3IG4A

Structure of a putative aminopeptidase p from bacillus anthracis
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
419
structure length
419
Chain Sequence
MKSKFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIDEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVIYLDSFEKTMSNIFFTENVKHLYLDLECREWKGTETKTLAFAKHVREQYPHVTIGNVYPNICELRVFKTDEEIEIIKEAIAVTKDGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLNALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGHENLSKDIIREVEEIEEFMRENNVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a putative aminopeptidase P from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords Xaa-pro aminopeptidase
total genus 129
structure length 419
sequence length 419
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3ig4A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3ig4A02
2NQ6A 2BWWA 3CTZA 2GU4A 1XGMA 1YW9A 3IU7A 4U6EA 4ZWOA 3FMRA 3MX6A 4PNCA 1KQ0A 5E5BA 2OKNA 2EVCA 3OVKA 5CDVA 4EGEA 4FO8A 4U6WA 4A6VA 2GG5A 3I7MA 4IDYA 1YVMA 1BN5A 1WY2A 1BOAA 4S01A 2OAZA 3PEBA 2BWSA 3PKAA 4IF7A 2GG9A 3PKEA 1QXYA 3FM3A 1WKMA 4ZNGA 4S2TP 2BWXA 1YJ3A 5CDLA 3PKDA 4RZZA 2Q96A 4HXXA 2Q94A 3TB5A 5JHUA 1C27A 2V6CA 2P9AA 4S2RP 1KQ9A 4RZYA 2EVMA 1WBQA 4FKCA 2GG0A 3IU9A 1CHMA 1WLRA 1R58A 4B28A 1PV9A 3S6BA 4Z7MA 3CB6A 2V3XA 1XGNA 2BWUA 1R5HA 1QXWA 2B3LA 5E2CA 2B3HA 2GU5A 2IW2A 2P98A 3CB5A 2Q92A 5CE6A 5JI6A 1W2MA 2V3YA 2Q93A 4U6ZA 4ZWUA 1C23A 3BIPA 1C22A 2ZSGA 4QR8A 1A16A 4A6WA 3PN9A 5CNXA 4S00A 4IPAA 4U69A 5FCHA 4FLIA 2GG8A 4U70A 2BWTA 3IL0A 5D6EA 2GG7A 4JUQA 3IG4A 1N51A 2P99A 4PV4A 1B59A 4U76A 2GGBA 2GTXA 4FLLA 1W7VA 4IKTA 2BB7A 1QXZA 1JAWA 2EA2A 2GG3A 1YW8A 2V3ZA 2GG2A 2G6PA 5CIKA 4IKUA 5CLSA 4FLKA 5D6FA 2Q8KA 4IU6A 1YW7A 2BH3A 2B3KA 1WN1A 4FUKA 3RVAA 2GGCA 1XGOA 3L24A 3PKBA 3RORA 4U75A 2BHCA 4ZWPA 1XNZA 4IECA 4U73A 2GU7A 2NQ7A 3D27A 3TAVA 4U71A 4RGZ1 2MATA 2GU6A 2BHBA 3QOCA 1M35A 1KP0A 4OOKA 2EA4A 4IKRA 1QZYA 1O0XA 1WL6A 1R5GA 4FO7A 4U1BA 3MR1A 2ADUA 4U6JA 2BHDA 3BIQA 4FLJA 3MATA 4IKSA 3Q6DA 2BN7A 5JFRA 3O5VA 1MATA 2BWYA 1C24A 1C21A 2DFIA 2EVOA 2BWVA 1WL9A 3BITA 4R60A 3PKCA 4MATA 4U6CA 1B6AA 2Q95A 3IU8A 5CDEA 2GZ5A 3OOOA 4KM3A 1XGSA 3L7GA 5FCFA 1Y1NA 2GA2A 2HOWA 2BHAA 3FMQA
chains in the Genus database with same CATH superfamily
