 5IYTA 1C2KA 1C5XB 1A0HB 1RTLA 1SLVB 3BSQA 3S0NA 2ZTXA 5FXLA 2UWLA 1V2ST 1ANBA 2Y5HA 1C1UH 4MLFB 2VVUA 4WMEA 3PWCA 2BDAA 1EPTB 1PPEE 1GBMA 2ZDNA 3LONA 2QV1A 1S6FA 5C5OA 1DUAA 3EA8A 1GVKB 1E0FD 2FYQA 1TMBH 1S82A 1SG8B 3RMOH 3LC5A 1RTFB 2F91A 3QTOH 1C2IA 1E38B 3GY2A 2J4IA 3KF2A 3BTQE 1AU8A 4ESTE 1UJ1A 1O5BB 1TRMA 3RDZA 3ZV8A 1E35B 4AORA 3TK9A 1ANEA 4A7IB 3H5CB 1O35A 3BN9A 1HJAB 4BAMB 1KTSB 1MU6B 2OQ5A 2WINI 1DXPA 1O3KA 1QBOA 2R0KA 1RD3B 1ZYOA 1SGCA 1CA0B 3SQHE 1S0QA 3Q3YA 2QXHA 1C2DA 5E0GA 1TOCB 3BTTE 2CGAA 1A7SA 3PMHB 4DURA 3NUMA 1TB6H 2GT7A 4AOQA 4IW4E 2BD7A 2SGPE 1JRTA 1EB2A 1SGTA 3RC4A 3KN2A 5HXFA 2R2WU 1BTPA 4K1TA 3HGNA 4MNYA 2PKAA 5EXLA 1GCTC 2F9UA 2ZCKP 1HAHH 1SGEE 1NRSH 3LGIA 1DVAH 4ZH8A 2ZIQH 3Q00A 1K1IA 2ZHDA 1K1JA 1QA0A 2BD3A 3ZV9A 4X2XA 1DWCH 3RXPA 1TRNA 4ABAA 3SJ9A 1BTXA 3BTKE 1O30A 3FAOA 2K1QA 2Z9GA 1LKAA 3RXLA 1OX1A 4WMDA 3MFJA 2FOFA 3GYMA 1VZQH 3U98H 5HMAA 4RKOB 1EZSC 1TA6A 4KKDA 5EW1H 3LU9B 4I8JA 1GBCA 3MH5A 3FZZA 4K5ZA 4X6OA 3G01A 4LZ1H 3T28A 2FOGA 3EGKH 4YLUA 1J15A 7GCHG 5LPRA 2DE8A 3P6ZB 1O32A 4JK6A 2VIPA 2FS8A 2LNCA 1Q31A 3PMAB 2Q1JA 4FUGA 5EPNA 4NZLA 4BOHA 1FPCH 4CHAC 2R9PA 3O8DA 1K22H 2BD8A 1NM6A 3PROA 3P95A 1GJ6A 3M5NA 5JPMH 1G2LA 2A4OA 4A1TA 3BTHE 3ELAH 3M3TA 5FBIA 1SGRE 5C20A 2O8TA 1TE0A 2H9HA 3ZZ8A 3EYDA 4Y8XA 1XUGA 1E34B 1NU9A 1AVWA 1O34A 1Z6JH 1GJBB 2OLGA 2GZ9A 3SV2H 5EW2H 4MPWA 1TOMH 3TJVA 1D9IA 4MPVA 2C8XB 3A81A 2GV6A 2A4QA 3GY7A 3TLOA 1TGBA 3RXKA 1W14U 3A89A 3MNXA 2BDYA 2P93A 1CQQA 1WSSH 2ZDLA 3KIDU 4FUHA 2ZGXH 3S9CA 2ALPA 4YM9A 3BG4C 2HOBA 2VIVA 3QUMP 4AG1A 1OWIA 1C5LH 3O8CA 4Y71A 3KQDA 3HATH 2ANWA 2NU3E 1NPMA 3SN8A 1IQNA 2A4RA 4AB9A 4ABHA 1MTSA 2Z3CA 4JZDH 3OU0A 4YTAA 4INLA 4MPXA 1ZTJA 1SMFE 1GHWH 2ZFTA 2GTBA 4H42U 1YCPH 1QRWA 2Y81A 2WPIS 2FLRH 1L4ZA 4IGDA 5DP7A 1Z8IB 3TU7H 3PLKA 2G00A 2I6QA 4NFEA 1H1BA 4OS4A 1ANCA 1BUIA 