3JB9F

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
82
structure length
82
Chain Sequence
b'MKLVRFLMKLTNETVSIELKNGTIVHGTITSVDMQMNTHLKAVKMTVKGREPVPVETLSIRGNNIRYYILPDSLPLDTLLID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 10
structure length 82
sequence length 82
chains with identical sequence f
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9F00
5GAMg 4MMLA 4JRKA 4C8QA 2DXUA 5GAOm 4M75C 1BIAA 3M4GA 3SWNB 5GAMe 1HXDA 5GAN8 1I8FA 2E64A 4M77A 4C92A 1M8VA 4XTVA 4PJOF 2EJFA 3V8JA 4NL2A 3JCMX 2VC8A 2YLCA 4XTUA 4DQ2A 4EMKC 4PJOD 1I4K1 5GANg 4J5YA 3SB2A 4A54A 4M7AF 3JB9J 3PGGA 3V7SA 4M7AD 1Y96A 5GANe 4JRIA 2CGHA 4M77B 1KQ2A 3RESA 4M78A 3V8KA 4M7DA 3INZA 2Y90A 2YLBA 3FB9A 5LJ5j 3QO3A 5GANf 1WQ7A 2E41A 1WQWA 3V8LA 4QVCA 5GAOq 4PJOA 4J6XA 1U1TA 4A53A 5GAN7 5GANh 1TH7A 4XU3A 4M78B 1LOJA 1M5Q1 5I21A 4M7DB 4PJOG 4PJOE 5CAIA 5GAOn 2EJ9A 4Y91A 5GAOp 4M7AG 4OP0A 1D3BB 4X9DA 4XU1A 3JB9H 4M75A 4M7AE 5LJ3g 2JN0A 4PJOC 3RUXA 4M7DD 3BW1A 3JCMd 1MGQA 2EJGA 5LJ3e 4JLIA 5DY9A 4M7AC 3RKXA 4XU2A 2DXTA 4M75B 2RM4A 1WNLA 4XTYA 5LJ3f 4EMKA 1B34A 2I2LA 4N0AC 5GAN4 3JCMc 1N9RA 5LJ3h 4F7UF 5GMKm 2RB6A 5GAOl 3L2ZA 1X01A 2RA2A 3EFRA 4M7AB 2YHTA 5LJ5d 3QSUA 1LNXA 4MMKA 4XQ3A 4EMKB 3JCMe 2DTHA 1B34B 3AHUA 3HFOA 5GMKj 4EMHA 1D3BA 2RD1A 4WF2A 2FB7A 3BY7A 3JCMf 3QUIA 4X9CA 4XTWA 3JCMb 4C8QF 4XU0A 3JCMh 4C8QD 1I5LA 3L1AA 1LJOA 2FYKA 3JCMQ 4NOYA 1HK9A 1YCYA 2DZ9A 1H641 4V2SA 4F7UG 4F7UE 2QTXA 3EFSA 3QHSA 4J6YA 4M77D 2K57A 4C92F 4C92D 2DZCA 3JCMW 2E65A 2E10A 4M7AA 5LJ5f 3JB9F 2DEQA 5GAMd 3JB9D 4QVDA 5GAMj 1I81A 5LJ5h 4XTXA 3V7CA 4PJOB 4M78F 3JCMV 4M78D 4HA8A 4N0AA 3HSBA 4RCBA 2DKGA 2DTOA 4XTZA 3SWNC 3JCMg 4C8QE 4C8QG 5GAN6 4NL3A 5GAN3 2DJZA 2ZGWA 4F7UB 5GAOr 3FJPA 5GANd 1JBMA 5GANj 4C8QC 4M77G 4C92G 1KQ1A 4M77E 3BFMA 4C92E 2E1HA 4J6WA 1N9SA 4PNOA 2EAYA 2VXFA 3HFNA 3VU3C 5GAN5 3JB9G 4M75F 4HT8A 4M75D 4M77C 4C92C 5GMKl 5LJ5g 5GAMf 2EWNA 4M78G 4RCCA 4C8QB 2HNIA 4M78E 4JUVA 3RKWA 4EMGA 5LJ5e 4M77F 2DTIA 1U1SA 5GAMh 4M7DG 4M7DE 3JB9I 5GMKe 5GAN2 4M78C 3RKYA 5GMKi 4C92B 3GIBA 3JCMJ 3JCMP 4M7DC 3V7RA 2VXEA 4F7UA 3RIRA 3BDUA 3FIFA 5LJ3d 5LJ3j 4HT9A 1BIBA 3RERA 5GMKh 1Y96B 4M7DF 3SWNA 4M75G 1JRIA 4M75E 2DVEA 1WPYA
chains in the Genus database with same CATH superfamily
1PRLC 4FW2A 2J06A 3M59A 3M4GA 1UEBA 5GAMe 3OYNA 1UTIA 2DETA 1K9MR 4KULA 1NEBA 2L3SA 1WXUA 2Y4XA 5KYXA 4HXJA 5HY6A 1MHNA 1WHGA 4QW2A 3M0SA 4JRPA 1H3HA 3VRZA 1PM3A 2RJFA 5I21A 4Y92A 2RI5A 5D6YA 4OP0A 4XU1A 3I55T 2V1RA 4KUIA 4PJOC 3PFSA 3VS7A 5DY9A 2QEXT 1G3SA 2I2LA 3CC7A 2O2OA 3M0UA 2EKHA 3N5BB 4E7HA 3GPLA 2KYMA 1TXQA 1KHCA 2LQNA 3QUIA 2ZZDA 5C6SA 1YN8A 2FYKA 3M0TA 9ATCB 4V2SA 3TU4K 3EFSA 2XD0A 3OB9A 3ZEHA 4ELYC 3NFCA 1ZBXA 3RBBB 4AFQC 4FT2A 2QDYB 1I81A 5CKEA 2OTLQ 2J6FA 1GCQA 1Q7YU 5GAN6 1NM7A 5CK9A 2KY9A 3FJPA 1SKUB 1K9MU 2DFUA 4M77E 3EFOB 4PK4A 1OPLA 3PT9A 4ZTFA 2KVQG 5LJ5g 2EIFA 2EGAA 2NUZA 4ME7A 1X6OA 4BY6B 4C92B 2OTJT 1FMKA 3J80E 2VV5A 3VYGA 3CMET 4M75G 3LH5A 1RL2A 1C1AA 1M3BA 1QKXA 5FU6C 5KYWA 4CC3A 4C8QA 2DXUA 2XDDA 1QKWA 1BIAA 4N4HA 2DA9A 1CSKA 4IUVA 4XK8E 2HBPA 4HVWA 1TUGB 1ZA1B 4IUTA 4A4GA 5A0LA 5KYWB 1VQ6T 1T0HA 4PJOD 4FYWB 2M9UA 3PGGA 3QZ5B 3OYAA 1JXOA 2QA4Q 4WCIA 3OYFA 3CCVQ 2YRCA 1YJNT 3G71A 1U1TA 2CSIA 2EYXA 1MNEA 3CCLQ 3OYLA 3C95A 1RACB 4R55A 2DIQA 2EJ9A 3QYHB 3A8GB 3LGLA 3UA6A 1VQ4T 1UUEA 1AOJA 2VYTA 3WVEB 2CP7A 1LVKA 2AKLA 2F5TX 4EPCA 3MHXA 4E6RA 4WF2A 4BI8B 2CYZB 2LNHB 3JCMb 1EZZB 3AT1B 1Q81R 3JCMQ 3H0FA 3CBPA 4NOYA 1NPPA 1KQSS 1X2QA 3KBGA 2GCXA 1K73U 1NJIR 3I35A 4QQ6A 3ZL7C 2DJQA 2E65A 2E10A 2QGGA 2EPDA 3EG9A 4QVDA 1MV3A 1WHMA 1VQLQ 2CP0A 2CH4A 2QQRA 1R0BG 2K79A 3CCJA 3LW5E 3M58A 1MV0B 3OSSC 4M77G 4O5VA 3I56A 2HKNA 1QLYA 3ULRB 3EG0A 5CVIA 4DA4A 5GAMf 4RG2A 4FSSA 3TCJA 2KGTA 3CC4T 2V8KA 1E6GA 5IN1A 4M78C 1MMDA 4BB7A 3I55Q 3JCMJ 2E6NA 1M1KR 2CZ1B 2OAUA 1YI2T 5FRNA 2CP2A 5CKDA 2QEXQ 2RHUA 2RHIA 2EYWA 2HAXA 1JB0E 4IIMA 3CCEA 4JDSA 4UC4A 1HXDA 1GBRA 3P8BB 4F14A 3HHTB 4LD9K 1M8VA 1VQOT 4PJOF 2EJFA 3UPUA 2YLCA 4FU6A 3SB2A 4X34A 1BI2A 2QK0A 3QPHA 5L23A 2YRDA 5KCOA 3JAME 5GANe 5IHIA 4J9GA 1GCQC 4D8DA 3KUFA 1KQ2A 2V8JA 3H41A 2FVUA 4AFZC 3CCST 1Q95G 4A53A 2A28A 2PUOB 1Q81U 1W2BS 2E3IA 4GY5A 4B6MA 1AWXA 1D3BB 2QQSA 3TQ7P 1P92A 1NLPC 2RMOA 5LJ3e 4JLIA 3THKA 1DJ7B 3DLMA 3SDZA 1VOMA 5CIUA 3CCQT 3MP1A 4N0AC 3MJXA 1BI1A 1N9RA 4F7UF 3G6EQ 1YWOA 2DD4A 1TTHB 4MZMA 3Q1JA 1QWEA 2HEQA 2MMPA 3NTKA 1PKSA 1VUBA 1K0SA 1B07A 2FB7A 1G5VA 1UB4A 2ROTA 1RAFB 3NTIA 1UGSB 3CMEQ 4JS4A 1G83A 1M2VB 3FJ5A 1PHTA 2K57A 1M1KU 4RTVA 2BE9B 