2NQ6A 2BWWA 3CTZA 2GU4A 1XGMA 1YW9A 3IU7A 4U6EA 4ZWOA 3FMRA 3MX6A 4PNCA 1KQ0A 5E5BA 2OKNA 2EVCA 3OVKA 5CDVA 4EGEA 4FO8A 4U6WA 4A6VA 2GG5A 3I7MA 4IDYA 1YVMA 1BN5A 1WY2A 1BOAA 4S01A 2OAZA 3PEBA 2BWSA 3PKAA 4IF7A 2GG9A 3PKEA 1QXYA 3FM3A 1WKMA 4ZNGA 4S2TP 2BWXA 1YJ3A 5CDLA 3PKDA 4RZZA 2Q96A 4HXXA 2Q94A 3TB5A 5JHUA 1C27A 2V6CA 2P9AA 4S2RP 1KQ9A 4RZYA 2EVMA 1WBQA 4FKCA 2GG0A 3IU9A 1CHMA 1WLRA 1R58A 4B28A 1PV9A 3S6BA 4Z7MA 3CB6A 2V3XA 1XGNA 2BWUA 1R5HA 1QXWA 2B3LA 5E2CA 2B3HA 2GU5A 2IW2A 2P98A 3CB5A 2Q92A 5CE6A 5JI6A 1W2MA 2V3YA 2Q93A 4U6ZA 4ZWUA 1C23A 3BIPA 1C22A 2ZSGA 4QR8A 1A16A 4A6WA 3PN9A 5CNXA 4S00A 4IPAA 4U69A 5FCHA 4FLIA 2GG8A 4U70A 2BWTA 3IL0A 5D6EA 2GG7A 4JUQA 3IG4A 1N51A 2P99A 4PV4A 1B59A 4U76A 2GGBA 2GTXA 4FLLA 1W7VA 4IKTA 2BB7A 1QXZA 1JAWA 2EA2A 2GG3A 1YW8A 2V3ZA 2GG2A 2G6PA 5CIKA 4IKUA 5CLSA 4FLKA 5D6FA 2Q8KA 4IU6A 1YW7A 2BH3A 2B3KA 1WN1A 4FUKA 3RVAA 2GGCA 1XGOA 3L24A 3PKBA 3RORA 4U75A 2BHCA 4ZWPA 1XNZA 4IECA 4U73A 2GU7A 2NQ7A 3D27A 3TAVA 4U71A 4RGZ1 2MATA 2GU6A 2BHBA 3QOCA 1M35A 1KP0A 4OOKA 2EA4A 4IKRA 1QZYA 1O0XA 1WL6A 1R5GA 4FO7A 4U1BA 3MR1A 2ADUA 4U6JA 2BHDA 3BIQA 4FLJA 3MATA 4IKSA 3Q6DA 2BN7A 5JFRA 3O5VA 1MATA 2BWYA 1C24A 1C21A 2DFIA 2EVOA 2BWVA 1WL9A 3BITA 4R60A 3PKCA 4MATA 4U6CA 1B6AA 2Q95A 3IU8A 5CDEA 2GZ5A 3OOOA 4KM3A 1XGSA 3L7GA 5FCFA 1Y1NA 2GA2A 2HOWA 2BHAA 3FMQA
chains in the Genus database with same CATH topology
2NQ6A 2BWWA 3CTZA 2GU4A 1XGMA 1YW9A 3IU7A 4U6EA 4ZWOA 3FMRA 3MX6A 4PNCA 1KQ0A 5E5BA 2OKNA 2EVCA 3OVKA 5CDVA 4EGEA 4FO8A 4U6WA 4A6VA 2GG5A 3I7MA 4IDYA 1YVMA 1BN5A 1WY2A 1BOAA 4S01A 2OAZA 3PEBA 2BWSA 3PKAA 4IF7A 2GG9A 3PKEA 1QXYA 3FM3A 1WKMA 4ZNGA 4S2TP 2BWXA 1YJ3A 5CDLA 3PKDA 4RZZA 2Q96A 4HXXA 2Q94A 3TB5A 5JHUA 1C27A 2V6CA 2P9AA 4S2RP 1KQ9A 4RZYA 2EVMA 1WBQA 4FKCA 2GG0A 3IU9A 1CHMA 1WLRA 1R58A 4B28A 1PV9A 3S6BA 4Z7MA 3CB6A 2V3XA 1XGNA 2BWUA 1R5HA 1QXWA 2B3LA 5E2CA 2B3HA 2GU5A 2IW2A 2P98A 3CB5A 2Q92A 5CE6A 5JI6A 1W2MA 2V3YA 2Q93A 4U6ZA 4ZWUA 1C23A 3BIPA 1C22A 2ZSGA 4QR8A 1A16A 4A6WA 3PN9A 5CNXA 4S00A 4IPAA 4U69A 5FCHA 4FLIA 2GG8A 4U70A 2BWTA 3IL0A 5D6EA 2GG7A 4JUQA 3IG4A 1N51A 2P99A 4PV4A 1B59A 4U76A 2GGBA 2GTXA 4FLLA 1W7VA 4IKTA 2BB7A 1QXZA 1JAWA 2EA2A 2GG3A 1YW8A 2V3ZA 2GG2A 2G6PA 5CIKA 4IKUA 5CLSA 4FLKA 