3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
b'EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
4UEMA 1XD3A 3IFWA 4DM9A 2ETLA 3RIIA 3KVFA 2LENA 3KW5A 4JKJA 1CMXA 3A7SA 3IRTA 3TB3A 3RISA 4I6NA 3IHRA 4IG7A 1UCHA 4UELA
chains in the Genus database with same CATH superfamily
5L2LA 4JEHB 3CMLA 3UQ7A 3KVFA 3SRZA 5M4YA 1U5PA 3JAFA 3RC8A 3DJBA 3C4ZA 1SUMB 1J5WA 2CBIA 3KBTA 3ZC1A 2NR4A 5E0OA 3T1HT 4PJLA 4O2AE 4NUVA 3UU3A 2OA5A 1KNPA 3AXJA 2CXDA 2N2NA 4DR3T 3QC9A 2P9BA 3PE0A 5L4EA 4PK6A 5FL1A 4UELA 2VKOA 3AEDA 4O4LE 4X64T 4QH1A 1KEYA 4KBMB 5FY7A 3P8CD 2LSIA 3RIIA 2KZ7B 5IWAT 5FVKA 3JADA 4HWHA 5FNVE 4MBQA 4PFPA 3N5LA 4U2YA 3AE5A 4AQFC 2A9UA 4XAXB 2J62A 4C90A 2IDOB 2V26A 5JTGA 4B6XA 2LKHA 3PV0F 1N36T 2UU9T 3AE1A 1MMGA 2WWUA 1HS7A 1QSDA 3MKDA 2VKJA 2XQ7A 2KWHA 2BZBA 2PJQA 3OKQA 4YTMA 1XWMA 4JBWF 4U74A 2NP9A 5H6RB 3CQGB 1YW0A 2BDEA 4LF4T 2SPCA 4UVCB 2D0TA 4DV1T 3AXJB 3MJXA 1NWMX 2XQ9A 3NZPA 1JNRA 3AEBA 3PUWF 3Q5EA 1SHZC 2OV9A 3JCFA 2WDQA 5IYZE 4X5TA 4FJOA 5LG3A 4DR4T 3AEAA 4U7IA 3C50A 3LG7A 1XDPA 5HXSA 5FP3A 4O8SA 1T8BA 2XAGB 4IDOA 4DMVA 3RYFE 2MOZA 1CMXA 5FXZA 1KF6A 3O1JA 3M65A 4BAYB 3RRWA 2E5LT 3FZKB 4EAHA 4O4JE 2LHNA 2VQET 2CLYB 4BJMA 2WCAA 2QVAA 4BJNA 2BG9A 5L3BB 2PBIA 3FZHB 3SFEA 3ZEFB 1HTJF 2QRXA 3O1IA 3UFEA 3V5SA 3K8PC 5HXRA 2QA7A 5HXEA 4ANJA 2OLTA 3AAAB 3PU8A 1MIYA 4GYRA 4JI3T 2RP4A 4X1IE 3HKEE 3ONLC 3N9NA 2WM9A 3CWZB 4DBRA 3I0QA 2L3LA 4IDPA 5FXWA 2VB6A 3Q2MA 4Q25A 1MNEA 3FZMB 5FYMA 3UT5E 2WU2A 4YSZA 4M1PA 4C91A 4PW8A 4ILAA 4EV6A 4DR2T 2K5BB 4JI5T 4PJJA 1JNZA 3CK6A 4U7YA 3GWHA 1XMOT 4H63V 2LKGA 2PTFA 1N32T 5AQVB 3AE8A 3E08A 4ZI7E 4YFSA 4LFCT 5EK4A 2XQ4A 4KHPT 4I55E 3L8RA 2YDRA 2BG9B 4LF9T 2W4XA 4PJMA 4H9OC 2CEAA 4HWDA 1HNZT 4P0BA 2MPKA 1MMNA 3P50A 4ZXLA 3UULA 4AKLA 4CXXA 4TUYE 3K3OA 5HCJA 4OX9T 2BKNA 5JR9A 2WAUA 3EAMA 4NIQA 2ZM0A 5AQUB 1HNWT 1T98A 3AEFA 2XZEA 5KX5E 4JV5T 2X0LB 3PUQA 3MA9A 4OFZA 1D1AA 4CI3B 4HFDA 1D0ZA 2WZHA 2F4VT 4NPPA 2JIWA 3UU5A 4I6NA 1IJ6A 4ZS2A 3BQKA 1WYBA 5LHGB 3ANWB 1R8IA 2ACXA 5FY0A 2BS3A 2FUPA 5CA1E 4P09A 2WMOA 4XZCA 4ASKA 1BR4A 3SS1A 2JMKA 2CMRA 3I0OA 2EHOC 2V6YA 3VRBA 4ZZBA 2XSBA 2HPJA 4TX5A 3ZPOA 2JQHA 2XM1A 4TZ4C 3ZMUB 4B3MT 2DWKA 2M6IA 1N33T 3CVRA 1D1BA 4TWHA 2C5JA 1B7TA 3UUXB 5ABFA 1BR1A 3E22E 3ZCIA 4QKNA 4AQFA 2UUAT 2LRKA 3ONJA 4CI2B 5LGUB 3C64A 4U2ZA 4JYAT 2IMLA 4HFVA 5JR9B 2WY2A 5KXJA 3CQCB 3P7IA 2HHHT 4LFBT 3P4WA 3Q5DA 4ISTA 2IC9A 3CIRA 1IZNB 2MTQA 5AQKB 4X1YE 1AJ3A 3IFWA 5AQHB 3RIUC 4DNDA 2LRLA 1I6ZA 3F31A 3SWHA 3KV4A 2UUBT 4ZS3A 2CHOA 2LM9A 5AQPB 5LHIB 2UXNB 2IW5B 1IJ5A 1VCSA 3RYHE 5L3EB 4E7ZA 5JH7E 3MXZA 2Y48B 4G63A 4AKGA 3RKOA 4GK0E 3RYCE 3AVSA 5AQRB 2G0UA 3N9PA 4U3CA 4LMLA 2V6YB 3HA4A 5F3JA 3RC3A 3PTRB 4AISA 4EXTA 4UXNB 4DV6T 3EDUA 4QHOA 2VK9A 3T8OA 5AQSB 2UXBT 3RIFA 2HN1A 4YT0A 2NW8A 3UUBA 4KI0F 2LSGA 3NVOA 4ADZA 4OYKA 5CGMA 3RLFF 3P4RA 4PK5A 1QLBA 2ZM8A 1UUSA 4UVAB 1HCIA 4K0UA 1XZYA 4HN9A 4TV8E 3RGLA 4HE8A 3WI3A 2BBJA 4XBFB 4QH5A 5CB4E 5LBMA 2H7VC 5HYAA 4WNKA 4H9PC 2VKHA 3LBXB 2X9WA 3U78A 2XJ7A 2XQ8A 2B76A 3C4WA 4N78D 1X9BA 2X0YA 5L3GB 2HPLA 4EB6E 4COFA 4B3ST 5AQIB 3EABA 3TLTA 4YY3T 3R84B 4HWCA 1MIVA 2WB5A 1HX1B 5JQGE 3RF1A 4A56A 2CXFA 3ZYMA 4TNWA 3QUJA 3BQIA 3D0TA 2AXDS 4LF6T 3H3MA 3AA0B 4GKKT 4AIUA 5F5WA 4H9RC 3CQXC 1ZOYA 4DV0T 3AA7B 2Y6XA 4KMCA 4I50E 4IHJE 4LF5T 5ABHA 2WDRA 5HWYA 3R6NA 5A1LA 2I6HA 3HKBE 4IE7A 2W61A 5JDMA 3ZSSA 2X68A 5AQFB 4DR6T 3DP7A 2KMFA 1FMVA 3E0ZA 4WBNE 3L39A 5LP6E 4YLHA 5L47A 2JMHA 2XAHB 4I4TE 4JI0T 1D0XA 2XAFB 4O4HE 1LVKA 1N34T 1IBLT 1WR6A 3N9OA 3JC6D 4DBQA 5LNKA 2V7MA 4HWFA 2EHOD 3LFMA 5L3CB 2X67A 1NEKA 3A8YC 4UV8B 3ETUA 1OEDC 3UFGA 3QNUA 4ILCA 1IBKT 3IRTA 2CXLA 3FXDB 2LE8A 2EHOA 4HTEA 2KXPB 3ZLIA 4H9QC 1M62A 2XM2A 3IEEA 3RIAA 3FB2A 2UXXB 4PK4A 4UVBB 2XQ6A 3KFWX 3QB5A 5LJMA 2X9XA 2Q9QA 3IBPA 2NW9A 4ZZCA 3RHWA 3PDYA 1WR0A 3EVYA 3ETVA 3PUGA 1IAPA 3PURA 3OYZA 4ZI2D 4CN6A 1KNRA 1XNRT 3FXEB 3RRCA 2YN6A 1G8XA 2XPKA 1S35A 4WZXA 3PUAA 3S4UA 2W00A 2ODVA 4L5GA 5HEHA 3HKDE 2AE9A 1WCRA 3ZN1B 4EIWA 2KT9A 2QYWA 3GMIA 1UX5A 3RIUA 1YKHB 5EZYE 2E2AA 4TWFA 4JKJA 3J9X1 4A98A 1OEDE 3VR8A 4NXMT 1FEWA 2X9YA 2ZLYA 2VL8A 2CA5A 4HFCA 1UURA 4HKAA 2ETLA 4TV9E 2ZMAA 3AE7A 2EHOB 1WFDA 5JRCA 2Y8DA 2X51A 3I9YA 2MAWA 3K1SA 3TLVA 2JQ9A 4J2CA 4PJNA 5L3FB 5JDLA 2DHRA 2YU1A 