4B9WA 1VQNT 2M51A 2I0NA 4QKUA 4M78D 1MUZA 4HA8A 4NS5A 3CBMA 4C8QE 1VQ6Q 4HVVA 2LX7A 2MI6A 1BK2A 5GAOr 2L2PA 3VS0A 3S3OA 4J6WA 1WHKA 4BE0A 4HT8A 1YJNQ 1PWTA 3GLXA 1XNIA 3M57A 4EMGA 2B8AA 3RKWA 1SRLA 4ZGDB 3LWHA 3GP8A 5GAN2 2P0PA 2X3XD 5GMKi 1VQ4Q 2K5IA 1UDLA 2LTOA 1KG1A 2AZVA 1V1CA 1ZSZA 1WPYA 3EGDB 3MP6A 1QP2A 3OMGA 3OMCA 4OGCA 4EDUA 2JJ9A 2QI2A 4EMKC 2XIDA 2CZ6B 4ZGJB 3ZFJA 5KH6A 3CCMA 2MWOA 1SHFA 5KYYA 2BZXA 1GCPA 1WZOA 3OYEA 3HKSA 3CCUA 2GNCA 3OSVA 1M4ZA 1PC0A 2LT1A 8AT1B 5KYYB 4PKCC 2X51A 3BW1A 2K3YA 5I11A 1MGQA 3RKXA 3URGA 1WHHA 1WYXA 1AWOA 2XICA 2O9SA 3PMTA 1SG5A 3U23A 3JCMe 3CC4Q 3RMQA 3REBB 4LD6A 3TVTA 4XTWA 4XU0A 1YI2Q 2C0IA 3RNJA 3JRZA 2E5QA 2FRWA 3QHSA 2OTJA 2K9GA 4A63B 3L42A 5A0DA 4M7AA 2CUBA 2FO0A 2JM9A 4M78F 2K3BA 4PFZA 5FWBA 4AG1C 4C8QG 1VQOQ 2DL3A 4FIBA 2CREA 1E6HA 1BBZA 4QQDA 1J3TA 4IKFA 1M2OA 3P8HA 2EAYA 1VQMQ 3CCSQ 5HCKA 1VA7A 2EWNA 1NLOC 4JUVA 5LJ5e 1KQSP 2LZ6B 3FDRA 4ORZA 1WIEA 1M27C 3RIRA 2DYBA 4M7DF 1Y96B 4M4ZA 1JQQA 3TSWA 3OYCA 2EKOA 5KE3A 3FEOA 2K3XA 4L6V5 2YRVA 1S72A 1VQ4A 4RTUA 3UDCA 4KH0B 3OYMA 4XTVA 4AG2C 4NL2A 1ZUYA 2DIGA 2ED0A 2PU9B 1UGPB 2Y90A 5GAOq 1W4SA 3KXTA 1M30A 3D7SB 2HQHA 1BCMA 2F5KA 3EG3A 4KBMB 2EYQA 3LLRA 1VQNQ 1KD1R 1NEGA 4X9DA 3CBOA 3JCMd 1R8OB 2L89A 1Q86R 4J9EA 4ZTJA 1H3ZA 3P8DA 4L5GA 2MCNA 2YHTA 3UATA 3OS5A 3CQTA 2P4TA 3VS1A 5FW9A 1IGUA 2GFAA 1PSEA 4JPBW 3MEVA 2BUDA 4CC4B 3LYIA 2DO3A 3JB9D 3LX7A 4LUDA 3F70A 2VB6A 1U5SA 2LDMA 1G3WA 2DL7A 4F7UB 1WHLA 1JJ2A 2JTFA 2VWFA 3OS2A 5FLXE 1Y0MA 1N9SA 3X26B 2CSQA 2CP6A 2L3RA 2JTEA 4HKEA 4C0DB 2EQMA 5GAMh 1U1SA 2R5AA 1XQHA 1N8RC 2QQAA 4FSXA 2DERA 5I22A 2E4HA 2Z0WA 3H0HA 3OYHA 1OPKA 1YBYA 1PG5B 4ESRA 3CC2A 4MMLA 4ELZC 4M75C 3UWNA 3QJ6A 5FU6B 2NUTA 2ZAEA 2H8HA 3CCQA 1ZX6A 4KRTA 4CRIA 2XDBA 1WGSA 1VQ9T 1YITA 2CGHA 1QCOA 3BDLA 2ATCB 1K4US 3CEYA 1WQ7A 2E41A 2RHZA 2KE9A 1N27A 1ZA2B 4XU3A 5LL6S 2KT8A 3VYHB 4FCYA 1AHJB 5CR2A 2RJDA 2AT1B 1K0XA 1VQPT 4M7AE 1AT1B 3QIIA 3ME9A 1VQLT 5FRMA 4E7LA 4OMOA 4OB2B 3MEUA 1YIJA 1VQ5A 2H3JA 1KFZA 2DK3A 2ZPGB 2RA2A 3EFRA 4HVUA 1QVFS 4MMKA 4E7KA 4LN2A 1IGQA 1NBEB 2JMCA 2BZ8A 1R0CB 1BYMA 1LJOA 1SSFA 3ER0A 3A98A 4LDXA 4ZN3A 1H92A 3DB4A 4XAXB 3PVQA 3UF4A 3L2UA 2CDTA 5LJ5f 3JB9F 3MEWA 4XTXA 4D8KA 2M1HA 5EG2A 4LUEA 4GBQA 4KGVB 2DKGA 4RCBA 3JCMg 3JV3A 2K4YA 2ZGWA 2RN8A 2AZSA 2KRSA 1I5OB 3SFMA 3I5SA 3T9NA 1OX9A 2QTVA 4M75D 2HQEA 2J6KA 4M77C 5GMKl 3CCRT 2PQWA 3GF5A 4MDWA 5CKFA 2HMAA 3QZ9B 5GMKh 3EFOA 1BU1A 2QGFB 3C12A 4K11A 1BKBA 5GJWB 3EG1A 1ARKA 2DE0X 2ZPEB 3G6ET 1D0XA 3PVLA 4C92A 3R6NA 2K2MA 2DL5A 2EQIA 3PMIA 1K73R 2JS0A 1QP3A 4M7DA 1EX4A 4PJLA 2HL3A 1D1AA 1TH7A 2FG0A 5IXBA 1OEBA 2QXFA 4M7DB 4LDUA 5CAIA 4FYVB 3C4SA 1OULA 3META 1TOVA 4M7AG 2K2VA 4A4KA 2YUPA 1AVZC 2KRMA 4PJNA 5EC7A 4KT0E 1SSHA 2RH2A 1VQ7T 1RAHB 2GQIA 2RB6A 5KYNA 1QVGA 1JJ2S 4OB1B 2RQUA 4MZTA 3R6OA 3J7AF 1PSFA 1HK9A 2CS7A 1EIFA 1SRMA 2QYZA 1XTDA 2JMAA 4M77D 2A7YA 2LQWA 2D9TA 2DEQA 2XHCA 1YHQT 1WJSA 5GAN3 1KC8C 4Z88A 2M0YA 4ZNXA 4AFUC 1VQ9Q 4CC2A 2O4XA 4M75F 2RK2A 2LJ1A 2FZCB 4E7IA 3MKDA 5CO7A 4LE9A 5CKHA 2VASA 2ZPFB 4R56A 2DPPB 2O4XB 4KGZB 1VQPQ 3BDUA 4MZPA 1BIBA 4RG8A 1OOTA 4LNPA 2DVEA 3C0CA 3DKMA 2OX7A 2OTLA 3EHQA 2CP3A 1VQ8T 1Q82C 2E64A 3M53A 3I9QA 2E12A 1O9SA 3M0RA 1B3QA 4LDWA 1I4K1 3NHNA 3JB9J 3V7SA 1WXTA 4JRIA 4F16A 3QO3A 1G3YA 3EAEA 2MOXA 5D6XA 1LOJA 2EVRA 1WX6A 4BE2A 5GAOn 3OW2A 3CXCA 3WXMB 3RDVA 4QT7A 4C5GA 3PTAA 2CH4W 1IB8A 2RNAA 1E7OA 4JJCA 3OY9A 2FPEA 2BZYA 5FROA 3CCRQ 1VYUA 1VQMT 1I07A 4F17A 4EMHA 1FYNA 1D3BA 1U3OA 3A8LB 2QA4A 2LVMA 2X4WA 1Z9ZA 4X9CA 3CCVA 2RQWA 4BY6C 1D1CA 4OMMA 1K1ZA 3CCLA 2IPOB 2EYYA 2J7IA 1NYFA 1NZ9A 2LMJA 1YJ9T 4FM4B 2KQWA 5KYUB 4Z89A 3OYIA 1ZUUA 4OMFB 2DEUA 1QVFP 1FMWA 4C8QC 4C92E 1M2VA 3CPWA 3HFNA 2L5QA 2PVOB 1KK7A 3G4SQ 4M7DE 1ZQ1A 3JB9I 1Y71A 4CC7A 4DEXA 4AT1B 4DBHA 6AT1B 1D09B 3SD4A 1CKBA 4J9HA 2LCCA 2O01E 3SWNA 4C5EA 3CD6T 4Y28E 1IXDA 1VQ7Q 3OYGA 1VQLA 3SWNB 1JU5C 4RTTA 1ACMB 1TUDA 2RJEA 3M4YA 3NGPA 4BI3A 4J9FA 2VC8A 4KUDK 3VS5A 4J5YA 4A54A 2HL5C 2HD0A 2CT3A 1UHCA 3M5AA 1QVGS 4FYYB 2E6ZA 1VQKT 3EGDA 5GAN7 2PNIA 1T3LA 3I55A 4JLGA 3CMAQ 2BKDN 4Y91A 2DBMA 2EFIA 2XI9A 1YHQQ 1ABOA 2GGRA 2JN0A 5CCAA 4ZN1A 2QEXA 1RAIB 1KJWA 5FWCA 2AIRB 5GAN4 1G2BA 5GAOl 3CC7T 1MMNA 2LC4A 1LNXA 4J9IA 3VS4A 5L8RE 3HFOA 5GMKj 3L2VA 2X4YA 2ZPIB 1N8RU 3OBWA 2RQVA 3X28B 3QDFA 1N6AA 4C8QD 1ZSGA 3L1AA 2HCKA 2IIMA 1WHJA 4PJJA 5FU7B 4DOWA 5LJ5h 1VQ8Q 5DLOA 3HSBA 2DTOA 2CKKA 4NL3A 3OYDA 2QASA 2DJZA 2LRQA 2X4XA 4D6WA 1JJ2P 2ED1A 1IREB 1WA7A 2LCSA 4C92G 2GF7A 2E1HA 3G6EA 2Y4YA 2DMOA 