5D6FA 2Q8KA 4IU6A 1YW7A 2BH3A 2B3KA 1WN1A 4FUKA 3RVAA 2GGCA 1XGOA 3L24A 3PKBA 3RORA 4U75A 2BHCA 4ZWPA 1XNZA 4IECA 4U73A 2GU7A 2NQ7A 3D27A 3TAVA 4U71A 4RGZ1 2MATA 2GU6A 2BHBA 3QOCA 1M35A 1KP0A 4OOKA 2EA4A 4IKRA 1QZYA 1O0XA 1WL6A 1R5GA 4FO7A 4U1BA 3MR1A 2ADUA 4U6JA 2BHDA 3BIQA 4FLJA 3MATA 4IKSA 3Q6DA 2BN7A 5JFRA 3O5VA 1MATA 2BWYA 1C24A 1C21A 2DFIA 2EVOA 2BWVA 1WL9A 3BITA 4R60A 3PKCA 4MATA 4U6CA 1B6AA 2Q95A 3IU8A 5CDEA 2GZ5A 3OOOA 4KM3A 1XGSA 3L7GA 5FCFA 1Y1NA 2GA2A 2HOWA 2BHAA 3FMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NQ6 A;  2BWW A;  3CTZ A;  2GU4 A;  1XGM A;  1YW9 A;  3IU7 A;  4U6E A;  4ZWO A;  3FMR A;  3MX6 A;  4PNC A;  1KQ0 A;  5E5B A;  2OKN A;  2EVC A;  3OVK A;  5CDV A;  4EGE A;  4FO8 A;  4U6W A;  4A6V A;  2GG5 A;  3I7M A;  4IDY A;  1YVM A;  1BN5 A;  1WY2 A;  1BOA A;  4S01 A;  2OAZ A;  3PEB A;  2BWS A;  3PKA A;  4IF7 A;  2GG9 A;  3PKE A;  1QXY A;  3FM3 A;  1WKM A;  4ZNG A;  4S2T P;  2BWX A;  1YJ3 A;  5CDL A;  3PKD A;  4RZZ A;  2Q96 A;  4HXX A;  2Q94 A;  3TB5 A;  5JHU A;  1C27 A;  2V6C A;  2P9A A;  4S2R P;  1KQ9 A;  4RZY A;  2EVM A;  1WBQ A;  4FKC A;  2GG0 A;  3IU9 A;  1CHM A;  1WLR A;  1R58 A;  4B28 A;  1PV9 A;  3S6B A;  4Z7M A;  3CB6 A;  2V3X A;  1XGN A;  2BWU A;  1R5H A;  1QXW A;  2B3L A;  5E2C A;  2B3H A;  2GU5 A;  2IW2 A;  2P98 A;  3CB5 A;  2Q92 A;  5CE6 A;  5JI6 A;  1W2M A;  2V3Y A;  2Q93 A;  4U6Z A;  4ZWU A;  1C23 A;  3BIP A;  1C22 A;  2ZSG A;  4QR8 A;  1A16 A;  4A6W A;  3PN9 A;  5CNX A;  4S00 A;  4IPA A;  4U69 A;  5FCH A;  4FLI A;  2GG8 A;  4U70 A;  2BWT A;  3IL0 A;  5D6E A;  2GG7 A;  4JUQ A;  3IG4 A;  1N51 A;  2P99 A;  4PV4 A;  1B59 A;  4U76 A;  2GGB A;  2GTX A;  4FLL A;  1W7V A;  4IKT A;  2BB7 A;  1QXZ A;  1JAW A;  2EA2 A;  2GG3 A;  1YW8 A;  2V3Z A;  2GG2 A;  2G6P A;  5CIK A;  4IKU A;  5CLS A;  4FLK A;  5D6F A;  2Q8K A;  4IU6 A;  1YW7 A;  2BH3 A;  2B3K A;  1WN1 A;  4FUK A;  3RVA A;  2GGC A;  1XGO A;  3L24 A;  3PKB A;  3ROR A;  4U75 A;  2BHC A;  4ZWP A;  1XNZ A;  4IEC A;  4U73 A;  2GU7 A;  2NQ7 A;  3D27 A;  3TAV A;  4U71 A;  4RGZ 1;  2MAT A;  2GU6 A;  2BHB A;  3QOC A;  1M35 A;  1KP0 A;  4OOK A;  2EA4 A;  4IKR A;  1QZY A;  1O0X A;  1WL6 A;  1R5G A;  4FO7 A;  4U1B A;  3MR1 A;  2ADU A;  4U6J A;  2BHD A;  3BIQ A;  4FLJ A;  3MAT A;  4IKS A;  3Q6D A;  2BN7 A;  5JFR A;  3O5V A;  1MAT A;  2BWY A;  1C24 A;  1C21 A;  2DFI A;  2EVO A;  2BWV A;  1WL9 A;  3BIT A;  4R60 A;  3PKC A;  4MAT A;  4U6C A;  1B6A A;  2Q95 A;  3IU8 A;  5CDE A;  2GZ5 A;  3OOO A;  4KM3 A;  1XGS A;  3L7G A;  5FCF A;  1Y1N A;  2GA2 A;  2HOW A;  2BHA A;  3FMQ A; 