1H7CA 1D0YA 4HWIB 4KX6A 1YD8G 1KK7A 2D5UA 4ERRA 2BBHA 2A2FX 1M7KA 2CBJA 2K48A 2CRBA 2LJLA 1VOMA 3LK42 5LJNA 1MMAA 5LYJE 5AFUL 2M67A 5DABA 5LG4A 2XUEA 2KWIB 3K3QC 4DUZT 3Q9DA 4YSXA 4AI6A 3N2KE 2A72A 5L3DB 2CHNA 4QXBB 2WMNA 2RPAA 2V7IA 2WQYA 3VKHA 5HEGA 4EZHA 5FL0A 3ZYLA 2YINA 4IL9A 4Z90A 4YSYA 2L8KA 5JRCB 4GIWA 5HCMA 5DQVA 4IIJE 2GK9A 4P0AA 3OVUA 2D9DA 1UX4A 3ZMTB 1CUNA 3W15B 3ONXA 3LJCA 4DV7T 2VL0A 2LSKA 3HR0A 3VHLA 3KV9A 1QUUA 5CFBA 3A5XA 2CLYC 3KV5A 3FZFB 3G06A 2W62A 2X0HA 4X66T 3IF8B 3AVRA 1NENA 1OXZA 5LGNB 1UCHA 1LVFA 3NBXX 2NTYA 3Q5XA 3F57A 4HFHA 4JLEA 3RX6A 2ES0A 3H37A 5FVLA 2WZIA 4H9NC 3AAIA 3RKGA 2Q9QC 3ZT7A 2FBWA 3MK7C 4QX8B 3N9QA 3I1AA 2FJDA 1S94A 4V1Av 3ZSTA 5TAOA 2V7LA 2X66A 1HNXT 2PG8A 3ZYKA 5AQOB 2XQ5A 2XTLA 3FBZA 3TKLB 3HL6A 1G73A 2BS2A 2L9QA 2H88A 1W0BA 2XQ3A 4X65T 4YXDA 3KV6A 4F8HA 1HR0T 5LB7B 4IT4A 1HG5A 1XD3A 2C0SA 4YJ2E 4IL4A 3NKZA 4TN7B 4YJ3E 5EK2A 2FJEA 1OEDA 4LFAT 2LEHA 1HF8A 5FXVA 1MIWA 3F2EA 2W66A 1YQ4A 4JEUB 2FJAA 2VASA 4ISSA 2LSJA 3L09A 1E7PA 3AE6A 2C5KT 3C51A 3PUZF 4DR1T 3Q5WA 4YHJA 1UK5A 1WLXA 3AE2A 4WW0A 4DR7T 4IE4A 3RPUA 2W2UA 4PNIA 4X1KE 2WSSV 4EOZB 5ABFB 2LOPA 2KSRA 5F8PA 1FJGT 3C98B 4TWDA 3J7Yq 4CN4A 3AE9A 1YQ3A 3MZKB 5AQQB 3LK2B 4QX7B 4ZOLE 3B57A 3AB3B 3UU8A 4B3RT 3O1HA 3KW5A 3B13A 2WU5A 2XAQB 4DV5T 4IE6A 2B1EA 3SFDA 2NOXA 4O2BE 5CA0E 4OK0A 4QXCB 3PUXF 3PJAJ 1T72A 1OEDB 3VKGA 2HH7A 3RQWA 2UXCT 1I94T 3LK3B 4HGAA 4ZHQE 5AQGB 3AEEA 4YTNA 4PFOA 3BQLA 5LXTE 4QH4A 4ILUA 4UR9A 4GOUA 5HEOA 3FZLB 5BMVE 1CHUA 2E8IA 2IAKA 3GA8A 3EI0A 3PJAA 2CE7A 5JVDE 2VURA 3EUHA 5H6QB 3TB3A 4OHFA 2UUCT 3PU3A 3KVBA 1T7SA 3AA1B 5L4HA 3KBUA 4JI8T 3EHZA 1ZP0A 2YU2A 3T1YT 1O3XA 1SA0E 5AQNB 4CN1A 4I43B 2DLRA 2JPFA 4DV4T 5C8YE 2XHEB 4G2AA 4AKIA 3AECA 4DO0A 4EGWA 4YTPA 3FBLA 5JDGA 4NXNT 2NTXA 5AQMB 5ABGA 3AA6B 4B3TT 1VCTA 2LOSA 1EZ3A 1BR0A 2BKPA 1XMQT 2VVNA 5LOVE 3RI5A 2HN2A 3H3AA 4DV2T 4EZ4A 4QWNB 1X79A 4EEBA 4KP3C 2YDSA 5ETWA 4ZI3C 3OPCA 5DJQC 3C4XA 3NZQA 3ZCJA 1J5ET 4LMKA 3FHNA 1WYCA 3KDSE 5J2TE 5LBQB 2JJ9A 3SOLA 3OBVE 2R6GF 5HWXA 1ZEEA 1IBMT 5KDMC 2E9XC 1KFYA 4JI7T 5JDNA 5LMUT 2Q9QD 3TLUA 3N9MA 4H9SE 1GQEA 5LMNT 2V7KA 4I0UA 5BR8T 1YXRA 3UQ4A 2XQYA 2J4GA 3CX6B 2J47A 1DU2A 5C3JA 3NRYA 4WBOA 5HAXA 1Y64B 3LDQB 2I0MA 4IE5A 5LA6E 4GYSA 4JI2T 4LF7T 1E2AA 2BS4A 3GN5A 3L3PA 4UIGA 3NRXA 5GONE 2WWVA 3CPZA 2BVLA 4KHZF 4ILBA 5HEUA 1E1HB 3UUMA 5J2UE 2M6BA 3N2OA 1V9DA 2IC6A 5FXXA 5JDHA 4Z8XA 4EEDA 4H63H 3CX8B 4U33A 3VR9A 5HEJA 4O4IE 5DQWA 2KINB 4DV3T 5HXHA 4IDZA 4MHCA 1Z0PA 2LSYA 3ZT5A 2V1DB 2JRKA 4UF0A 3DTOA 1ZKEA 4HFIA 4JUYA 3QOFA 4DUYT 2C5IT 4F6RC 2DL1A 2JQQA 3LSVA 3AAEB 2CWYA 5FMNA 4FI5A 5C2TA 1L0VA 3AE3A 4IDNA 5FKYA 3ZN0B 4MALA 1US7B 2Q9QB 2LM2A 4YHHT 3KINB 4ZEYA 2IIUA 4HFEA 3ESLA 3A7MA 2D2SA 2WP9A 1UCUA 3GN5B 4NUUA 5J0ZA 4CI1B 2YEVC 2ODUA 2WDVA 5AQTB 3CKDA 3ANWA 3PUSA 3MACA 3JAEA 2V8SV 2LENA 2DWGA 5HXCA 2A3DA 3RISA 2CWOA 3ABVA 3OTOT 4IREA 2KNDA 4MFRA 2LLYA 3ZMVB 2K3WA 3P4QA 4CXYA 3WAJA 2XQAA 4UF0B 3O9XA 3IHRA 2I59A 2LT3A 4L9IA 2BVMA 2J1DG 3RH3A 2YK0A 3PUVF 4JI6T 2NWBA 2ACZA 3UTKA 1ZV4X 2V5DA 2W63A 2CM0A 1MNDA 5FY1A 4IG7A 2IUBA 2XASB 4UEMA 5EK3A 1U4QA 3N2GE 2LHRA 3P4SA 4A97A 2VWAA 3V5UA 5JDQA 1KNZA 1W0AA 4CQIA 5JDFA 1J1JA 4DR5T 2E5VA 5IUXA 3ZMSB 1VRBA 2VVSA 3CX7B 2CCQA 4X20E 4JI1T 3P4PA 3ZJ2A 3ZKRA 1WRDA 3HI2A 3UUNA 4QXHB 1SE7A 1FIOA 5CJ5A 2V7JA 4AKHA 3JC6C 5ABEA 3A7SA 2WS3A 2W67A 2N9DA 4ZI3D 4AQGA 4JI4T 4Z91A 1Y01A 3TLSA 2YKSA 4U31A 4AQYT 2X9HA 2DCFA 3QK6A 2BKOA 5LHHB 1MMDA 4OYJA 3VU7H 1HFAA 3EDVA 3I9WA 1UGOA 1HX8A 2E9XD 2MBGA 4L0RA 2K9AA 4WYVA 4GK5E 3AE4A 1NAFA 4PAGA 2FJBA 2XAJB 2H89A 1LKXA 3O4XE 3M3ZB 4ZI2C 1Z8UA 2E9XA 2RA1A 2V5CA 5JREA 3IA3A 2BG9C 2KLQA 4X62T 4E7SA 3TLWA 5LCYA 3B5MA 3UU4A 2QGSA 3NWIA 3ZT6A 1HG2A 2NW7A 1BR2A 4DIDB 2MYSA 4AXPA 2YDQA 1FMWA 4P1NA 3LBXA 2VQFT 5LGTB 2K24A 5AQLB 3RQUA 4IGUA 1XDOA 1YKEB 2Z6EA 4KUMB 3UU6A 1W09A 2ZM2A 3ZC0A 2H3RA 5IHYA 2DNXA 2WBLA 4EYYR 5KMGP 4CZZB 1XNQT 3BK9A 4A5XA 4DVDA 3OJAA 4HEAA 4IE0A 3VRAA 2YOEA 3KVAA 2CPTA 4K0KT 4LMJA 4GKJT 1LRZA 3WAKA 3PUYF 1D1CA 3AEGA 3QB5K 3HKCE 5J1GA 4U72A 4AKRB 2V6XA 2XSAA 4UV9B 3RYIE 4CXWA 5ADXL 2E9XB 3K3NA 2BG9E 1W9RA 2UXDT 4BA9A 5AQJB 3ZMZB 4IDQA 3U3IA 3N9LA 4DM9A 4LF8T 3X1DA 4DMWA 2JQKA 4HFBA 4MLKA 2IHR1 2DI4A 2N1GA 3OYXA 2XY8B 2ZM6T 2W0GA 2PFVA 1OWAA 1ZHCA 2H7OA 5JR9C 4EYUA 3ZJ1A 2VKDA 4TNVA 2D0UA