1YP5A 3PNWC 5HKCA 2DF6A 2QG9B 4M7DG 3SEMA 4JJBA 1W1FA 2ECZA 1PRMC 2M16A 3M0QA 1AWWA 4DBQA 4PFPA 3CMEA 2F69A 2M02A 3OW2S 3CXCS 1ABQA 1W70A 2O31A 2GTJA 4RKUE 1VQ6A 4N4IA 4MDXA 4TVRA 1QCFA 4DQ2A 1NPRA 1C6VX 2LT4A 3A1PA 1Y96A 2SEMA 3E2UA 1YJNA 2DXCA 5GANf 3V8LA 2W10A 1H8KA 1HSQA 1NYGA 3NMZC 3G71T 4BUGA 1YJ9Q 1UGVA 4C0ZA 3EH2A 3E19A 5GAOp 1GRIA 2RQTA 2EJGA 2NYSA 3SHWA 3S3NA 4A4HA 1I0CA 4KH1B 4L59A 3QBYA 1FMVA 5LJ3f 1YJWT 1NJIC 1AD5A 3NPFA 1Z9QA 4J7IA 2F2VA 3CPWS 3E9FA 4C8QF 1N5ZA 2KEAA 1PD1A 1UHFA 4PJOA 3VRYA 3CD6Q 4BDZA 1K8AC 1AWJA 3LWIA 2DX1A 2QQBA 2IVWA 4PJOB 2K5LA 1R77A 1WJRA 1WLPB 1M1KC 1ZSZC 2DILA 4QQGA 3OYBA 1JBMA 1XJWB 3WVDB 1VQ8A 3HL8A 2P4RA 3I56T 1VQKQ 3ZBDA 2PUKB 3CC4A 4RCCA 2YUQA 5IXFA 2E70A 4O6JA 1YI2A 2DAQA 4F7UA 1VYVA 2WSEE 4BE1A 4HCKA 4C5HA 1JRIA 1Q7YR 3TSZA 1Q82R 2RK1A 4JRKA 1YCSB 5J3BA 4B9XA 3CC7Q 1VQOA 2AK5A 1UGRB 3QG1A 4XTUA 5A2QE 1X6GA 2V1QA 1VQMA 3CCSA 1UGQB 5IAYA 4LDVA 2COZA 3PE0A 2FHDA 5GJVB 7AT1B 4LXCA 2DRMA 1M5Q1 3OYKA 1BI0A 4JRQA 3S3MA 2BTTA 1MNDA 4J9BA 4IUUA 3JB9H 4CI0C 2L8DA 1KC8U 2D8JA 2DVJA 2EQJA 3MPUB 4M7AC 1G3TA 2ROLA 1GL5A 4X1VA 4XTYA 2ZPBB 3UA7A 5A0GA 8ATCB 2M0OA 3JCMc 2DXBA 1RABB 3L2ZA 1QVGP 3M9QA 3A5ZB 3JCMf 2RPNA 2LNVA 4BD3A 1I5LA 1BI3A 1IHVA 4HCBA 2OAWA 1RI9A 1M9SA 2FZKB 4BDYA 2QDLA 3VKIA 1OU8A 1VQNA 3UT1A 1M90C 1D1BA 1Q82U 4JS5A 3CD6A 1RLQC 2K5FA 2LQKA 1V29B 3L2WA 3BFMA 2FEIA 2EGCA 2WSFE 4PNOA 1QCNA 2PTKA 2MF2A 2HZYA 3G71Q 4JJNK 1X27A 3E9GA 1VQKA 3A8MB 2KMTA 1HYOA 3EH1A 3OS0A 5KYXB 2JUFA 2XMFA 2KROA 2CZ7B 3TEEA 1YJWQ 3HRSA 1UJYA 3QJYA 3HP9A 2ZPHB 2MK5A 3M55A 1JXMA 1VIFA 4IIOA 3V8JA 4GLKA 5J39A 2V26A 4M7AD 2KBTA 3EHRA 3RESA 1RADB 1RUWA 4M78A 3BE3A 3V8KA 2DLPA 5LJ5j 2DBKA 5KCHA 1WQWA 4QVCA 3CCMT 2PZ1A 1UFFA 4M78B 3VS3A 1TG0A 2R57A 2XG8D 3OA6A 4PJOE 3OW2P 3X25B 3CXCP 5CKBA 1W2BA 1M3CA 3CCUT 4OMLA 1RAGB 3MO8A 3CCJQ 1ZUKA 1WDXA 2RM4A 2YDLA 3I56Q 1SF9A 2K6DA 2GBQA 1OQKA 2FPDA 4OGEA 1WJQA 2O9VA 1I1JA 2D1XA 3G4ST 1TU0B 4C0DC 1WXBA 2CT4A 3A8OB 3O5ZA 2WSCE 2EYZA 2SRCA 1UG1A 2BIVA 2A08A 4DBFA 1MMAA 3C94A 3VUBA 2ESWA 1GFCA 4F7UE 2LJ0A 2DZCA 4YTLA 3S6WA 3VV0A 5GAMd 2IG0A 1QQJA 4N0AA 3CCEQ 5J26A 3OYJA 2LQ8A 2BE7D 4ZGEB 4A4EA 1IHWA 3HRUA 4A4FA 2LX9A 2G6FX 3CPWP 5AYFA 2KDSA 4JZ4A 1LCKA 4C8QB 2EQUA 2QAZA 5GMKe 2D0NA 3JCMP 2MIOA 3V7RA 1SEMA 2VXEA 1AZEA 1AZGB 3CMAT 2NUPA 1ZBJA 2XKOC 4JJDA 1JEGA 2NUPB 1S72T 3RMSA 4AFSC 4RTXA 1I8FA 1KD1C 3QKJA 2OJ2A 1YJWA 4KGXB 2PVGB 1OX8A 1D0YA 4C0FA 4M7AF 2CUDA 2KNBB 1Q86C 2JNGA 3LGFA 1U06A 2F2XA 2JS2A 4J6XA 4AMCA 4RUGA 5GANh 2R58A 4N4GA 2JZ2A 2RF0A 4PJOG 4DBRA 1MMGA 5I2SA 2FRYA 3TREA 3RUXA 2VKNA 5DLQE 3L2QA 2L0AA 1GBQA 2LP5A 2DNUA 1WNLA 4EMKA 1B34A 3H9NA 5LJ3h 5GMKm 2XK0A 1X01A 4HCZA 3QSUA 4XQ3A 3EG9B 4EMKB 4PFOA 1B34B 4OMNA 1T3SA 4Z8AA 1XOVA 1TUCA 2VVKA 4E2FB 1T0JA 1K8AR 3MP8A 2DZ9A 1H641 4F7UG 4J6YA 2EW3A 3M54A 2KSSA 2COWA 2KR3A 5GAMj 4OB0B 3V7CA 3H8ZA 2OI3A 4OMPA 1K76A 5ECAA 1KSWA 5HK3A 1SPKA 3ASKA 1KQ1A 3QDRB 3X20B 4ANJA 1PKTA 3MCAB 4C92C 5I2MA 3VJPA 3CCMQ 2HNIA 4M78E 3VS6A 2DYIA 2RO0A 1IZ6A 2A3LA 2DTIA 4M77F 5D6WA 1Y7XA 1G8XA 4PJMA 5KYUA 1V76A 3HTRA 1M8MA 3GIBA 3CCUQ 4M7DC 1LPLA 1TS9A 2KI7A 2NLUA 2C0TA 3PIPA 4XU2A 1Y57A 5GAMg 1NJIU 1Y07A 3DB3A 3EGXA 3FC3A 3CC2T 4OB3B 2JVVA 1FXXA 4F04B 1M1FA 4Z02A 2VGNA 2WACA 1Q7YC 1N8RR 3EGXB 3JCMX 4BACA 2C0OA 1X2KA 2AKKA 1VQ9A 1K9MC 1QMCA 1RLPC 1OZ3A 1OI1A 2NWMA 2YLBA 1YITT 3RR6A 4GLMA 1K8AU 3LH0A 2OTJQ 1JO8A 1OYXA 1VQPA 1OZ2A 3H6ZA 4E7JA 2P84A 3A8HB 2KXCA 1AEYA 4EIKA 2DXTA 2HKQB 2RI3A 2KK4A 4E47A 2P0QA 2L3QA 3OQ5A 1YIJT 1VQ5T 1X69A 1KHIA 4OF1A 1YWPA 5D7UA 4PL6A 1U8RA 1EFNA 2COYA 3JCMh 1X75C 4DEYA 3M0PA 2QTXA 4C92D 3JCMW 1F1BB 1PCXA 1M90R 2D8HA 1S72Q 4P5NA 3QWYA 2W0ZA 2R5MA 2X3WD 4M7DD 1NG2A 4FW1A 3FRNA 1FWZA 5GANd 3E1SA 2RHYA 1BCOA 4QVZA 3CCRA 1ZSZB 3OS1A 2X9HA 4M78G 3G1JA 5GAN8 3VUZA 2HDAA 1HJDA 2EBPA 1UECA 2DRKA 2DL4A 3FIFA 5LJ3d 1K73C 1IRXA 2RHXA 5IT9E 4OVAA 2KT1A 4J9DA 4VUBA 2RI2A 2FPFA 2L3PA 2X4JA 2FL7A 2VUBA 2KXDA 2D6FA 3QYGB 2JM8A 1SHGA 4PLLA 3GNGA 1UE9A 3INZA 3GBQA 3G4SA 1YFNA 4BI4A 2MWPA 4J9CA 3REAB 4WTOB 1NE8A 1C0MA 2QQ9A 2RJCA 1M90U 2F2WA 4M75A 4J83A 1QW1A 1QVPA 2JOYA 2ZCFB 3L2RA 5CQXA 1KIKA 3QXEB 5IH2A 4IUPA 1OV3A 4M75B 1VQ7A 2MPXC 1B7TA 4C0GA 1QWFA 1TWBA 2LJ3A 2FZGB 3VS2A 2KYBA 3EG2A 4M7AB 1TSFA 2GQVA 5IHNA 4J7FA 2A0FB 2HQXA 1QVFA 1D0ZA 2DD5A 4FYXB 2HBWA 3O8VA 2XDPA 1WI7A 1YCYA 4RMOA 4FL6A 2YUNA 4C92F 2A36A 4JZ3A 2YWWA 5HK0A 2CP5A 1Q81C 3NTHA 5IHKA 3CMAA 3CC2Q 5C0MA 4II1A 1YHQA 3HPWA 1OU9A 4C5IA 4XTZA 3CPFA 3SWNC 2JT4A 1K9AA 3MEAA 3H0IA 4DOVA 1X6BA 