#chains in the Genus database with same CATH topology
 2NQ6 A;  2BWW A;  3CTZ A;  2GU4 A;  1XGM A;  1YW9 A;  3IU7 A;  4U6E A;  4ZWO A;  3FMR A;  3MX6 A;  4PNC A;  1KQ0 A;  5E5B A;  2OKN A;  2EVC A;  3OVK A;  5CDV A;  4EGE A;  4FO8 A;  4U6W A;  4A6V A;  2GG5 A;  3I7M A;  4IDY A;  1YVM A;  1BN5 A;  1WY2 A;  1BOA A;  4S01 A;  2OAZ A;  3PEB A;  2BWS A;  3PKA A;  4IF7 A;  2GG9 A;  3PKE A;  1QXY A;  3FM3 A;  1WKM A;  4ZNG A;  4S2T P;  2BWX A;  1YJ3 A;  5CDL A;  3PKD A;  4RZZ A;  2Q96 A;  4HXX A;  2Q94 A;  3TB5 A;  5JHU A;  1C27 A;  2V6C A;  2P9A A;  4S2R P;  1KQ9 A;  4RZY A;  2EVM A;  1WBQ A;  4FKC A;  2GG0 A;  3IU9 A;  1CHM A;  1WLR A;  1R58 A;  4B28 A;  1PV9 A;  3S6B A;  4Z7M A;  3CB6 A;  2V3X A;  1XGN A;  2BWU A;  1R5H A;  1QXW A;  2B3L A;  5E2C A;  2B3H A;  2GU5 A;  2IW2 A;  2P98 A;  3CB5 A;  2Q92 A;  5CE6 A;  5JI6 A;  1W2M A;  2V3Y A;  2Q93 A;  4U6Z A;  4ZWU A;  1C23 A;  3BIP A;  1C22 A;  2ZSG A;  4QR8 A;  1A16 A;  4A6W A;  3PN9 A;  5CNX A;  4S00 A;  4IPA A;  4U69 A;  5FCH A;  4FLI A;  2GG8 A;  4U70 A;  2BWT A;  3IL0 A;  5D6E A;  2GG7 A;  4JUQ A;  3IG4 A;  1N51 A;  2P99 A;  4PV4 A;  1B59 A;  4U76 A;  2GGB A;  2GTX A;  4FLL A;  1W7V A;  4IKT A;  2BB7 A;  1QXZ A;  1JAW A;  2EA2 A;  2GG3 A;  1YW8 A;  2V3Z A;  2GG2 A;  2G6P A;  5CIK A;  4IKU A;  5CLS A;  4FLK A;  5D6F A;  2Q8K A;  4IU6 A;  1YW7 A;  2BH3 A;  2B3K A;  1WN1 A;  4FUK A;  3RVA A;  2GGC A;  1XGO A;  3L24 A;  3PKB A;  3ROR A;  4U75 A;  2BHC A;  4ZWP A;  1XNZ A;  4IEC A;  4U73 A;  2GU7 A;  2NQ7 A;  3D27 A;  3TAV A;  4U71 A;  4RGZ 1;  2MAT A;  2GU6 A;  2BHB A;  3QOC A;  1M35 A;  1KP0 A;  4OOK A;  2EA4 A;  4IKR A;  1QZY A;  1O0X A;  1WL6 A;  1R5G A;  4FO7 A;  4U1B A;  3MR1 A;  2ADU A;  4U6J A;  2BHD A;  3BIQ A;  4FLJ A;  3MAT A;  4IKS A;  3Q6D A;  2BN7 A;  5JFR A;  3O5V A;  1MAT A;  2BWY A;  1C24 A;  1C21 A;  2DFI A;  2EVO A;  2BWV A;  1WL9 A;  3BIT A;  4R60 A;  3PKC A;  4MAT A;  4U6C A;  1B6A A;  2Q95 A;  3IU8 A;  5CDE A;  2GZ5 A;  3OOO A;  4KM3 A;  1XGS A;  3L7G A;  5FCF A;  1Y1N A;  2GA2 A;  2HOW A;  2BHA A;  3FMQ A; 