4INKA 1CGHA 2XBXA 2WYGA 1A5HA 1NRNH 1BMAA 2XRCA 1GL1A 1IQIA 1SQTA 3K9XB 1FDPA 1L1NA 2CXVA 4Q2KA 1V2KT 1OWJA 4GHTA 1IQGA 1F5LA 3T25A 2BLOA 1Y3UA 3DA9B 3QX5H 3MI4A 1J14A 3M36A 3UOUA 1QJ6B 2PV9B 1C1OA 1THPB 3A7YA 5JBBS 3IG6B 3SU2A 1HAPH 3R0FA 4DT7B 1XVOA 1C9TA 3HKJB 5TCCA 1RIWC 3UNRA 2SGQE 4FVDA 1GI4A 3MNCA 1MZAA 2JH6D 4JZEH 1C1QA 3BTEE 2VNTA 1JMOH 4WH8A 3HGPA 1B5GH 5BRRE 2XCNA 1O2ZA 3A80A 3MU8A 3ATMA 4YOGA 3VXFH 1GMHF 3GY8A 4D9QA 1T4UH 1YPKH 1EX3A 2VH6A 1W13U 4XDEA 8GCHG 1RFNA 2BD5A 1YCPM 1QR3E 1GHAG 1NY22 3RLWH 1C1NA 1EATA 3PYHA 5JBTA 1DWEH 4ZHAA 4PROA 5HM2A 3VB6A 1BT7A 3UQOA 4B74A 4MDSA 2Z94A 1CE5A 1PPGE 3URDA 1EXFA 1P2JA 2YNBA 3SJOA 5FPSA 6ESTA 3DFLA 1V2JT 1LVOA 1XMNB 3GISB 5A8XA 3ATWA 1W0ZU 2B7DH 2QF3A 5GPIB 5ETXA 1G30B 2ZHEH 3EDXB 2XCFA 5DJ7A 1P2MA 1SGDE 1HAXB 2UUKB 3D62A 3IWMA 1FZZA 3VEQB 3BEFB 3LGYA 2OC0A 1LTOA 4Y8YA 4ABIA 4NIYA 1DT2A 4B76A 2P16A 4CRCA 5ESTE 2AMPA 1NO9H 2GDEH 2FEQH 1E36B 3SBKA 1JOUB 4BTUB 3MH6A 2G5NA 1CT2E 1WV7H 3RXFA 1EASA 4MNVA 3ZZBA 4JZ1A 4BTIB 4K8YA 1HCGA 4K69A 3SNDA 2P94A 2PW8H 1O3JA 2BXUH 3GCNA 4JYUH 3STJA 5J4QA 2VIOA 1TBRH 2XBWA 1LVBA 3RXMA 2AERH 2FYRA 3FVFB 7LPRA 2V35A 1A1RA 3LC3A 3TGJE 3T2NA 4D7GA 1CO7E 4X8TH 2M5TA 2ZU5A 2ZPQA 3NPSA 1JWTA 1QHRB 3VB3A 3RM0H 1O39A 1L4DA 1XUIA 3V0XA 1O3EA 1ELGA 1O31A 3KQEA 4NWLA 4JMYA 1T8OA 2OINA 1P0SH 3MWIU 1P10A 2QXIA 3NXPA 1ZTKA 3QTVH 1UTJA 3RXJA 1DDJA 1Z1JA 1ZPCA 3ZVCA 2BDGA 3AASA 4I8HA 1WOFA 3QWCH 1C1TA 1ELTA 4NCYA 4B2AA 2A4GA 2SGEE 2GKVE 2V0BA 1GBHA 5IDKA 1P02A 1PPFE 1CHOF 4MQAA 1OWHA 1W0YH 7GCHF 1J8AA 1CBWB 4AGJA 4U2WA 5JB9S 4B2CA 1FPHH 8ESTE 1MQ5A 2VB0A 2FESH 1BDAA 2WPHS 4ISNA 4OS1A 1O2SA 2QF0A 4H6SB 1GMCF 1P57B 3VGCC 1NTPA 3A85A 1BCUH 1OYQA 2A0QB 4YT7H 1O2QA 4JCNA 4AZ2B 3LGTA 3TK6A 3M3SA 1AVGH 5EODA 1L1GA 1C2FA 3U1JB 4UFGH 1F7ZA 3RXEA 1YPMH 3SUFA 1XUKA 3MU5A 1RXPA 1QIXB 1SGIB 3PV4A 