3CCQQ 5GANj 2XU8A 2P0KA 3VU3C 5GAN5 1YITQ 2J6OA 3DLLA 2YXYA 2CZ0B 1RAEB 3RKYA 1KC8R 3X24B 1A0NB 2ENMA 5LJ3j 3RERA 4IURA 2YSQA 3G7ZA 4R0KA 4PLIA 2MAMA 4OMQA 2X35A 3CCJT 2ABLA 1UJ0A 5GAOm 1YIJQ 1VQ5Q 1CKAA 5CQYA 4FT4A 2G3RA 2OTLT 4ATOA 4M77A 1VYTA 5GANg 1WFWA 1YNZA 1W6XA 5DM7R 2JTMA 2KRNA 4Q5WA 4M77B 2GFUA 2AHJB 2DL8A 2RQRA 2EQKA 3FB9A 4RTZA 2GTOA 3PIOA 5FU7C 3FLGA 5M9OA 1RI0A 4IUQA 1W2BP 2VGMA 2D0QB 2JXBA 5LJ3g 4LDYA 3CCET 3OBYA 2MYSA 2C06A 1FX7A 2EGEA 2HSEB 2PVDB 5LJ5d 2DTHA 1M3AA 3AHUA 3JSCA 2KAFA 2RD1A 3BY7A 2QA4T 4RTWA 2DM1A 3CCVT 5AT1B 1GFDA 2E5KA 4E7SA 1M1GA 2LCLA 3OYYA 1YJ9A 3CCLT 3I5RA 2K7AA 2B86A 2JW4A 3JCMV 3EGUA 1PNJA 2V8IA 1KD1U 3GOXA 1PD0A 2HSPA 3M56A 4E7ZA 3QWXX 3KFVA 1S1NA 4J8OA 1ZLMA 2YUOA 1ZHIA 1X43A 3J81E 3HRTA 1Q86U 2VXFA 1O75A 4HCCA 3JB9G 4RTYA 2E3HA 5KE2A 1HD3A 3IQLA 1KQSA 1GXIE 1BB9A 2NUTB 2H3EB 1IO6A 4HT9A 2A37A 2YT6A 1RAAB 2O88A 2J05A 4M75E 3GNFB 1VIEA 2F1LA
chains in the Genus database with same CATH topology
4Y28E 3M59A 3OYGA 1S72T 3M4GA 1UEBA 3RMSA 3SWNB 5GAMe 3OYNA 1VQLA 3UDCA 1I8FA 3OYMA 4KULA 1KD1C 2RJEA 3M4YA 3QKJA 4XTVA 1YJWA 4BI3A 4NL2A 2VC8A 4KUDK 2PVGB 4J5YA 4A54A 4M7AF 4C0FA 2Y4XA 2HD0A 2DIGA 5HY6A 2PU9B 3M5AA 1MHNA 1QVGS 1Q86C 2E6ZA 2JNGA 3LGFA 1UGPB 2Y90A 5GAOq 1VQKT 4QW2A 1W4SA 3KXTA 4J6XA 5GAN7 5GANh 4JRPA 2R58A 2RJFA 4N4GA 2F5KA 5I21A 2JZ2A 4PJOG 4KBMB 2EYQA 3LLRA 4JLGA 3I55A 2BKDN 2RI5A 4Y91A 2EFIA 5I2SA 2XI9A 5D6YA 4OP0A 4XU1A 4X9DA 3TREA 3I55T 4KUIA 2JN0A 5CCAA 4PJOC 3CBOA 3RUXA 3JCMd 3PFSA 1R8OB 5DLQE 4ZN1A 2QEXA 3L2QA 5DY9A 2L89A 2QEXT 1G3SA 1WNLA 4EMKA 4ZTJA 1B34A 2I2LA 3CC7A 5GAN4 5LJ3h 1H3ZA 5GMKm 5GAOl 2XK0A 1X01A 3P8DA 4L5GA 3CC7T 2YHTA 4HCZA 2LC4A 3QSUA 1LNXA 3OS5A 4XQ3A 4EMKB 5L8RE 1B34B 3HFOA 2P4TA 3N5BB 2X4YA 5GMKj 3L2VA 3GPLA 4E7HA 1KHCA 1XOVA 2ZPIB 1N8RU 3QUIA 3OBWA 3X28B 2ZZDA 3CCQT 1N6AA 2GFAA 4C8QD 5C6SA 3L1AA 1PSEA 3MEVA 2FYKA 2BUDA 3MP8A 2DZ9A 1H641 4V2SA 4F7UG 3LYIA 3TU4K 3EFSA 2XD0A 4J6YA 3OB9A 5FU7B 3M54A 2KSSA 3ZEHA 4ELYC 3NFCA 1ZBXA 4FT2A 2DO3A 2QDYB 4DOWA 5GAMj 1I81A 4OB0B 3JB9D 5LJ5h 3V7CA 5CKEA 3H8ZA 3LX7A 5DLOA 3HSBA 2DTOA 1Q7YU 3F70A 2CKKA 5GAN6 5HK3A 4NL3A 3OYDA 2DJZA 1G3WA 2LDMA 2LRQA 2X4XA 4D6WA 4F7UB 5CK9A 3ASKA 2KY9A 3FJPA 1IREB 1JJ2A 2JTFA 3OS2A 4C92G 1KQ1A 4M77E 5FLXE 2GF7A 2E1HA 1K9MU 3G6EA 1N9SA 2Y4YA 3QDRB 3PT9A 3X20B 3X26B 4ZTFA 2KVQG 3MCAB 4C92C 2L3RA 5I2MA 5LJ5g 3PNWC 4HKEA 3VJPA 5HKCA 2HNIA 4M78E 4C0DB 2EQMA 2RO0A 2EIFA 1IZ6A 2A3LA 1U1SA 2DTIA 4M77F 1Y7XA 2R5AA 5D6WA 5GAMh 1XQHA 4ME7A 1X6OA 1N8RC 2QQAA 3GIBA 4BY6B 4C92B 2OTJT 4FSXA 4M7DC 2M16A 3CMEA 2F69A 3J80E 2VV5A 1M8VA 3VYGA 3OYHA 3CMET 4M75G 1YBYA 1RL2A 3OW2S 2NLUA 3CXCS 3PIPA 4XU2A 5FU6C 3CC2A 5GAMg 4MMLA 1NJIU 1Y07A 3DB3A 4ELZC 4C8QA 2DXUA 2XDDA 4M75C 1BIAA 4N4HA 3FC3A 3CC2T 3UWNA 4OB3B 2JVVA 4RKUE 1FXXA 3QJ6A 4IUVA 1VQ6A 4N4IA 1M1FA 4Z02A 4MDXA 2VGNA 2WACA 1Q7YC 4XK8E 2HBPA 4TVRA 5FU6B 4A4GA 4IUTA 5A0LA 1VQ6T 4PJOD 3JCMX 3CCQA 4DQ2A 4BACA 1NPRA 1VQ9A 2LT4A 2M9UA 3PGGA 4CRIA 3QZ5B 3OYAA 1K9MC 1Y96A 2XDBA 1WGSA 1VQ9T 1OZ3A 1OI1A 2CGHA 1YITA 3OYFA 3BDLA 1YJNA 2DXCA 2YLBA 3CEYA 1YITT 5GANf 1WQ7A 2E41A 2RHZA 3V8LA 1YJNT 3G71A 1N27A 1U1TA 4XU3A 1K8AU 3LH0A 3G71T 5LL6S 3VYHB 1OYXA 3C95A 4BUGA 3OYLA 1AHJB 5CR2A 4R55A 1VQPA 2DIQA 4C0ZA 2EJ9A 3QYHB 3A8GB 1OZ2A 2RJDA 3E19A 3H6ZA 3LGLA 5GAOp 4E7JA 1VQ4T 1VQPT 4M7AE 3A8HB 3QIIA 2EJGA 3ME9A 1VQLT 3S3NA 5FRMA 2VYTA 4E7LA 4A4HA 4L59A 3QBYA 2DXTA 2RI3A 3MEUA 4OB2B 5LJ3f 1YIJA 3WVEB 1YJWT 1NJIC 1VQ5A 2KK4A 2H3JA 2P0QA 4E47A 2F5TX 3OQ5A 1YIJT 2DK3A 2ZPGB 1VQ5T 2RA2A 3EFRA 4EPCA 1QVFS 4MMKA 3MHXA 1KHIA 4E7KA 4J7IA 4OF1A 4WF2A 4BI8B 3CPWS 4PL6A 3E9FA 1U8RA 2CYZB 3JCMb 4C8QF 3JCMh 1BYMA 1LJOA 1SSFA 1X75C 3ER0A 4LDXA 4ZN3A 3JCMQ 3CBPA 4NOYA 1NPPA 1KQSS 3KBGA 1K73U 2GCXA 3DB4A 2QTXA 4XAXB 4PJOA 4C92D 4QQ6A 3JCMW 4BDZA 2E65A 1K8AC 2E10A 3L2UA 5LJ5f 3JB9F 4P5NA 3LWIA 4QVDA 3MEWA 2QQBA 4XTXA 2IVWA 4PJOB 2M1HA 2R5MA 5EG2A 2K5LA 4RCBA 2DKGA 3JCMg 4M7DD 2QQRA 2K4YA 2ZGWA 1WJRA 3LW5E 3CCJA 1M1KC 4QQGA 3FRNA 1FWZA 3M58A 3OYBA 5GANd 1JBMA 3E1SA 3OSSC 4M77G 2RHYA 4O5VA 3WVDB 3I56A 1VQ8A 3SFMA 3HL8A 4QVZA 5CVIA 3I56T 3CCRA 3T9NA 4M75D 2HQEA 4M77C 3ZBDA 5GMKl 2PUKB 3OS1A 4DA4A 5GAMf 3CCRT 3CC4A 4M78G 4RCCA 4RG2A 5GAN8 2PQWA 3GF5A 4MDWA 5CKFA 3TCJA 3VUZA 3CC4T 2E70A 2V8KA 5IN1A 4M78C 4O6JA 1YI2A 4BB7A 2DAQA 3JCMJ 2E6NA 4F7UA 2CZ1B 2OAUA 2WSEE 1YI2T 4BE1A 3FIFA 5LJ3d 3QZ9B 5GMKh 5FRNA 4C5HA 1K73C 2RHXA 5CKDA 1JRIA 2RHUA 3C12A 2RHIA 2RK1A 5IT9E 2HAXA 4OVAA 1JB0E 4JRKA 1BKBA 3CCEA 5J3BA 4JDSA 4UC4A 