#chains in the Genus database with same CATH homology
 2NQ6 A;  2BWW A;  3CTZ A;  2GU4 A;  1XGM A;  1YW9 A;  3IU7 A;  4U6E A;  4ZWO A;  3FMR A;  3MX6 A;  4PNC A;  1KQ0 A;  5E5B A;  2OKN A;  2EVC A;  3OVK A;  5CDV A;  4EGE A;  4FO8 A;  4U6W A;  4A6V A;  2GG5 A;  3I7M A;  4IDY A;  1YVM A;  1BN5 A;  1WY2 A;  1BOA A;  4S01 A;  2OAZ A;  3PEB A;  2BWS A;  3PKA A;  4IF7 A;  2GG9 A;  3PKE A;  1QXY A;  3FM3 A;  1WKM A;  4ZNG A;  4S2T P;  2BWX A;  1YJ3 A;  5CDL A;  3PKD A;  4RZZ A;  2Q96 A;  4HXX A;  2Q94 A;  3TB5 A;  5JHU A;  1C27 A;  2V6C A;  2P9A A;  4S2R P;  1KQ9 A;  4RZY A;  2EVM A;  1WBQ A;  4FKC A;  2GG0 A;  3IU9 A;  1CHM A;  1WLR A;  1R58 A;  4B28 A;  1PV9 A;  3S6B A;  4Z7M A;  3CB6 A;  2V3X A;  1XGN A;  2BWU A;  1R5H A;  1QXW A;  2B3L A;  5E2C A;  2B3H A;  2GU5 A;  2IW2 A;  2P98 A;  3CB5 A;  2Q92 A;  5CE6 A;  5JI6 A;  1W2M A;  2V3Y A;  2Q93 A;  4U6Z A;  4ZWU A;  1C23 A;  3BIP A;  1C22 A;  2ZSG A;  4QR8 A;  1A16 A;  4A6W A;  3PN9 A;  5CNX A;  4S00 A;  4IPA A;  4U69 A;  5FCH A;  4FLI A;  2GG8 A;  4U70 A;  2BWT A;  3IL0 A;  5D6E A;  2GG7 A;  4JUQ A;  3IG4 A;  1N51 A;  2P99 A;  4PV4 A;  1B59 A;  4U76 A;  2GGB A;  2GTX A;  4FLL A;  1W7V A;  4IKT A;  2BB7 A;  1QXZ A;  1JAW A;  2EA2 A;  2GG3 A;  1YW8 A;  2V3Z A;  2GG2 A;  2G6P A;  5CIK A;  4IKU A;  5CLS A;  4FLK A;  5D6F A;  2Q8K A;  4IU6 A;  1YW7 A;  2BH3 A;  2B3K A;  1WN1 A;  4FUK A;  3RVA A;  2GGC A;  1XGO A;  3L24 A;  3PKB A;  3ROR A;  4U75 A;  2BHC A;  4ZWP A;  1XNZ A;  4IEC A;  4U73 A;  2GU7 A;  2NQ7 A;  3D27 A;  3TAV A;  4U71 A;  4RGZ 1;  2MAT A;  2GU6 A;  2BHB A;  3QOC A;  1M35 A;  1KP0 A;  4OOK A;  2EA4 A;  4IKR A;  1QZY A;  1O0X A;  1WL6 A;  1R5G A;  4FO7 A;  4U1B A;  3MR1 A;  2ADU A;  4U6J A;  2BHD A;  3BIQ A;  4FLJ A;  3MAT A;  4IKS A;  3Q6D A;  2BN7 A;  5JFR A;  3O5V A;  1MAT A;  2BWY A;  1C24 A;  1C21 A;  2DFI A;  2EVO A;  2BWV A;  1WL9 A;  3BIT A;  4R60 A;  3PKC A;  4MAT A;  4U6C A;  1B6A A;  2Q95 A;  3IU8 A;  5CDE A;  2GZ5 A;  3OOO A;  4KM3 A;  1XGS A;  3L7G A;  5FCF A;  1Y1N A;  2GA2 A;  2HOW A;  2BHA A;  3FMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...