chains in the Genus database with same CATH topology
4IE5A 5LA6E 4GYSA 4X1YE 1AJ3A 3IFWA 2A72A 5L2LA 3GN5A 4JEHB 5L3DB 4DNDA 3CMLA 3L3PA 4UIGA 3NRXA 5GONE 4QXBB 2WMNA 3F31A 3KV4A 3CPZA 3SRZA 2BVLA 3SWHA 5M4YA 3KVFA 2V7IA 3VKHA 4ZS3A 1U5PA 2LM9A 5LHIB 2UXNB 3RC8A 4EZHA 1E1HB 3UUMA 3DJBA 2IW5B 1IJ5A 3C4ZA 3ZYLA 5J2UE 3RYHE 5L3EB 3N2OA 4E7ZA 2YINA 5JH7E 1V9DA 2IC6A 3KBTA 3MXZA 3ZC1A 2Y48B 5FXXA 5JDHA 4Z8XA 5E0OA 4G63A 4PJLA 4AKGA 4H63H 2L8KA 4O2AE 4NUVA 5JRCB 4GIWA 2OA5A 4GK0E 3RKOA 2CXDA 2N2NA 3CX8B 5DQVA 3RYCE 4IIJE 3AVSA 2G0UA 3QC9A 2GK9A 3N9PA 4P0AA 2P9BA 4O4IE 5DQWA 2KINB 3PE0A 3HA4A 1UX4A 5HXHA 4IDZA 3ZMTB 4MHCA 5F3JA 3RC3A 1Z0PA 4PK6A 1CUNA 2LSYA 3W15B 3ONXA 3LJCA 3PTRB 4UELA 2VKOA 2LSKA 4O4LE 2V1DB 3HR0A 3VHLA 2JRKA 4UF0A 4EXTA 4UXNB 3KV9A 1QUUA 4KBMB 3EDUA 3A5XA 3DTOA 3P8CD 5FY7A 2LSIA 3RIIA 2KZ7B 4QHOA 1ZKEA 2VK9A 4JUYA 2CLYC 3KV5A 3T8OA 2W62A 2C5IT 4F6RC 5FNVE 3IF8B 4MBQA 4PFPA 2NW8A 3AVRA 1OXZA 5LGNB 3N5LA 2JQQA 1UCHA 4AQFC 1LVFA 3AAEB 3NBXX 2CWYA 4XAXB 5FMNA 2NTYA 3Q5XA 4C90A 2LSGA 4FI5A 3F57A 2V26A 3ZN0B 4ADZA 4B6XA 4MALA 1US7B 2Q9QB 4JLEA 4OYKA 3RX6A 2ES0A 3H37A 3KINB 4PK5A 4H9NC 3AAIA 2ZM8A 3ESLA 4UVAB 2Q9QC 1HCIA 2D2SA 3MK7C 4QX8B 4K0UA 1MMGA 3I1AA 1UCUA 3N9QA 2WWUA 3GN5B 4HN9A 1HS7A 1QSDA 4NUUA 1S94A 4V1Av 3MKDA 4TV8E 5TAOA 4CI1B 2YEVC 2V7LA 4HE8A 2VKJA 3WI3A 2X66A 2ODUA 2PG8A 3ZYKA 2KWHA 2XTLA 3ANWA 3CKDA 3PUSA 2BZBA 2PJQA 3FBZA 3OKQA 4XBFB 5CB4E 3TKLB 3MACA 3HL6A 1G73A 4U74A 5LBMA 2H7VC 2LENA 5HYAA 2DWGA 2L9QA 2NP9A 4WNKA 5H6RB 5HXCA 3CQGB 2A3DA 4H9PC 2VKHA 1YW0A 3RISA 3LBXB 2BDEA 2CWOA 3KV6A 2SPCA 4UVCB 2D0TA 2X9WA 3U78A 3MJXA 1HG5A 1XD3A 1NWMX 2C0SA 4YJ2E 2KNDA 3C4WA 3NZPA 4MFRA 4N78D 3ZMVB 4TN7B 1SHZC 4CXYA 4YJ3E 5EK2A 5L3GB 3WAJA 2HPLA 4EB6E 5IYZE 2LEHA 4UF0B 1HF8A 4FJOA 3O9XA 3IHRA 5FXVA 3C50A 1MIWA 3F2EA 2I59A 2LT3A 4L9IA 3LG7A 4JEUB 2VASA 2BVMA 5HXSA 3R84B 2J1DG 5FP3A 2YK0A 3RH3A 1MIVA 4ISSA 4O8SA 5JQGE 2LSJA 3L09A 2NWBA 2XAGB 3UTKA 4A56A 1ZV4X 2CXFA 3ZYMA 2C5KT 3QUJA 3BQIA 3C51A 4DMVA 3RYFE 2MOZA 3D0TA 1CMXA 5FXZA 3Q5WA 4YHJA 3O1JA 3M65A 3AA0B 2W63A 4BAYB 1WLXA 2CM0A 4WW0A 1MNDA 5FY1A 4IG7A 3RRWA 2XASB 4H9RC 3CQXC 4UEMA 4O4JE 4EAHA 3AA7B 4IE4A 3RPUA 2LHNA 5EK3A 1U4QA 2Y6XA 2CLYB 4KMCA 3N2GE 4BJMA 4BJNA 4I50E 4IHJE 2LHRA 5L3BB 2PBIA 4PNIA 4X1KE 2WSSV 3ZEFB 5HWYA 2VWAA 3R6NA 3V5UA 4EOZB 5A1LA 5JDQA 3HKBE 2LOPA 1KNZA 1HTJF 4IE7A 4CQIA 5F8PA 3O1IA 3C98B 2W61A 3UFEA 5JDFA 3V5SA 5JDMA 2X68A 3K8PC 3DP7A 5HXRA 2KMFA 2QA7A 3ZMSB 3J7Yq 1FMVA 1VRBA 3CX7B 3E0ZA 2CCQA 4X20E 3MZKB 5HXEA 4ANJA 4WBNE 3ZJ2A 5LP6E 3AAAB 3PU8A 4YLHA 2JMHA 1WRDA 1MIYA 4GYRA 3HI2A 3LK2B 3UUNA 4QXHB 1FIOA 4QX7B 2XAHB 4I4TE 4ZOLE 2RP4A 3AB3B 2V7JA 1D0XA 2XAFB 3B57A 4X1IE 3HKEE 4AKHA 3N9NA 2WM9A 3CWZB 3JC6C 3O1HA 4DBRA 3I0QA 2L3LA 4O4HE 1LVKA 5FXWA 2VB6A 3Q2MA 3KW5A 3B13A 1WR6A 3A7SA 3N9OA 1MNEA 2N9DA 2XAQB 3JC6D 4DBQA 4IE6A 4ZI3D 5FYMA 3UT5E 5LNKA 2B1EA 2V7MA 2NOXA 4O2BE 5CA0E 4AQGA 2EHOD 4OK0A 4QXCB 3LFMA 5L3CB 2X67A 4M1PA 4C91A 4PW8A 4UV8B 3VKGA 2HH7A 2X9HA 3ETUA 2DCFA 3LK3B 3QK6A 4HGAA 2K5BB 1MMDA 4ZHQE 5LHHB 4OYJA 3VU7H 3IRTA 1HFAA 4PJJA 2CXLA 3FXDB 4PFOA 2LE8A 2EHOA 4HTEA 2KXPB 3BQLA 5LXTE 4H9QC 3ZLIA 4ILUA 3EDVA 3I9WA 3IEEA 4GOUA 1HX8A 2E9XD 2MBGA 4L0RA 2K9AA 3FB2A 3GWHA 4GK5E 2UXXB 5BMVE 4PK4A 4UVBB 4H63V 1NAFA 2E8IA 3KFWX 4PAGA 2IAKA 3GA8A 3E08A 4ZI7E 2XAJB 4YFSA 2CE7A 5JVDE 5LJMA 5EK4A 2X9XA 1LKXA 3O4XE 2Q9QA 3EUHA 3IBPA 2NW9A 4ZI2C 5H6QB 3TB3A 4OHFA 3PDYA 4I55E 2E9XA 3EVYA 2RA1A 3PU3A 3KVBA 3ETVA 3PUGA 1IAPA 3PURA 3OYZA 4ZI2D 5JREA 3AA1B 4PJMA 3KBUA 3FXEB 2YU2A 3RRCA 1O3XA 1SA0E 4H9OC 2CEAA 1G8XA 4I43B 2DLRA 2KLQA 4P0BA 2JPFA 1MMNA 4E7SA 3UULA 1S35A 4AKLA 4CXXA 3PUAA 5LCYA 4TUYE 3K3OA 5C8YE 2XHEB 3S4UA 2W00A 2ODVA 2QGSA 4L5GA 5JR9A 1HG2A 2NW7A 2WAUA 4G2AA 2ZM0A 1BR2A 4AKIA 3HKDE 2MYSA 3ZN1B 4AXPA 4DO0A 1T98A 1FMWA 4EIWA 5KX5E 2KT9A 3LBXA 3GMIA 5LGTB 2X0LB 3FBLA 3PUQA 5JDGA 2K24A 1UX5A 3MA9A 2NTXA 4IGUA 1YKEB 4OFZA 2Z6EA 4KUMB 1YKHB 5EZYE 3AA6B 1D1AA 2LOSA 1EZ3A 4CI3B 2ZM2A 3ZC0A 1BR0A 2H3RA 5IHYA 1D0ZA 4JKJA 3J9X1 4I6NA 1IJ6A 2DNXA 2WBLA 5LOVE 4ZS2A 3BQKA 1WYBA 4EYYR 5KMGP 4CZZB 5LHGB 3ANWB 2ACXA 3BK9A 1FEWA 2X9YA 2ZLYA 2VL8A 3H3AA 2CA5A 5FY0A 4EZ4A 4DVDA 4HKAA 