1HXDA 4B9XA 1VQOA 4VUBA 3P8BB 2RI2A 2ZPEB 3HHTB 3G6ET 1UGRB 2X4JA 4LD9K 4C92A 1VQOT 2FL7A 4PJOF 2EJFA 2VUBA 3QG1A 3UPUA 2YLCA 4XTUA 5A2QE 2D6FA 4FU6A 3SB2A 4X34A 1BI2A 3QPHA 3QYGB 5KCOA 3JAME 5GANe 3PMIA 3KUFA 4PLLA 3GNGA 1KQ2A 1VQMA 3CCSA 2V8JA 1QP3A 4M7DA 3INZA 3G4SA 1UGQB 5IAYA 2FVUA 4LDVA 3CCST 4BI4A 4A53A 2FHDA 2PUOB 1TH7A 2MWPA 1Q81U 1M5Q1 3OYKA 1BI0A 2QXFA 4M7DB 4JRQA 4LDUA 5CAIA 3S3MA 1W2BS 1NE8A 3C4SA 2QQ9A 2RJCA 3META 4GY5A 1M90U 1D3BB 2QQSA 4IUUA 3JB9H 4M75A 4M7AG 2K2VA 4J83A 1P92A 4A4KA 4CI0C 2L8DA 1QW1A 1QVPA 2JOYA 2ZCFB 3L2RA 1KC8U 2EQJA 5LJ3e 4JLIA 5CQXA 4M7AC 3QXEB 1DJ7B 1G3TA 4IUPA 3DLMA 4M75B 4XTYA 3SDZA 4KT0E 1VQ7A 2ZPBB 5CIUA 4C0GA 3MP1A 4N0AC 5A0GA 2M0OA 1BI1A 3JCMc 1N9RA 2RH2A 4F7UF 1VQ7T 2DXBA 2RB6A 2DD4A 3L2ZA 4M7AB 2GQVA 4MZMA 1QVGA 3Q1JA 1JJ2S 4J7FA 2HQXA 2MMPA 3NTKA 4OB1B 1QVFA 1VUBA 2DD5A 3M9QA 2FB7A 4MZTA 3A5ZB 3R6OA 3JCMf 1G5VA 3J7AF 1PSFA 2LNVA 3O8VA 1UB4A 4BD3A 1I5LA 1BI3A 4HCBA 2XDPA 3NTIA 1HK9A 2CS7A 1EIFA 1YCYA 1UGSB 4RMOA 1M9SA 1XTDA 4FL6A 4JS4A 4BDYA 4C92F 4M77D 2K57A 1M1KU 2A7YA 3VKIA 5HK0A 1Q81C 1VQNA 3NTHA 3CMAA 2D9TA 2DEQA 4B9WA 5C0MA 4II1A 1YHQA 1VQNT 3UT1A 3HPWA 4M78D 4HA8A 2XHCA 4NS5A 4C5IA 1Q82U 1M90C 4JS5A 4XTZA 3CPFA 3CBMA 3SWNC 1YHQT 4C8QE 3CD6A 1WJSA 2K5FA 2LQKA 5GAN3 1KC8C 1V29B 2MI6A 3L2WA 3MEAA 5GAOr 4DOVA 5GANj 2XU8A 3BFMA 3S3OA 4J6WA 4BE0A 2WSFE 4PNOA 2O4XA 2P0KA 3VU3C 5GAN5 4M75F 4HT8A 2RK2A 3GLXA 1XNIA 3M57A 4EMGA 3DLLA 2B8AA 2MF2A 3RKWA 4E7IA 5CO7A 4ZGDB 3LWHA 5CKHA 3GP8A 2ZPFB 4R56A 4JJNK 2DPPB 2O4XB 3E9GA 5GAN2 2CZ0B 2P0PA 5GMKi 3RKYA 1VQKA 3A8MB 3X24B 2KMTA 2K5IA 3BDUA 3OS0A 4MZPA 5LJ3j 1BIBA 3RERA 4IURA 4RG8A 2LTOA 2JUFA 3G7ZA 1KG1A 4PLIA 2CZ7B 2DVEA 2MAMA 2X35A 3DKMA 3TEEA 1WPYA 3HRSA 3MP6A 3CCJT 1QP2A 3OMGA 3HP9A 3QJYA 2ZPHB 5GAOm 2OTLA 3M55A 5CQYA 3OW2A 3OMCA 4FT4A 4OGCA 4EDUA 2G3RA 1Q82C 1VQ8T 2OTLT 4ATOA 1VIFA 2E64A 3M53A 4M77A 3V8JA 2QI2A 2E12A 4GLKA 5J39A 1O9SA 4EMKC 4LDWA 1I4K1 5GANg 2XIDA 3JB9J 3V7SA 4M7AD 2CZ6B 5DM7R 2JTMA 4ZGJB 4Q5WA 4JRIA 3ZFJA 5KH6A 4M77B 2GFUA 4M78A 2AHJB 3RESA 3V8KA 2EQKA 3FB9A 5LJ5j 2MWOA 3CCMA 3QO3A 5KCHA 1G3YA 1WQWA 4QVCA 3EAEA 5D6XA 3CCMT 3PIOA 4M78B 1LOJA 2R57A 3OYEA 2XG8D 3HKSA 5FU7C 3FLGA 5M9OA 3OA6A 3CCUA 4BE2A 3OSVA 1RI0A 1M4ZA 4IUQA 3X25B 2LT1A 5CKBA 3WXMB 5GAOn 2VGMA 4PKCC 3CXCA 1W2BA 3CCUT 2D0QB 5LJ3g 4C5GA 3BW1A 2K3YA 1MGQA 4LDYA 3CCET 3RKXA 3MO8A 3URGA 3PTAA 3OBYA 2RM4A 3OY9A 2C06A 2XICA 1FX7A 5FROA 3PMTA 4OGEA 2PVDB 1WJQA 5LJ5d 3JCMe 2DTHA 1VQMT 4M7DG 3AHUA 3JSCA 3RMQA 2KAFA 4EMHA 1D3BA 2RD1A 3G4ST 3A8LB 4C0DC 3A8OB 2QA4A 2LVMA 3BY7A 2WSCE 2X4WA 4LD6A 4X9CA 4XTWA 3CCVA 2QA4T 4XU0A 2BIVA 4BY6C 3CCVT 3JRZA 3C94A 3VUBA 2E5QA 4F7UE 3CCLA 1M1GA 2LCLA 3QHSA 2OTJA 2DZCA 3OYYA 1YJ9A 3L42A 4PJOE 5A0DA 3CCLT 4M7AA 4YTLA 1NZ9A 3S6WA 3VV0A 5GAMd 1YJ9T 4FM4B 2IG0A 4M78F 3JCMV 2KQWA 4N0AA 5J26A 3OYJA 2V8IA 4C8QG 3OYIA 1KD1U 2LQ8A 3GOXA 4OMFB 3M56A 4FIBA 4ZGEB 4A4EA 4QQDA 3HRUA 4A4FA 4C8QC 2LX9A 4C92E 4IKFA 4J8OA 1ZHIA 3P8HA 3J81E 3CPWA 3HRTA 2EAYA 1Q86U 2VXFA 3HFNA 1O75A 2L5QA 2PVOB 3JB9G 5AYFA 2KDSA 4HCCA 2EWNA 4C8QB 4JUVA 5KE2A 5LJ5e 4M7DE 2EQUA 1ZQ1A 1KQSA 3JB9I 3FDRA 5GMKe 1GXIE 1Y71A 3JCMP 3V7RA 2VXEA 3RIRA 3CMAT 3SD4A 4HT9A 4M7DF 1Y96B 2LCCA 3OYCA 2O01E 3SWNA 2EKOA 4C5EA 5KE3A 3FEOA 2XKOC 4M75E 2K3XA 4L6V5 2YRVA 3GNFB 1S72A 1VIEA 1VQ4A 3CD6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM g;  4MML A;  4JRK A;  4C8Q A;  2DXU A;  5GAO m;  4M75 C;  1BIA A;  3M4G A;  3SWN B;  5GAM e;  1HXD A;  5GAN 8;  1I8F A;  2E64 A;  4M77 A;  4C92 A;  1M8V A;  4XTV A;  4PJO F;  2EJF A;  3V8J A;  4NL2 A;  3JCM X;  2VC8 A;  2YLC A;  4XTU A;  4DQ2 A;  4EMK C;  4PJO D;  1I4K 1;  5GAN g;  4J5Y A;  3SB2 A;  4A54 A;  4M7A F;  3JB9 J;  3PGG A;  3V7S A;  4M7A D;  1Y96 A;  5GAN e;  4JRI A;  2CGH A;  4M77 B;  1KQ2 A;  3RES A;  4M78 A;  3V8K A;  4M7D A;  3INZ A;  2Y90 A;  2YLB A;  3FB9 A;  5LJ5 j;  3QO3 A;  5GAN f;  1WQ7 A;  2E41 A;  1WQW A;  3V8L A;  4QVC A;  5GAO q;  4PJO A;  4J6X A;  1U1T A;  4A53 A;  5GAN 7;  5GAN h;  1TH7 A;  4XU3 A;  4M78 B;  1LOJ A;  1M5Q 1;  5I21 A;  4M7D B;  4PJO G;  4PJO E;  5CAI A;  5GAO n;  2EJ9 A;  4Y91 A;  5GAO p;  4M7A G;  4OP0 A;  1D3B B;  4X9D A;  4XU1 A;  3JB9 H;  4M75 A;  4M7A E;  5LJ3 g;  2JN0 A;  4PJO C;  3RUX A;  4M7D D;  3BW1 A;  3JCM d;  1MGQ A;  2EJG A;  5LJ3 e;  4JLI A;  5DY9 A;  4M7A C;  3RKX A;  4XU2 A;  2DXT A;  4M75 B;  2RM4 A;  1WNL A;  4XTY A;  5LJ3 f;  4EMK A;  1B34 A;  2I2L A;  4N0A C;  5GAN 4;  3JCM c;  1N9R A;  5LJ3 h;  4F7U