1SHYA 1HBTH 5JBAS 1F5KU 1GHXH 4HTCH 1FN6A 3OSYA 3LGWA 2Z9LA 2BTCE 2VWOA 1AKSB 3K2UA 4BNRA 1TRYA 1AWFH 3ZZDA 3U8TH 2GZ7A 1HV7A 2Q6DA 1P2OA 2A5AA 4SGBE 4XE4A 1SLUB 3A87A 1NROH 1RJXB 1ZJKA 1P06A 3SJKA 1JIMA 2GMTC 1AVXA 3RXDA 1GBDA 2D1JA 1JBUH 1O2MA 3LKWA 2TGTA 2WPKS 2P8OB 2IN2A 3PTBA 1BRUP 1BOQA 3W95A 3H7OA 5TCAA 4NZQA 4E06H 3SQEE 3LOXA 4DCDA 1KXBA 1QCPA 2OC8A 1WQVH 1C9PA 1GBTA 4WJG2 1BQYA 2ZFRH 3SUGA 2FODA 4R8TB 1GDNA 3MHWU 3Q3KA 2GT8A 1JXPA 3PM3A 2OUAA 4TWYA 1C2HA 2FPZA 1C1VH 3RXQA 1P01A 2SGAA 1UHBB 1WTHD 3C27B 1GL0E 1BTWA 2Z9IA 5I46H 4XBBA 1ZMNA 1D4PB 1DXWA 1A61H 1BHXF 1GI6A 2VIDA 1FY4A 4YOJA 3A8CA 3U8RH 3VPKA 2WUBA 1V2UT 1TNGA 4UD9H 3V12A 1UVSH 5EQQA 4LK4A 1YPEH 1GGDB 1NRPH 1IHTH 1U6QA 1V2WT 1TLDA 2Z3EA 1BBRH 4X2VA 1HLTH 3M5LA 5A0BA 1O2IA 2AEIH 1K21H 3ZVBA 1QBVH 1O2WA 2WYJA 1DPOA 1G3EA 4U32A 5A2MH 2A5KA 2D2DA 4AYYB 2OQUA 4O97A 5K0HA 3RXVA 4FU8A 1ZSLA 1O3MA 1SPJA 3SU0A 1UTOA 2HLCA 2PLXA 2P3TB 1O3HA 1O2RA 2ANMH 1AFQB 3SGBE 1QURH 1BIOA 3RXBA 1O3AA 2HNTE 3OX7U 2FMJA 1W7GH 2BY9X 4RN6A 2XC5A 1OSSA 2W5EA 1GHAF 3TITA 5E8EH 1UCYH 1K1MA 5E2PA 3RU4D 2B9LA 3SV7A 1GI1A 2BMGB 1SGNE 2FXRA 2QIQA 5ESBA 4Y7BA 1YYY1 1QA7A 1GMHG 1QJ1B 2EI8A 1CT0E 2IPHA 4ABJA 1XUFA 2O8WA 1ZSJA 1HJ9A 1P2KA 4Y76A 1W3CA 3L3TA 1P11E 3RXHA 5GDSH 1C5VA 4IC6A 4IN1A 3QO6A 3TPIZ 1G2MA 2GP9B 1BMLA 1J16A 3UIRA 2XW9A 3GCTF 4DVAU 1NFXA 2BXTH 2AIQA 1VR1H 3BF6H 2F9PA 4CRGA 3F1SB 5J4SA 1CVWH 5FPTA 2AIPA 1AFEH 3SORA 2V3OH 3ZZ5A 2PTNA 1FI8A 2QCYA 2FOMB 4ZAEA 3RXIA 1QB9A 1YPLH 1VITG 1J9CH 4X1RU 1A4WH 1GCTB 3E0NB 4KGAA 1IOEA 2AGGX 1ZPZA 1MTUA 5FBEA 1LO6A 4FUEA 1BRBE 2YNAA 1MZDA 4UE7H 3I78A 1KIGH 3SHAH 2A7CA 4LXBH 1W2KH 3UPEA 1NRQH 1HAIH 3LH1A 3UR6A 1GCDA 2VVCA 3T26A 4MNXA 4GUXA 1KXAA 2FM2A 2O8LA 5F8XA 3SV8A 2H9TH 3ZVFA 2ZHQH 5CHAC 1C2JA 1T32A 3S9BA 2J2UA 2WUCA 4CBNA 1O3BA 1LQDB 3CS7A 2BD2A 4BTTB 2XBVA 2R3YA 3NWUA 