2ETLA 3OJAA 4QWNB 5CA1E 4HEAA 4IE0A 1X79A 4P09A 3KVAA 2WMOA 4TV9E 2ZMAA 4XZCA 2EHOB 4KP3C 4ASKA 1BR4A 5JRCA 2Y8DA 3SS1A 5ETWA 2X51A 4ZI3C 3I9YA 5DJQC 2JMKA 2CMRA 1LRZA 2EHOC 3I0OA 3WAKA 3C4XA 3NZQA 2HPJA 3ZCJA 4J2CA 4PJNA 4TX5A 1D1CA 5L3FB 5JDLA 3HKCE 3FHNA 5J1GA 4U72A 1WYCA 2DHRA 2YU1A 4AKRB 3KDSE 5J2TE 1H7CA 5LBQB 3ZPOA 1D0YA 4UV9B 4TZ4C 3RYIE 2JJ9A 3ZMUB 4CXWA 1YD8G 2DWKA 1IZNB 3SOLA 3OBVE 1KK7A 5ADXL 2E9XB 2D5UA 3CVRA 4ERRA 3K3NA 5HWXA 1D1BA 2C5JA 1ZEEA 2A2FX 1B7TA 5KDMC 3UUXB 2K48A 2E9XC 4BA9A 5JDNA 1BR1A 2Q9QD 3E22E 4QKNA 3N9MA 3ZCIA 4AQFA 2LJLA 4H9SE 2V7KA 1VOMA 3ZMZB 4CI2B 3LK42 5LGUB 3U3IA 5LJNA 3C64A 3N9LA 4DM9A 2XQYA 1MMAA 5LYJE 4HFVA 4DMWA 5AFUL 5JR9B 4MLKA 2M67A 2DI4A 5DABA 5LG4A 3CX6B 2XUEA 2KWIB 3K3QC 2N1GA 3OYXA 3Q9DA 2W0GA 3NRYA 2PFVA 1OWAA 3CQCB 1ZHCA 2H7OA 5JR9C 4EYUA 3P7IA 4WBOA 3ZJ1A 2VKDA 3N2KE 5HAXA 4AI6A 1Y64B 4ISTA 2IC9A 2D0UA 2MTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEM A;  1XD3 A;  3IFW A;  4DM9 A;  2ETL A;  3RII A;  3KVF A;  2LEN A;  3KW5 A;  4JKJ A;  1CMX A;  3A7S A;  3IRT A;  3TB3 A;  3RIS A;  4I6N A;  3IHR A;  4IG7 A;  1UCH A;  4UEL A; 
#chains in the Genus database with same CATH topology
 5L2L A;  4JEH B;  3CML A;  3UQ7 A;  3KVF A;  3SRZ A;  5M4Y A;  1U5P A;  3JAF A;  3RC8 A;  3DJB A;  3C4Z A;  1SUM B;  1J5W A;  2CBI A;  3KBT A;  3ZC1 A;  2NR4 A;  5E0O A;  3T1H T;  4PJL A;  4O2A E;  4NUV A;  3UU3 A;  2OA5 A;  1KNP A;  3AXJ A;  2CXD A;  2N2N A;  4DR3 T;  3QC9 A;  2P9B A;  3PE0 A;  5L4E A;  4PK6 A;  5FL1 A;  4UEL A;  2VKO A;  3AED A;  4O4L E;  4X64 T;  4QH1 A;  1KEY A;  4KBM B;  5FY7 A;  3P8C D;  2LSI A;  3RII A;  2KZ7 B;  5IWA T;  5FVK A;  3JAD A;  4HWH A;  5FNV E;  4MBQ A;  4PFP A;  3N5L A;  4U2Y A;  3AE5 A;  4AQF C;  2A9U A;  4XAX B;  2J62 A;  4C90 A;  2IDO B;  2V26 A;  5JTG A;  4B6X A;  2LKH A;  3PV0 F;  1N36 T;  2UU9 T;  3AE1 A;  1MMG A;  2WWU A;  1HS7 A;  1QSD A;  3MKD A;  2VKJ A;  2XQ7 A;  2KWH A;  2BZB A;  2PJQ A;  3OKQ A;  4YTM A;  1XWM A;  4JBW F;  4U74 A;  2NP9 A;  5H6R B;  3CQG B;  1YW0 A;  2BDE A;  4LF4 T;  2SPC A;  4UVC B;  2D0T A;  4DV1 T;  3AXJ B;  3MJX A;  1NWM X;  2XQ9 A;  3NZP A;  1JNR A;  3AEB A;  3PUW F;  3Q5E A;  1SHZ C;  2OV9 A;  3JCF A;  2WDQ A;  5IYZ E;  4X5T A;  4FJO A;  5LG3 A;  4DR4 T;  3AEA A;  4U7I A;  3C50 A;  3LG7 A;  1XDP A;  5HXS A;  5FP3 A;  4O8S A;  1T8B A;  2XAG B;  4IDO A;  4DMV A;  3RYF E;  2MOZ A;  1CMX A;  5FXZ A;  1KF6 A;  3O1J A;  3M65 A;  4BAY B;  3RRW A;  2E5L T;  3FZK B;  4EAH A;  4O4J E;  2LHN A;  2VQE T;  2CLY B;  4BJM A;  2WCA A;  2QVA A;  4BJN A;  2BG9 A;  5L3B B;  2PBI A;  3FZH B;  3SFE A;  3ZEF B;  1HTJ F;  2QRX A;  3O1I A;  3UFE A;  3V5S A;  3K8P C;  5HXR A;  2QA7 A;  5HXE A;  4ANJ A;  2OLT A;  3AAA B;  3PU8 A;  1MIY A;  4GYR A;  4JI3 T;  2RP4 A;  4X1I E;  3HKE E;  3ONL C;  3N9N A;  2WM9 A;  3CWZ B;  4DBR A;  3I0Q A;  2L3L A;  4IDP A;  5FXW A;  2VB6 A;  3Q2M A;  4Q25 A;  1MNE A;  3FZM B;  5FYM A;  3UT5 E;  2WU2 A;  4YSZ A;  4M1P A;  4C91 A;  4PW8 A;  4ILA A;  4EV6 A;  4DR2 T;  2K5B B;  4JI5 T;  4PJJ A;  1JNZ A;  3CK6 A;  4U7Y A;  3GWH A;  1XMO T;  4H63 V;  2LKG A;  2PTF A;  1N32 T;  5AQV B;  3AE8 A;  3E08 A;  4ZI7 E;  4YFS A;  4LFC T;  5EK4 A;  2XQ4 A;  4KHP T;  4I55 E;  3L8R A;  2YDR A;  2BG9 B;  4LF9 T;  2W4X A;  4PJM A;  4H9O C;  2CEA A;  4HWD A;  1HNZ T;  4P0B A;  2MPK A;  1MMN A;  3P50 A;  4ZXL A;  3UUL A;  4AKL A;  4CXX A;  4TUY E;  3K3O A;  5HCJ A;  4OX9 T;  2BKN A;  5JR9 A;  2WAU A;  3EAM A;  4NIQ A;  2ZM0 A;  5AQU B;  1HNW T;  1T98 A;  3AEF A;  2XZE A;  5KX5 E;  4JV5 T;  2X0L B;  3PUQ A;  3MA9 A;  4OFZ A;  1D1A A;  4CI3 B;  4HFD A;  1D0Z A;  2WZH A;  2F4V T;  4NPP A;  2JIW A;  3UU5 A;  4I6N A;  1IJ6 A;  4ZS2 A;  3BQK A;  1WYB A;  5LHG B;  3ANW B;  1R8I A;  2ACX A;  5FY0 A;  2BS3 A;  2FUP A;  5CA1 E;  4P09 A;  2WMO A;  4XZC A;  4ASK A;  1BR4 A;  3SS1 A;  2JMK A;  2CMR A;  3I0O A;  2EHO C;  2V6Y A;  3VRB A;  4ZZB A;  2XSB A;  2HPJ A;  4TX5 A;  3ZPO A;  2JQH A;  2XM1 A;  4TZ4 C;  3ZMU B;  4B3M T;  2DWK A;  2M6I A;  1N33 T;  3CVR A;  1D1B A;  4TWH A;  2C5J A;  1B7T A;  3UUX B;  5ABF A;  1BR1 A;  3E22 E;  3ZCI A;  4QKN A;  4AQF A;  2UUA T;  2LRK A;  3ONJ A;  4CI2 B;  5LGU B;  3C64 A;  4U2Z A;  4JYA T;  2IML A;  4HFV