F;  5GMK m;  2RB6 A;  5GAO l;  3L2Z A;  1X01 A;  2RA2 A;  3EFR A;  4M7A B;  2YHT A;  5LJ5 d;  3QSU A;  1LNX A;  4MMK A;  4XQ3 A;  4EMK B;  3JCM e;  2DTH A;  1B34 B;  3AHU A;  3HFO A;  5GMK j;  4EMH A;  1D3B A;  2RD1 A;  4WF2 A;  2FB7 A;  3BY7 A;  3JCM f;  3QUI A;  4X9C A;  4XTW A;  3JCM b;  4C8Q F;  4XU0 A;  3JCM h;  4C8Q D;  1I5L A;  3L1A A;  1LJO A;  2FYK A;  3JCM Q;  4NOY A;  1HK9 A;  1YCY A;  2DZ9 A;  1H64 1;  4V2S A;  4F7U G;  4F7U E;  2QTX A;  3EFS A;  3QHS A;  4J6Y A;  4M77 D;  2K57 A;  4C92 F;  4C92 D;  2DZC A;  3JCM W;  2E65 A;  2E10 A;  4M7A A;  5LJ5 f;  3JB9 F;  2DEQ A;  5GAM d;  3JB9 D;  4QVD A;  5GAM j;  1I81 A;  5LJ5 h;  4XTX A;  3V7C A;  4PJO B;  4M78 F;  3JCM V;  4M78 D;  4HA8 A;  4N0A A;  3HSB A;  4RCB A;  2DKG A;  2DTO A;  4XTZ A;  3SWN C;  3JCM g;  4C8Q E;  4C8Q G;  5GAN 6;  4NL3 A;  5GAN 3;  2DJZ A;  2ZGW A;  4F7U B;  5GAO r;  3FJP A;  5GAN d;  1JBM A;  5GAN j;  4C8Q C;  4M77 G;  4C92 G;  1KQ1 A;  4M77 E;  3BFM A;  4C92 E;  2E1H A;  4J6W A;  1N9S A;  4PNO A;  2EAY A;  2VXF A;  3HFN A;  3VU3 C;  5GAN 5;  3JB9 G;  4M75 F;  4HT8 A;  4M75 D;  4M77 C;  4C92 C;  5GMK l;  5LJ5 g;  5GAM f;  2EWN A;  4M78 G;  4RCC A;  4C8Q B;  2HNI A;  4M78 E;  4JUV A;  3RKW A;  4EMG A;  5LJ5 e;  4M77 F;  2DTI A;  1U1S A;  5GAM h;  4M7D G;  4M7D E;  3JB9 I;  5GMK e;  5GAN 2;  4M78 C;  3RKY A;  5GMK i;  4C92 B;  3GIB A;  3JCM J;  3JCM P;  4M7D C;  3V7R A;  2VXE A;  4F7U A;  3RIR A;  3BDU A;  3FIF A;  5LJ3 d;  5LJ3 j;  4HT9 A;  1BIB A;  3RER A;  5GMK h;  1Y96 B;  4M7D F;  3SWN A;  4M75 G;  1JRI A;  4M75 E;  2DVE A;  1WPY A; 
#chains in the Genus database with same CATH topology
 1PRL C;  4FW2 A;  2J06 A;  3M59 A;  3M4G A;  1UEB A;  5GAM e;  3OYN A;  1UTI A;  2DET A;  1K9M R;  4KUL A;  1NEB A;  2L3S A;  1WXU A;  2Y4X A;  5KYX A;  4HXJ A;  5HY6 A;  1MHN A;  1WHG A;  4QW2 A;  3M0S A;  4JRP A;  1H3H A;  3VRZ A;  1PM3 A;  2RJF A;  5I21 A;  4Y92 A;  2RI5 A;  5D6Y A;  4OP0 A;  4XU1 A;  3I55 T;  2V1R A;  4KUI A;  4PJO C;  3PFS A;  3VS7 A;  5DY9 A;  2QEX T;  1G3S A;  2I2L A;  3CC7 A;  2O2O A;  3M0U A;  2EKH A;  3N5B B;  4E7H A;  3GPL A;  2KYM A;  1TXQ A;  1KHC A;  2LQN A;  3QUI A;  2ZZD A;  5C6S A;  1YN8 A;  2FYK A;  3M0T A;  9ATC B;  4V2S A;  3TU4 K;  3EFS A;  2XD0 A;  3OB9 A;  3ZEH A;  4ELY C;  3NFC A;  1ZBX A;  3RBB B;  4AFQ C;  4FT2 A;  2QDY B;  1I81 A;  5CKE A;  2OTL Q;  2J6F A;  1GCQ A;  1Q7Y U;  5GAN 6;  1NM7 A;  5CK9 A;  2KY9 A;  3FJP A;  1SKU B;  1K9M U;  2DFU A;  4M77 E;  3EFO B;  4PK4 A;  1OPL A;  3PT9 A;  4ZTF A;  2KVQ G;  5LJ5 g;  2EIF A;  2EGA A;  2NUZ A;  4ME7 A;  1X6O A;  4BY6 B;  4C92 B;  2OTJ T;  1FMK A;  3J80 E;  2VV5 A;  3VYG A;  3CME T;  4M75 G;  3LH5 A;  1RL2 A;  1C1A A;  1M3B A;  1QKX A;  5FU6 C;  5KYW A;  4CC3 A;  4C8Q A;  2DXU A;  2XDD A;  1QKW A;  1BIA A;  4N4H A;  2DA9 A;  1CSK A;  4IUV A;  4XK8 E;  2HBP A;  4HVW A;  1TUG B;  1ZA1 B;  4IUT A;  4A4G A;  5A0L A;  5KYW B;  1VQ6 T;  1T0H A;  4PJO D;  4FYW B;  2M9U A;  3PGG A;  3QZ5 B;  3OYA A;  1JXO A;  2QA4 Q;  4WCI A;  3OYF A;  3CCV Q;  2YRC A;  1YJN T;  3G71 A;  1U1T A;  2CSI A;  2EYX A;  1MNE A;  3CCL Q;  3OYL A;  3C95 A;  1RAC B;  4R55 A;  2DIQ A;  2EJ9 A;  3QYH B;  3A8G B;  3LGL A;  3UA6 A;  1VQ4 T;  1UUE A;  1AOJ A;  2VYT A;  3WVE B;  2CP7 A;  1LVK A;  2AKL A;  2F5T X;  4EPC A;  3MHX A;  4E6R A;  4WF2 A;  4BI8 B;  2CYZ B;  2LNH B;  3JCM b;  1EZZ B;  3AT1 B;  1Q81 R;  3JCM Q;  3H0F A;  3CBP A;  4NOY A;  1NPP A;  1KQS S;  1X2Q A;  3KBG A;  2GCX A;  1K73 U;  1NJI R;  3I35 A;  4QQ6 A;  3ZL7 C;  2DJQ A;  2E65 A;  2E10 A;  2QGG A;  2EPD A;  3EG9 A;  4QVD A;  1MV3 A;  1WHM A;  1VQL Q;  2CP0 A;  2CH4 A;  2QQR A;  1R0B G;  2K79 A;  3CCJ A;  3LW5 E;  3M58 A;  1MV0 B;  3OSS C;  4M77 G;  4O5V A;  3I56 A;  2HKN A;  1QLY A;  3ULR B;  3EG0 A;  5CVI A;  4DA4 A;  5GAM f;  4RG2 A;  4FSS A;  3TCJ A;  2KGT A;  3CC4 T;  2V8K A;  1E6G A;  5IN1 A;  4M78 C;  1MMD A;  4BB7 A;  3I55 Q;  3JCM J;  2E6N A;  1M1K R;  2CZ1 B;  2OAU A;  1YI2 T;  5FRN A;  2CP2 A;  5CKD A;  2QEX Q;  2RHU A;  2RHI A;  2EYW A;  2HAX A;  1JB0 E;  4IIM A;  3CCE A;  4JDS A;  4UC4 A;  1HXD A;  1GBR A;  3P8B B;  4F14 A;  3HHT B;  4LD9 K;  1M8V A;  1VQO T;  4PJO F;  2EJF A;  3UPU A;  2YLC A;  4FU6 A;  3SB2 A;  4X34 A;  1BI2 A;  2QK0 A;  3QPH A;  5L23 A;  2YRD A;  5KCO A;  3JAM E;  5GAN e;  5IHI A;  4J9G A;  1GCQ C;  4D8D A;  3KUF A;  1KQ2 A;  2V8J A;  3H41 A;  2FVU A;  4AFZ C;  3CCS T;  1Q95 G;  4A53 A;  2A28 A;  2PUO B;  1Q81 U;  1W2B S;  2E3I