1GI2A 4ZHMU 1O5DH 1BTYA 1P2QA 4X8VH 3OYPA 4RKJB 4CHAB 1V2QT 4NA7A 1BITA 2JH5D 2ODQA 3LH3A 1FIWA 1ZLRA 2G5VA 2QGRA 1ZTLA 4FUBA 3R3GB 4Y8ZA 4E7RG 1P04A 1TPOA 1GJCB 2R3UA 2J94A 2C8WB 1INCA 2JETC 1S81A 4X1NU 1J17T 1V2LT 1NFWA 2PKSC 2HRVA 5DP5A 2HPPH 3MH4A 4AGKA 1Y3VA 1ZRBA 1UCYK 3ZVAA 3SGAE 9ESTA 1AE8H 1SOZA 2FOEA 3MYWA 2ASUB 4X8SH 5FCRA 1K9OE 3E0PB 1DFPA 1H8IH 1IQFA 2LPRA 1G3DA 1O2TA 1HDTH 1N8OC 1CHOG 1EOLA 5DKMA 3BG4B 1O2XA 3UY9A 3NZIA 1UTNA 1SQAA 2W3KA 3BIVH 1HIAB 4D9RA 1W8BH 1C1PA 2BOHB 1V2OT 1F0TA 1YF4A 3E3TA 1P3CA 2FO9A 1GMCG 1MMJN 1O2UA 4GPGA 1ELBA 1PPZA 3QZRA 1QL9A 5T6DA 3VB7A 2BB4A 1ZHMA 3QN7A 1F0UA 5DO4H 4UFFH 1T4VH 2SFAA 4DG4A 3A7TA 3AAUA 1OKXA 5DK1A 3CS0A 1OXGA 2FTLE 2CV3A 1GVLA 1P2NA 2BY6X 1NU7B 1OP2A 2BX4A 4JYTA 1O3PB 1H9IE 2FX6A 4R0IA 1BTZA 2PGQB 4X6NA 2ZPRA 3RUOA 1Y8TA 1YPGH 1RS0A 4F4OC 2STBE 5FCKA 3I77A 4WVPE 2PSYA 1UTQA 2OBOA 4CR9A 2BD9A 2P59A 1KTTB 3PWBA 1FAXA 3FANA 3I29A 3KNXA 4J1YA 2OC1A 4A5TS 1PYTC 2OCVB 4TPYA 1TX6A 1F2SE 3A7ZA 4WY3A 3O8BA 1UVOA 1V2RT 1RIWB 1B0FA 1MAXA 3SNBA 2BVRH 1NN6A 2XXLA 2GX4A 4ZXYH 1TNKA 1KYNA 3GY3A 1NS3A 1CHGA 2Y5GA 2SNVA 3MU1A 3SU3A 3EAJA 3RMLH 4JZIA 3WY8A 3GYLB 4O3UA 2RA0A 5F6MA 5C5NA 2QYIA 3EA9A 1S0RA 1O5AB 3QDZB 3KQCA 3TJUA 4E05H 1GJ9B 2V3HH 4ABFA 4X6PA 4X0WU 1N6YA 1FIZA 3N7OA 2W7UA 1AY6H 3U8OH 2ZGBH 1SQOA 2W3IA 3F9EA 3SU5A 3S69A 3VB4A 4AFQA 1RRKA 1DITH 1ID5H 1LPKB 2HWLB 2A32A 1SGYE 4FUCA 2FP7B 3U9AH 3M7TA 5EQSA 1K1NA 1Q2WA 1UK4A 3FFGA 1HGTH 1K2I1 1KSNA 2C93B 1FLEE 1GHBF 4TYDA 3A83A 3TGKE 2ZU1A 2ANKH 2F3CE 2EC9H 1K1PA 1EJNA 3ZYEA 4UONA 8LPRA 1KXEA 3TH2H 1ZHPA 3QZQA 1T7CA 1F5RA 5FPYA 2BY8X 1Y5BT 3T27A 1V2NT 2ZGCA 2ZZUH 3M3VA 5AF9H 2AH4X 2THFB 2Z9JA 2FI5E 2VWLA 2STAE 4Y7AA 5E2OA 1G9IE 3D23A 3K6ZA 1TGSZ 1BHXB 5EPYA 4Y0YE 4F49A 1TPAE 1FNIA 1PPHE 4CRBA 1VJAU 1SGFG 2Y80A 2W7SA 1IHSH 3SUDA 2BLWA 2NU4E 2YOLA 2Y5FA