A;  5JR9 B;  2WY2 A;  5KXJ A;  3CQC B;  3P7I A;  2HHH T;  4LFB T;  3P4W A;  3Q5D A;  4IST A;  2IC9 A;  3CIR A;  1IZN B;  2MTQ A;  5AQK B;  4X1Y E;  1AJ3 A;  3IFW A;  5AQH B;  3RIU C;  4DND A;  2LRL A;  1I6Z A;  3F31 A;  3SWH A;  3KV4 A;  2UUB T;  4ZS3 A;  2CHO A;  2LM9 A;  5AQP B;  5LHI B;  2UXN B;  2IW5 B;  1IJ5 A;  1VCS A;  3RYH E;  5L3E B;  4E7Z A;  5JH7 E;  3MXZ A;  2Y48 B;  4G63 A;  4AKG A;  3RKO A;  4GK0 E;  3RYC E;  3AVS A;  5AQR B;  2G0U A;  3N9P A;  4U3C A;  4LML A;  2V6Y B;  3HA4 A;  5F3J A;  3RC3 A;  3PTR B;  4AIS A;  4EXT A;  4UXN B;  4DV6 T;  3EDU A;  4QHO A;  2VK9 A;  3T8O A;  5AQS B;  2UXB T;  3RIF A;  2HN1 A;  4YT0 A;  2NW8 A;  3UUB A;  4KI0 F;  2LSG A;  3NVO A;  4ADZ A;  4OYK A;  5CGM A;  3RLF F;  3P4R A;  4PK5 A;  1QLB A;  2ZM8 A;  1UUS A;  4UVA B;  1HCI A;  4K0U A;  1XZY A;  4HN9 A;  4TV8 E;  3RGL A;  4HE8 A;  3WI3 A;  2BBJ A;  4XBF B;  4QH5 A;  5CB4 E;  5LBM A;  2H7V C;  5HYA A;  4WNK A;  4H9P C;  2VKH A;  3LBX B;  2X9W A;  3U78 A;  2XJ7 A;  2XQ8 A;  2B76 A;  3C4W A;  4N78 D;  1X9B A;  2X0Y A;  5L3G B;  2HPL A;  4EB6 E;  4COF A;  4B3S T;  5AQI B;  3EAB A;  3TLT A;  4YY3 T;  3R84 B;  4HWC A;  1MIV A;  2WB5 A;  1HX1 B;  5JQG E;  3RF1 A;  4A56 A;  2CXF A;  3ZYM A;  4TNW A;  3QUJ A;  3BQI A;  3D0T A;  2AXD S;  4LF6 T;  3H3M A;  3AA0 B;  4GKK T;  4AIU A;  5F5W A;  4H9R C;  3CQX C;  1ZOY A;  4DV0 T;  3AA7 B;  2Y6X A;  4KMC A;  4I50 E;  4IHJ E;  4LF5 T;  5ABH A;  2WDR A;  5HWY A;  3R6N A;  5A1L A;  2I6H A;  3HKB E;  4IE7 A;  2W61 A;  5JDM A;  3ZSS A;  2X68 A;  5AQF B;  4DR6 T;  3DP7 A;  2KMF A;  1FMV A;  3E0Z A;  4WBN E;  3L39 A;  5LP6 E;  4YLH A;  5L47 A;  2JMH A;  2XAH B;  4I4T E;  4JI0 T;  1D0X A;  2XAF B;  4O4H E;  1LVK A;  1N34 T;  1IBL T;  1WR6 A;  3N9O A;  3JC6 D;  4DBQ A;  5LNK A;  2V7M A;  4HWF A;  2EHO D;  3LFM A;  5L3C B;  2X67 A;  1NEK A;  3A8Y C;  4UV8 B;  3ETU A;  1OED C;  3UFG A;  3QNU A;  4ILC A;  1IBK T;  3IRT A;  2CXL A;  3FXD B;  2LE8 A;  2EHO A;  4HTE A;  2KXP B;  3ZLI A;  4H9Q C;  1M62 A;  2XM2 A;  3IEE A;  3RIA A;  3FB2 A;  2UXX B;  4PK4 A;  4UVB B;  2XQ6 A;  3KFW X;  3QB5 A;  5LJM A;  2X9X A;  2Q9Q A;  3IBP A;  2NW9 A;  4ZZC A;  3RHW A;  3PDY A;  1WR0 A;  3EVY A;  3ETV A;  3PUG A;  1IAP A;  3PUR A;  3OYZ A;  4ZI2 D;  4CN6 A;  1KNR A;  1XNR T;  3FXE B;  3RRC A;  2YN6 A;  1G8X A;  2XPK A;  1S35 A;  4WZX A;  3PUA A;  3S4U A;  2W00 A;  2ODV A;  4L5G A;  5HEH A;  3HKD E;  2AE9 A;  1WCR A;  3ZN1 B;  4EIW A;  2KT9 A;  2QYW A;  3GMI A;  1UX5 A;  3RIU A;  1YKH B;  5EZY E;  2E2A A;  4TWF A;  4JKJ A;  3J9X 1;  4A98 A;  1OED E;  3VR8 A;  4NXM T;  1FEW A;  2X9Y A;  2ZLY A;  2VL8 A;  2CA5 A;  4HFC A;  1UUR A;  4HKA A;  2ETL A;  4TV9 E;  2ZMA A;  3AE7 A;  2EHO B;  1WFD A;  5JRC A;  2Y8D A;  2X51 A;  3I9Y A;  2MAW A;  3K1S A;  3TLV A;  2JQ9 A;  4J2C A;  4PJN A;  5L3F B;  5JDL A;  2DHR A;  2YU1 A;  1H7C A;  1D0Y A;  4HWI B;  4KX6 A;  1YD8 G;  1KK7 A;  2D5U A;  4ERR A;  2BBH A;  2A2F X;  1M7K A;  2CBJ A;  2K48 A;  2CRB A;  2LJL A;  1VOM A;  3LK4 2;  5LJN A;  1MMA A;  5LYJ E;  5AFU L;  2M67 A;  5DAB A;  5LG4 A;  2XUE A;  2KWI B;  3K3Q C;  4DUZ T;  3Q9D A;  4YSX A;  4AI6 A;  3N2K E;  2A72 A;  5L3D B;  2CHN A;  4QXB B;  2WMN A;  2RPA A;  2V7I A;  2WQY A;  3VKH A;  5HEG A;  4EZH A;  5FL0 A;  3ZYL A;  2YIN A;  4IL9 A;  4Z90 A;  4YSY A;  2L8K A;  5JRC B;  4GIW A;  5HCM A;  5DQV A;  4IIJ E;  2GK9 A;  4P0A A;  3OVU A;  2D9D A;  1UX4 A;  3ZMT B;  1CUN A;  3W15 B;  3ONX A;  3LJC A;  4DV7 T;  2VL0 A;  2LSK A;  3HR0 A;  3VHL A;  3KV9 A;  1QUU A;  5CFB A;  3A5X A;  2CLY C;  3KV5 A;  3FZF B;  3G06 A;  2W62 A;  2X0H A;  4X66 T;  3IF8 B;  3AVR A;  1NEN A;  1OXZ A;  5LGN B;  1UCH A;  1LVF A;  3NBX X;  2NTY A;  3Q5X A;  3F57 A;  4HFH A;  4JLE A;  3RX6 A;  2ES0 A;  3H37 A;  5FVL A;  2WZI A;  4H9N C;  3AAI A;  3RKG A;  2Q9Q C;  3ZT7 A;  2FBW A;  3MK7 C;  4QX8 B;  3N9Q A;  3I1A A;  2FJD A;  1S94 A;  4V1A v;  3ZST A;  5TAO A;  2V7L A;  2X66 A;  1HNX T;  2PG8 A;  3ZYK A;  5AQO B;  2XQ5 A;  2XTL A;  3FBZ A;  3TKL B;  3HL6 A;  1G73 A;  2BS2 A;  2L9Q A;  2H88 A;  1W0B A;  2XQ3 A;  4X65 T;  4YXD A;  3KV6 A;  4F8H A;  1HR0 T;  5LB7 B;  4IT4 A;  1HG5 A;  1XD3 A;  2C0S A;  4YJ2 E;  4IL4 A;  3NKZ A;  4TN7 B;  4YJ3 E;  5EK2 A;  