A;  4GY5 A;  4B6M A;  1AWX A;  1D3B B;  2QQS A;  3TQ7 P;  1P92 A;  1NLP C;  2RMO A;  5LJ3 e;  4JLI A;  3THK A;  1DJ7 B;  3DLM A;  3SDZ A;  1VOM A;  5CIU A;  3CCQ T;  3MP1 A;  4N0A C;  3MJX A;  1BI1 A;  1N9R A;  4F7U F;  3G6E Q;  1YWO A;  2DD4 A;  1TTH B;  4MZM A;  3Q1J A;  1QWE A;  2HEQ A;  2MMP A;  3NTK A;  1PKS A;  1VUB A;  1K0S A;  1B07 A;  2FB7 A;  1G5V A;  1UB4 A;  2ROT A;  1RAF B;  3NTI A;  1UGS B;  3CME Q;  4JS4 A;  1G83 A;  1M2V B;  3FJ5 A;  1PHT A;  2K57 A;  1M1K U;  4RTV A;  2BE9 B;  4B9W A;  1VQN T;  2M51 A;  2I0N A;  4QKU A;  4M78 D;  1MUZ A;  4HA8 A;  4NS5 A;  3CBM A;  4C8Q E;  1VQ6 Q;  4HVV A;  2LX7 A;  2MI6 A;  1BK2 A;  5GAO r;  2L2P A;  3VS0 A;  3S3O A;  4J6W A;  1WHK A;  4BE0 A;  4HT8 A;  1YJN Q;  1PWT A;  3GLX A;  1XNI A;  3M57 A;  4EMG A;  2B8A A;  3RKW A;  1SRL A;  4ZGD B;  3LWH A;  3GP8 A;  5GAN 2;  2P0P A;  2X3X D;  5GMK i;  1VQ4 Q;  2K5I A;  1UDL A;  2LTO A;  1KG1 A;  2AZV A;  1V1C A;  1ZSZ A;  1WPY A;  3EGD B;  3MP6 A;  1QP2 A;  3OMG A;  3OMC A;  4OGC A;  4EDU A;  2JJ9 A;  2QI2 A;  4EMK C;  2XID A;  2CZ6 B;  4ZGJ B;  3ZFJ A;  5KH6 A;  3CCM A;  2MWO A;  1SHF A;  5KYY A;  2BZX A;  1GCP A;  1WZO A;  3OYE A;  3HKS A;  3CCU A;  2GNC A;  3OSV A;  1M4Z A;  1PC0 A;  2LT1 A;  8AT1 B;  5KYY B;  4PKC C;  2X51 A;  3BW1 A;  2K3Y A;  5I11 A;  1MGQ A;  3RKX A;  3URG A;  1WHH A;  1WYX A;  1AWO A;  2XIC A;  2O9S A;  3PMT A;  1SG5 A;  3U23 A;  3JCM e;  3CC4 Q;  3RMQ A;  3REB B;  4LD6 A;  3TVT A;  4XTW A;  4XU0 A;  1YI2 Q;  2C0I A;  3RNJ A;  3JRZ A;  2E5Q A;  2FRW A;  3QHS A;  2OTJ A;  2K9G A;  4A63 B;  3L42 A;  5A0D A;  4M7A A;  2CUB A;  2FO0 A;  2JM9 A;  4M78 F;  2K3B A;  4PFZ A;  5FWB A;  4AG1 C;  4C8Q G;  1VQO Q;  2DL3 A;  4FIB A;  2CRE A;  1E6H A;  1BBZ A;  4QQD A;  1J3T A;  4IKF A;  1M2O A;  3P8H A;  2EAY A;  1VQM Q;  3CCS Q;  5HCK A;  1VA7 A;  2EWN A;  1NLO C;  4JUV A;  5LJ5 e;  1KQS P;  2LZ6 B;  3FDR A;  4ORZ A;  1WIE A;  1M27 C;  3RIR A;  2DYB A;  4M7D F;  1Y96 B;  4M4Z A;  1JQQ A;  3TSW A;  3OYC A;  2EKO A;  5KE3 A;  3FEO A;  2K3X A;  4L6V 5;  2YRV A;  1S72 A;  1VQ4 A;  4RTU A;  3UDC A;  4KH0 B;  3OYM A;  4XTV A;  4AG2 C;  4NL2 A;  1ZUY A;  2DIG A;  2ED0 A;  2PU9 B;  1UGP B;  2Y90 A;  5GAO q;  1W4S A;  3KXT A;  1M30 A;  3D7S B;  2HQH A;  1BCM A;  2F5K A;  3EG3 A;  4KBM B;  2EYQ A;  3LLR A;  1VQN Q;  1KD1 R;  1NEG A;  4X9D A;  3CBO A;  3JCM d;  1R8O B;  2L89 A;  1Q86 R;  4J9E A;  4ZTJ A;  1H3Z A;  3P8D A;  4L5G A;  2MCN A;  2YHT A;  3UAT A;  3OS5 A;  3CQT A;  2P4T A;  3VS1 A;  5FW9 A;  1IGU A;  2GFA A;  1PSE A;  4JPB W;  3MEV A;  2BUD A;  4CC4 B;  3LYI A;  2DO3 A;  3JB9 D;  3LX7 A;  4LUD A;  3F70 A;  2VB6 A;  1U5S A;  2LDM A;  1G3W A;  2DL7 A;  4F7U B;  1WHL A;  1JJ2 A;  2JTF A;  2VWF A;  3OS2 A;  5FLX E;  1Y0M A;  1N9S A;  3X26 B;  2CSQ A;  2CP6 A;  2L3R A;  2JTE A;  4HKE A;  4C0D B;  2EQM A;  5GAM h;  1U1S A;  2R5A A;  1XQH A;  1N8R C;  2QQA A;  4FSX A;  2DER A;  5I22 A;  2E4H A;  2Z0W A;  3H0H A;  3OYH A;  1OPK A;  1YBY A;  1PG5 B;  4ESR A;  3CC2 A;  4MML A;  4ELZ C;  4M75 C;  3UWN A;  3QJ6 A;  5FU6 B;  2NUT A;  2ZAE A;  2H8H A;  3CCQ A;  1ZX6 A;  4KRT A;  4CRI A;  2XDB A;  1WGS A;  1VQ9 T;  1YIT A;  2CGH A;  1QCO A;  3BDL A;  2ATC B;  1K4U S;  3CEY A;  1WQ7 A;  2E41 A;  2RHZ A;  2KE9 A;  1N27 A;  1ZA2 B;  4XU3 A;  5LL6 S;  2KT8 A;  3VYH B;  4FCY A;  1AHJ B;  5CR2 A;  2RJD A;  2AT1 B;  1K0X A;  1VQP T;  4M7A E;  1AT1 B;  3QII A;  3ME9 A;  1VQL T;  5FRM A;  4E7L A;  4OMO A;  4OB2 B;  3MEU A;  1YIJ A;  1VQ5 A;  2H3J A;  1KFZ A;  2DK3 A;  2ZPG B;  2RA2 A;  3EFR A;  4HVU A;  1QVF S;  4MMK A;  4E7K A;  4LN2 A;  1IGQ A;  1NBE B;  2JMC A;  2BZ8 A;  1R0C B;  1BYM A;  1LJO A;  1SSF A;  3ER0 A;  3A98 A;  4LDX A;  4ZN3 A;  1H92 A;  3DB4 A;  4XAX B;  3PVQ A;  3UF4 A;  3L2U A;  2CDT A;  5LJ5 f;  3JB9 F;  3MEW A;  4XTX A;  4D8K A;  2M1H A;  5EG2 A;  4LUE A;  4GBQ A;  4KGV B;  2DKG A;  4RCB A;  3JCM g;  3JV3 A;  2K4Y A;  2ZGW A;  2RN8 A;  2AZS A;  2KRS A;  1I5O B;  3SFM A;  3I5S A;  3T9N A;  1OX9 A;  2QTV A;  4M75 D;  2HQE A;  2J6K A;  4M77 C;  5GMK l;  3CCR T;  2PQW A;  3GF5 A;  4MDW A;  5CKF A;  2HMA A;  3QZ9 B;  5GMK h;  3EFO A;  1BU1 A;  2QGF B;  3C12 A;  4K11 A;  1BKB A;  5GJW B;  3EG1 A;  1ARK A;  2DE0 X;  2ZPE B;  3G6E T;  1D0X A;  3PVL A;  4C92 A;  3R6N A;  2K2M A;  2DL5 A;  2EQI A;  3PMI A;  1K73 R;  2JS0 A;  1QP3 A;  4M7D A;  1EX4 A;  4PJL A;  2HL3 A;  1D1A A;  1TH7 A;  2FG0 A;  5IXB A;  1OEB A;  2QXF A;  4M7D B;  4LDU A;  5CAI A;  4FYV