2FJE A;  1OED A;  4LFA T;  2LEH A;  1HF8 A;  5FXV A;  1MIW A;  3F2E A;  2W66 A;  1YQ4 A;  4JEU B;  2FJA A;  2VAS A;  4ISS A;  2LSJ A;  3L09 A;  1E7P A;  3AE6 A;  2C5K T;  3C51 A;  3PUZ F;  4DR1 T;  3Q5W A;  4YHJ A;  1UK5 A;  1WLX A;  3AE2 A;  4WW0 A;  4DR7 T;  4IE4 A;  3RPU A;  2W2U A;  4PNI A;  4X1K E;  2WSS V;  4EOZ B;  5ABF B;  2LOP A;  2KSR A;  5F8P A;  1FJG T;  3C98 B;  4TWD A;  3J7Y q;  4CN4 A;  3AE9 A;  1YQ3 A;  3MZK B;  5AQQ B;  3LK2 B;  4QX7 B;  4ZOL E;  3B57 A;  3AB3 B;  3UU8 A;  4B3R T;  3O1H A;  3KW5 A;  3B13 A;  2WU5 A;  2XAQ B;  4DV5 T;  4IE6 A;  2B1E A;  3SFD A;  2NOX A;  4O2B E;  5CA0 E;  4OK0 A;  4QXC B;  3PUX F;  3PJA J;  1T72 A;  1OED B;  3VKG A;  2HH7 A;  3RQW A;  2UXC T;  1I94 T;  3LK3 B;  4HGA A;  4ZHQ E;  5AQG B;  3AEE A;  4YTN A;  4PFO A;  3BQL A;  5LXT E;  4QH4 A;  4ILU A;  4UR9 A;  4GOU A;  5HEO A;  3FZL B;  5BMV E;  1CHU A;  2E8I A;  2IAK A;  3GA8 A;  3EI0 A;  3PJA A;  2CE7 A;  5JVD E;  2VUR A;  3EUH A;  5H6Q B;  3TB3 A;  4OHF A;  2UUC T;  3PU3 A;  3KVB A;  1T7S A;  3AA1 B;  5L4H A;  3KBU A;  4JI8 T;  3EHZ A;  1ZP0 A;  2YU2 A;  3T1Y T;  1O3X A;  1SA0 E;  5AQN B;  4CN1 A;  4I43 B;  2DLR A;  2JPF A;  4DV4 T;  5C8Y E;  2XHE B;  4G2A A;  4AKI A;  3AEC A;  4DO0 A;  4EGW A;  4YTP A;  3FBL A;  5JDG A;  4NXN T;  2NTX A;  5AQM B;  5ABG A;  3AA6 B;  4B3T T;  1VCT A;  2LOS A;  1EZ3 A;  1BR0 A;  2BKP A;  1XMQ T;  2VVN A;  5LOV E;  3RI5 A;  2HN2 A;  3H3A A;  4DV2 T;  4EZ4 A;  4QWN B;  1X79 A;  4EEB A;  4KP3 C;  2YDS A;  5ETW A;  4ZI3 C;  3OPC A;  5DJQ C;  3C4X A;  3NZQ A;  3ZCJ A;  1J5E T;  4LMK A;  3FHN A;  1WYC A;  3KDS E;  5J2T E;  5LBQ B;  2JJ9 A;  3SOL A;  3OBV E;  2R6G F;  5HWX A;  1ZEE A;  1IBM T;  5KDM C;  2E9X C;  1KFY A;  4JI7 T;  5JDN A;  5LMU T;  2Q9Q D;  3TLU A;  3N9M A;  4H9S E;  1GQE A;  5LMN T;  2V7K A;  4I0U A;  5BR8 T;  1YXR A;  3UQ4 A;  2XQY A;  2J4G A;  3CX6 B;  2J47 A;  1DU2 A;  5C3J A;  3NRY A;  4WBO A;  5HAX A;  1Y64 B;  3LDQ B;  2I0M A;  4IE5 A;  5LA6 E;  4GYS A;  4JI2 T;  4LF7 T;  1E2A A;  2BS4 A;  3GN5 A;  3L3P A;  4UIG A;  3NRX A;  5GON E;  2WWV A;  3CPZ A;  2BVL A;  4KHZ F;  4ILB A;  5HEU A;  1E1H B;  3UUM A;  5J2U E;  2M6B A;  3N2O A;  1V9D A;  2IC6 A;  5FXX A;  5JDH A;  4Z8X A;  4EED A;  4H63 H;  3CX8 B;  4U33 A;  3VR9 A;  5HEJ A;  4O4I E;  5DQW A;  2KIN B;  4DV3 T;  5HXH A;  4IDZ A;  4MHC A;  1Z0P A;  2LSY A;  3ZT5 A;  2V1D B;  2JRK A;  4UF0 A;  3DTO A;  1ZKE A;  4HFI A;  4JUY A;  3QOF A;  4DUY T;  2C5I T;  4F6R C;  2DL1 A;  2JQQ A;  3LSV A;  3AAE B;  2CWY A;  5FMN A;  4FI5 A;  5C2T A;  1L0V A;  3AE3 A;  4IDN A;  5FKY A;  3ZN0 B;  4MAL A;  1US7 B;  2Q9Q B;  2LM2 A;  4YHH T;  3KIN B;  4ZEY A;  2IIU A;  4HFE A;  3ESL A;  3A7M A;  2D2S A;  2WP9 A;  1UCU A;  3GN5 B;  4NUU A;  5J0Z A;  4CI1 B;  2YEV C;  2ODU A;  2WDV A;  5AQT B;  3CKD A;  3ANW A;  3PUS A;  3MAC A;  3JAE A;  2V8S V;  2LEN A;  2DWG A;  5HXC A;  2A3D A;  3RIS A;  2CWO A;  3ABV A;  3OTO T;  4IRE A;  2KND A;  4MFR A;  2LLY A;  3ZMV B;  2K3W A;  3P4Q A;  4CXY A;  3WAJ A;  2XQA A;  4UF0 B;  3O9X A;  3IHR A;  2I59 A;  2LT3 A;  4L9I A;  2BVM A;  2J1D G;  3RH3 A;  2YK0 A;  3PUV F;  4JI6 T;  2NWB A;  2ACZ A;  3UTK A;  1ZV4 X;  2V5D A;  2W63 A;  2CM0 A;  1MND A;  5FY1 A;  4IG7 A;  2IUB A;  2XAS B;  4UEM A;  5EK3 A;  1U4Q A;  3N2G E;  2LHR A;  3P4S A;  4A97 A;  2VWA A;  3V5U A;  5JDQ A;  1KNZ A;  1W0A A;  4CQI A;  5JDF A;  1J1J A;  4DR5 T;  2E5V A;  5IUX A;  3ZMS B;  1VRB A;  2VVS A;  3CX7 B;  2CCQ A;  4X20 E;  4JI1 T;  3P4P A;  3ZJ2 A;  3ZKR A;  1WRD A;  3HI2 A;  3UUN A;  4QXH B;  1SE7 A;  1FIO A;  5CJ5 A;  2V7J A;  4AKH A;  3JC6 C;  5ABE A;  3A7S A;  2WS3 A;  2W67 A;  2N9D A;  4ZI3 D;  4AQG A;  4JI4 T;  4Z91 A;  1Y01 A;  3TLS A;  2YKS A;  4U31 A;  4AQY T;  2X9H A;  2DCF A;  3QK6 A;  2BKO A;  5LHH B;  1MMD A;  4OYJ A;  3VU7 H;  1HFA A;  3EDV A;  3I9W A;  1UGO A;  1HX8 A;  2E9X D;  2MBG A;  4L0R A;  2K9A A;  4WYV A;  4GK5 E;  3AE4 A;  1NAF A;  4PAG A;  2FJB A;  2XAJ B;  2H89 A;  1LKX A;  3O4X E;  3M3Z B;  4ZI2 C;  1Z8U A;  2E9X A;  2RA1 A;  2V5C A;  5JRE A;  3IA3 A;  2BG9 C;  2KLQ A;  4X62 T;  4E7S A;  3TLW A;  5LCY A;  3B5M A;  3UU4 A;  2QGS A;  3NWI A;  3ZT6 A;  1HG2 A;  2NW7 A;  1BR2 A;  4DID B;  2MYS A;  4AXP A;  2YDQ A;  1FMW A;  4P1N A;  3LBX A;  2VQF T;  5LGT B;  2K24 A;  5AQL B;  3RQU A;  4IGU A;  1XDO A;  1YKE B;  2Z6E A;  4KUM B;  3UU6 A;  1W09 A;  2ZM2 A;  3ZC0 A;  2H3R A;  5IHY A;  2DNX A;  2WBL A;  4EYY R;  5KMG P;  4CZZ B;  1XNQ T;  3BK9 A;  4A5X A;  4DVD A;  3OJA A;  4HEA A;  4IE0 A;  3VRA A;  2YOE A;  3KVA A;  2CPT A;  4K0K T;  4LMJ A;  4GKJ T;  1LRZ A;  3WAK A;  3PUY F;  1D1C A;  3AEG A;  3QB5 K;  3HKC E;  5J1G A;  4U72 A;  4AKR B;  2V6X A;  2XSA A;  4UV9 B;  3RYI E;  4CXW A;  5ADX L;  2E9X B;  3K3N A;  2BG9 E;  1W9R A;  2UXD T;  4BA9 A;  5AQJ B;  3ZMZ B;  4IDQ A;  3U3I A;  3N9L A;  4DM9 A;  4LF8 T;  3X1D A;  4DMW A;  2JQK A;  4HFB A;  4MLK A;  2IHR 1;  2DI4 A;  2N1G A;  3OYX A;  2XY8 B;  2ZM6 T;  2W0G A;  2PFV A;  1OWA A;  1ZHC A;  2H7O A;  5JR9 C;  4EYU A;  3ZJ1 A;  2VKD A;  4TNV A;  2D0U A; 
#chains in the Genus database with same CATH homology
 4IE5 A;  5LA6 E;  4GYS A;  4X1Y E;  1AJ3 A;  3IFW A;  2A72 A;  5L2L A;  3GN5 A;  4JEH B;  5L3D B;  4DND A;  3CML A;  3L3P A;  4UIG A;  3NRX A;  5GON E;  4QXB B;  2WMN A;  3F31 A;  3KV4 A;  3CPZ A;  3SRZ A;  2BVL A;  3SWH A;  5M4Y A;  3KVF A;  2V7I A;  3VKH A;  4ZS3 A;  1U5P A;  2LM9 A;  5LHI B;  2UXN B;  3RC8 A;  4EZH A;  1E1H B;  3UUM A;  3DJB A;  2IW5 B;  1IJ5 A;  3C4Z A;  3ZYL A;  5J2U E;  3RYH E;  5L3E B;  3N2O A;  4E7Z A;  2YIN A;  5JH7 E;  1V9D A;  2IC6 A;  3KBT A;  3MXZ A;  3ZC1 A;  2Y48 B;  5FXX A;  5JDH A;  4Z8X A;  5E0O A;  4G63 A;  4PJL A;  4AKG A;  4H63 H;  2L8K A;  4O2A E;  4NUV A;  5JRC B;  4GIW A;  2OA5 A;  4GK0 E;  3RKO A;  2CXD A;  2N2N A;  3CX8 B;  5DQV A;  3RYC E;  4IIJ E;  3AVS A;  2G0U A;  3QC9 A;  2GK9 A;  3N9P A;  4P0A A;  2P9B A;  4O4I E;  5DQW A;  2KIN B;  3PE0 A;  3HA4 A;  1UX4 A;  5HXH A;  4IDZ A;  3ZMT B;  4MHC A;  5F3J A;  3RC3 A;  1Z0P A;  4PK6 A;  1CUN A;  2LSY A;  3W15 B;  3ONX A;  3LJC A;  3PTR B;  4UEL A;  2VKO A;  2LSK A;  4O4L E;  2V1D B;  3HR0 A;  3VHL A;  2JRK A;  4UF0 A;  4EXT A;  4UXN B;  3KV9 A;  1QUU A;  4KBM B;  3EDU A;  3A5X A;  3DTO A;  3P8C D;  5FY7 A;  2LSI A;  3RII A;  2KZ7 B;  4QHO A;  1ZKE A;  2VK9 A;  4JUY A;  2CLY C;  3KV5 A;  3T8O A;  2W62 A;  2C5I T;  4F6R C;  5FNV E;  3IF8 B;  4MBQ A;  4PFP A;  2NW8 A;  3AVR A;  1OXZ A;  5LGN B;  3N5L A;  2JQQ A;  1UCH A;  4AQF C;  1LVF A;  3AAE B;  3NBX X;  2CWY A;  4XAX B;  5FMN A;  2NTY A;  3Q5X A;  4C90 A;  2LSG A;  4FI5 A;  3F57 A;  2V26 A;  3ZN0 B;  4ADZ A;  4B6X A;  4MAL A;  1US7 B;  2Q9Q B;  4JLE A;  4OYK A;  3RX6 A;  2ES0 A;  3H37 A;  3KIN B;  4PK5 A;  4H9N C;  3AAI A;  2ZM8 A;  3ESL A;  4UVA B;  2Q9Q C;  1HCI A;  2D2S A;  3MK7 C;  4QX8 B;  4K0U A;  1MMG A;  3I1A A;  1UCU A;  3N9Q A;  2WWU A;  3GN5 B;  4HN9 A;  1HS7 A;  1QSD A;  4NUU A;  1S94 A;  4V1A v;  3MKD A;  4TV8 E;  5TAO A;  4CI1 B;  2YEV C;  2V7L A;  4HE8 A;  2VKJ A;  3WI3 A;  2X66 A;  2ODU A;  2PG8 A;  3ZYK A;  2KWH A;  2XTL A;  3ANW A;  3CKD A;  3PUS A;  2BZB A;  2PJQ A;  3FBZ A;  3OKQ A;  4XBF B;  5CB4 E;  3TKL B;  3MAC A;  3HL6 A;  1G73 A;  4U74 A;  5LBM A;  2H7V C;  2LEN A;  5HYA A;  2DWG A;  2L9Q A;  2NP9 A;  4WNK A;  5H6R B;  5HXC A;  3CQG B;  2A3D A;  4H9P C;  2VKH A;  1YW0 A;  3RIS A;  3LBX B;  2BDE A;  2CWO A;  3KV6 A;  2SPC A;  4UVC B;  2D0T A;  2X9W A;  3U78 A;  3MJX A;  1HG5 A;  1XD3 A;  1NWM X;  2C0S A;  4YJ2 E;  2KND A;  3C4W A;  3NZP A;  4MFR A;  4N78 D;  3ZMV B;  4TN7 B;  1SHZ C;  4CXY A;  4YJ3 E;  5EK2 A;  5L3G B;  3WAJ A;  2HPL A;  4EB6 E;  5IYZ E;  2LEH A;  4UF0 B;  1HF8 A;  4FJO A;  3O9X A;  3IHR A;  5FXV A;  3C50 A;  1MIW A;  3F2E A;  2I59 A;  2LT3 A;  4L9I A;  3LG7 A;  4JEU B;  2VAS A;  2BVM A;  5HXS A;  3R84 B;  2J1D G;  5FP3 A;  2YK0 A;  3RH3 A;  1MIV A;  4ISS A;  4O8S A;  5JQG E;  2LSJ A;  3L09 A;  2NWB A;  2XAG B;  3UTK A;  4A56 A;  1ZV4 X;  2CXF A;  3ZYM A;  2C5K T;  3QUJ A;  3BQI A;  3C51 A;  4DMV A;  3RYF E;  2MOZ A;  3D0T A;  1CMX A;  5FXZ A;  3Q5W A;  4YHJ A;  3O1J A;  3M65 A;  3AA0 B;  2W63 A;  4BAY B;  1WLX A;  2CM0 A;  4WW0 A;  1MND A;  5FY1 A;  4IG7 A;  3RRW A;  2XAS B;  4H9R C;  3CQX C;  4UEM A;  4O4J E;  4EAH A;  3AA7 B;  4IE4 A;  3RPU A;  2LHN A;  5EK3 A;  1U4Q A;  2Y6X A;  2CLY B;  4KMC A;  3N2G E;  4BJM A;  4BJN A;  4I50 E;  4IHJ E;  2LHR A;  5L3B B;  2PBI A;  4PNI A;  4X1K E;  2WSS V;  3ZEF B;  5HWY A;  2VWA A;  3R6N A;  3V5U A;  4EOZ B;  5A1L A;  5JDQ A;  3HKB E;  2LOP A;  1KNZ A;  1HTJ F;  4IE7 A;  4CQI A;  5F8P A;  3O1I A;  3C98 B;  2W61 A;  3UFE A;  5JDF A;  3V5S A;  5JDM A;  2X68 A;  3K8P C;  3DP7 A;  5HXR A;  2KMF A;  2QA7 A;  3ZMS B;  3J7Y q;  1FMV A;  1VRB A;  3CX7 B;  3E0Z A;  2CCQ A;  4X20 E;  3MZK B;  5HXE A;  4ANJ A;  4WBN E;  3ZJ2 A;  5LP6 E;  3AAA B;  3PU8 A;  4YLH A;  2JMH A;  1WRD A;  1MIY A;  4GYR A;  3HI2 A;  3LK2 B;  3UUN A;  4QXH B;  1FIO A;  4QX7 B;  2XAH B;  4I4T E;  4ZOL E;  2RP4 A;  3AB3 B;  2V7J A;  1D0X A;  2XAF B;  3B57 A;  4X1I E;  3HKE E;  4AKH A;  3N9N A;  2WM9 A;  3CWZ B;  3JC6 C;  3O1H A;  4DBR A;  3I0Q A;  2L3L A;  4O4H E;  1LVK A;  5FXW A;  2VB6 A;  3Q2M A;  3KW5 A;  3B13 A;  1WR6 A;  3A7S A;  3N9O A;  1MNE A;  2N9D A;  2XAQ B;  3JC6 D;  4DBQ A;  4IE6 A;  4ZI3 D;  5FYM A;  3UT5 E;  5LNK A;  2B1E A;  2V7M A;  2NOX A;  4O2B E;  5CA0 E;  4AQG A;  2EHO D;  4OK0 A;  4QXC B;  3LFM A;  5L3C B;  2X67 A;  4M1P A;  4C91 A;  4PW8 A;  4UV8 B;  3VKG A;  2HH7 A;  2X9H A;  3ETU A;  2DCF A;  3LK3 B;  3QK6 A;  4HGA A;  2K5B B;  1MMD A;  4ZHQ E;  5LHH B;  4OYJ A;  3VU7 H;  3IRT A;  1HFA A;  4PJJ A;  2CXL A;  3FXD B;  4PFO A;  2LE8 A;  2EHO A;  4HTE A;  2KXP B;  3BQL A;  5LXT E;  4H9Q C;  3ZLI A;  4ILU A;  3EDV A;  3I9W A;  3IEE A;  4GOU A;  1HX8 A;  2E9X D;  2MBG A;  4L0R A;  2K9A A;  3FB2 A;  3GWH A;  4GK5 E;  2UXX B;  5BMV E;  4PK4 A;  4UVB B;  4H63 V;  1NAF A;  2E8I A;  3KFW X;  4PAG A;  2IAK A;  3GA8 A;  3E08 A;  4ZI7 E;  2XAJ B;  4YFS A;  2CE7 A;  5JVD E;  5LJM A;  5EK4 A;  2X9X A;  1LKX A;  3O4X E;  2Q9Q A;  3EUH A;  3IBP A;  2NW9 A;  4ZI2 C;  5H6Q B;  3TB3 A;  4OHF A;  3PDY A;  4I55 E;  2E9X A;  3EVY A;  2RA1 A;  3PU3 A;  3KVB A;  3ETV A;  3PUG A;  1IAP A;  3PUR A;  3OYZ A;  4ZI2 D;  5JRE A;  3AA1 B;  4PJM A;  3KBU A;  3FXE B;  2YU2 A;  3RRC A;  1O3X A;  1SA0 E;  4H9O C;  2CEA A;  1G8X A;  4I43 B;  2DLR A;  2KLQ A;  4P0B A;  2JPF A;  1MMN A;  4E7S A;  3UUL A;  1S35 A;  4AKL A;  4CXX A;  3PUA A;  5LCY A;  4TUY E;  3K3O A;  5C8Y E;  2XHE B;  3S4U A;  2W00 A;  2ODV A;  2QGS A;  4L5G A;  5JR9 A;  1HG2 A;  2NW7 A;  2WAU A;  4G2A A;  2ZM0 A;  1BR2 A;  4AKI A;  3HKD E;  2MYS A;  3ZN1 B;  4AXP A;  4DO0 A;  1T98 A;  1FMW A;  4EIW A;  5KX5 E;  2KT9 A;  3LBX A;  3GMI A;  5LGT B;  2X0L B;  3FBL A;  3PUQ A;  5JDG A;  2K24 A;  1UX5 A;  3MA9 A;  2NTX A;  4IGU A;  1YKE B;  4OFZ A;  2Z6E A;  4KUM B;  1YKH B;  5EZY E;  3AA6 B;  1D1A A;  2LOS A;  1EZ3 A;  4CI3 B;  2ZM2 A;  3ZC0 A;  1BR0 A;  2H3R A;  5IHY A;  1D0Z A;  4JKJ A;  3J9X 1;  4I6N A;  1IJ6 A;  2DNX A;  2WBL A;  5LOV E;  4ZS2 A;  3BQK A;  1WYB A;  4EYY R;  5KMG P;  4CZZ B;  5LHG B;  3ANW B;  2ACX A;  3BK9 A;  1FEW A;  2X9Y A;  2ZLY A;  2VL8 A;  3H3A A;  2CA5 A;  5FY0 A;  4EZ4 A;  4DVD A;  4HKA A;  2ETL A;  3OJA A;  4QWN B;  5CA1 E;  4HEA A;  4IE0 A;  1X79 A;  4P09 A;  3KVA A;  2WMO A;  4TV9 E;  2ZMA A;  4XZC A;  2EHO B;  4KP3 C;  4ASK A;  1BR4 A;  5JRC A;  2Y8D A;  3SS1 A;  5ETW A;  2X51 A;  4ZI3 C;  3I9Y A;  5DJQ C;  2JMK A;  2CMR A;  1LRZ A;  2EHO C;  3I0O A;  3WAK A;  3C4X A;  3NZQ A;  2HPJ A;  3ZCJ A;  4J2C A;  4PJN A;  4TX5 A;  1D1C A;  5L3F B;  5JDL A;  3HKC E;  3FHN A;  5J1G A;  4U72 A;  1WYC A;  2DHR A;  2YU1 A;  4AKR B;  3KDS E;  5J2T E;  1H7C A;  5LBQ B;  3ZPO A;  1D0Y A;  4UV9 B;  4TZ4 C;  3RYI E;  2JJ9 A;  3ZMU B;  4CXW A;  1YD8 G;  2DWK A;  1IZN B;  3SOL A;  3OBV E;  1KK7 A;  5ADX L;  2E9X B;  2D5U A;  3CVR A;  4ERR A;  3K3N A;  5HWX A;  1D1B A;  2C5J A;  1ZEE A;  2A2F X;  1B7T A;  5KDM C;  3UUX B;  2K48 A;  2E9X C;  4BA9 A;  5JDN A;  1BR1 A;  2Q9Q D;  3E22 E;  4QKN A;  3N9M A;  3ZCI A;  4AQF A;  2LJL A;  4H9S E;  2V7K A;  1VOM A;  3ZMZ B;  4CI2 B;  3LK4 2;  5LGU B;  3U3I A;  5LJN A;  3C64 A;  3N9L A;  4DM9 A;  2XQY A;  1MMA A;  5LYJ E;  4HFV A;  4DMW A;  5AFU L;  5JR9 B;  4MLK A;  2M67 A;  2DI4 A;  5DAB A;  5LG4 A;  3CX6 B;  2XUE A;  2KWI B;  3K3Q C;  2N1G A;  3OYX A;  3Q9D A;  2W0G A;  3NRY A;  2PFV A;  1OWA A;  3CQC B;  1ZHC A;  2H7O A;  5JR9 C;  4EYU A;  3P7I A;  4WBO A;  3ZJ1 A;  2VKD A;  3N2K E;  5HAX A;  4AI6 A;  1Y64 B;  4IST A;  2IC9 A;  2D0U A;  2MTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...