B;  3C4S A;  1OUL A;  3MET A;  1TOV A;  4M7A G;  2K2V A;  4A4K A;  2YUP A;  1AVZ C;  2KRM A;  4PJN A;  5EC7 A;  4KT0 E;  1SSH A;  2RH2 A;  1VQ7 T;  1RAH B;  2GQI A;  2RB6 A;  5KYN A;  1QVG A;  1JJ2 S;  4OB1 B;  2RQU A;  4MZT A;  3R6O A;  3J7A F;  1PSF A;  1HK9 A;  2CS7 A;  1EIF A;  1SRM A;  2QYZ A;  1XTD A;  2JMA A;  4M77 D;  2A7Y A;  2LQW A;  2D9T A;  2DEQ A;  2XHC A;  1YHQ T;  1WJS A;  5GAN 3;  1KC8 C;  4Z88 A;  2M0Y A;  4ZNX A;  4AFU C;  1VQ9 Q;  4CC2 A;  2O4X A;  4M75 F;  2RK2 A;  2LJ1 A;  2FZC B;  4E7I A;  3MKD A;  5CO7 A;  4LE9 A;  5CKH A;  2VAS A;  2ZPF B;  4R56 A;  2DPP B;  2O4X B;  4KGZ B;  1VQP Q;  3BDU A;  4MZP A;  1BIB A;  4RG8 A;  1OOT A;  4LNP A;  2DVE A;  3C0C A;  3DKM A;  2OX7 A;  2OTL A;  3EHQ A;  2CP3 A;  1VQ8 T;  1Q82 C;  2E64 A;  3M53 A;  3I9Q A;  2E12 A;  1O9S A;  3M0R A;  1B3Q A;  4LDW A;  1I4K 1;  3NHN A;  3JB9 J;  3V7S A;  1WXT A;  4JRI A;  4F16 A;  3QO3 A;  1G3Y A;  3EAE A;  2MOX A;  5D6X A;  1LOJ A;  2EVR A;  1WX6 A;  4BE2 A;  5GAO n;  3OW2 A;  3CXC A;  3WXM B;  3RDV A;  4QT7 A;  4C5G A;  3PTA A;  2CH4 W;  1IB8 A;  2RNA A;  1E7O A;  4JJC A;  3OY9 A;  2FPE A;  2BZY A;  5FRO A;  3CCR Q;  1VYU A;  1VQM T;  1I07 A;  4F17 A;  4EMH A;  1FYN A;  1D3B A;  1U3O A;  3A8L B;  2QA4 A;  2LVM A;  2X4W A;  1Z9Z A;  4X9C A;  3CCV A;  2RQW A;  4BY6 C;  1D1C A;  4OMM A;  1K1Z A;  3CCL A;  2IPO B;  2EYY A;  2J7I A;  1NYF A;  1NZ9 A;  2LMJ A;  1YJ9 T;  4FM4 B;  2KQW A;  5KYU B;  4Z89 A;  3OYI A;  1ZUU A;  4OMF B;  2DEU A;  1QVF P;  1FMW A;  4C8Q C;  4C92 E;  1M2V A;  3CPW A;  3HFN A;  2L5Q A;  2PVO B;  1KK7 A;  3G4S Q;  4M7D E;  1ZQ1 A;  3JB9 I;  1Y71 A;  4CC7 A;  4DEX A;  4AT1 B;  4DBH A;  6AT1 B;  1D09 B;  3SD4 A;  1CKB A;  4J9H A;  2LCC A;  2O01 E;  3SWN A;  4C5E A;  3CD6 T;  4Y28 E;  1IXD A;  1VQ7 Q;  3OYG A;  1VQL A;  3SWN B;  1JU5 C;  4RTT A;  1ACM B;  1TUD A;  2RJE A;  3M4Y A;  3NGP A;  4BI3 A;  4J9F A;  2VC8 A;  4KUD K;  3VS5 A;  4J5Y A;  4A54 A;  2HL5 C;  2HD0 A;  2CT3 A;  1UHC A;  3M5A A;  1QVG S;  4FYY B;  2E6Z A;  1VQK T;  3EGD A;  5GAN 7;  2PNI A;  1T3L A;  3I55 A;  4JLG A;  3CMA Q;  2BKD N;  4Y91 A;  2DBM A;  2EFI A;  2XI9 A;  1YHQ Q;  1ABO A;  2GGR A;  2JN0 A;  5CCA A;  4ZN1 A;  2QEX A;  1RAI B;  1KJW A;  5FWC A;  2AIR B;  5GAN 4;  1G2B A;  5GAO l;  3CC7 T;  1MMN A;  2LC4 A;  1LNX A;  4J9I A;  3VS4 A;  5L8R E;  3HFO A;  5GMK j;  3L2V A;  2X4Y A;  2ZPI B;  1N8R U;  3OBW A;  2RQV A;  3X28 B;  3QDF A;  1N6A A;  4C8Q D;  1ZSG A;  3L1A A;  2HCK A;  2IIM A;  1WHJ A;  4PJJ A;  5FU7 B;  4DOW A;  5LJ5 h;  1VQ8 Q;  5DLO A;  3HSB A;  2DTO A;  2CKK A;  4NL3 A;  3OYD A;  2QAS A;  2DJZ A;  2LRQ A;  2X4X A;  4D6W A;  1JJ2 P;  2ED1 A;  1IRE B;  1WA7 A;  2LCS A;  4C92 G;  2GF7 A;  2E1H A;  3G6E A;  2Y4Y A;  2DMO A;  1YP5 A;  3PNW C;  5HKC A;  2DF6 A;  2QG9 B;  4M7D G;  3SEM A;  4JJB A;  1W1F A;  2ECZ A;  1PRM C;  2M16 A;  3M0Q A;  1AWW A;  4DBQ A;  4PFP A;  3CME A;  2F69 A;  2M02 A;  3OW2 S;  3CXC S;  1ABQ A;  1W70 A;  2O31 A;  2GTJ A;  4RKU E;  1VQ6 A;  4N4I A;  4MDX A;  4TVR A;  1QCF A;  4DQ2 A;  1NPR A;  1C6V X;  2LT4 A;  3A1P A;  1Y96 A;  2SEM A;  3E2U A;  1YJN A;  2DXC A;  5GAN f;  3V8L A;  2W10 A;  1H8K A;  1HSQ A;  1NYG A;  3NMZ C;  3G71 T;  4BUG A;  1YJ9 Q;  1UGV A;  4C0Z A;  3EH2 A;  3E19 A;  5GAO p;  1GRI A;  2RQT A;  2EJG A;  2NYS A;  3SHW A;  3S3N A;  4A4H A;  1I0C A;  4KH1 B;  4L59 A;  3QBY A;  1FMV A;  5LJ3 f;  1YJW T;  1NJI C;  1AD5 A;  3NPF A;  1Z9Q A;  4J7I A;  2F2V A;  3CPW S;  3E9F A;  4C8Q F;  1N5Z A;  2KEA A;  1PD1 A;  1UHF A;  4PJO A;  3VRY A;  3CD6 Q;  4BDZ A;  1K8A C;  1AWJ A;  3LWI A;  2DX1 A;  2QQB A;  2IVW A;  4PJO B;  2K5L A;  1R77 A;  1WJR A;  1WLP B;  1M1K C;  1ZSZ C;  2DIL A;  4QQG A;  3OYB A;  1JBM A;  1XJW B;  3WVD B;  1VQ8 A;  3HL8 A;  2P4R A;  3I56 T;  1VQK Q;  3ZBD A;  2PUK B;  3CC4 A;  4RCC A;  2YUQ A;  5IXF A;  2E70 A;  4O6J A;  1YI2 A;  2DAQ A;  4F7U A;  1VYV A;  2WSE E;  4BE1 A;  4HCK A;  4C5H A;  1JRI A;  1Q7Y R;  3TSZ A;  1Q82 R;  2RK1 A;  4JRK A;  1YCS B;  5J3B A;  4B9X A;  3CC7 Q;  1VQO A;  2AK5 A;  1UGR B;  3QG1 A;  4XTU A;  5A2Q E;  1X6G A;  2V1Q A;  1VQM A;  3CCS A;  1UGQ B;  5IAY A;  4LDV A;  2COZ A;  3PE0 A;  2FHD A;  5GJV B;  7AT1 B;  4LXC A;  2DRM A;  1M5Q 1;  3OYK A;  1BI0 A;  4JRQ A;  3S3M A;  2BTT A;  1MND A;  4J9B A;  4IUU A;  3JB9 H;  4CI0 C;  2L8D A;  1KC8 U;  2D8J A;  2DVJ A;  2EQJ A;  3MPU B;  4M7A C;  1G3T A;  2ROL A;  1GL5 A;  4X1V A;  4XTY A;  2ZPB B;  3UA7 A;  5A0G A;  8ATC B;  2M0O A;  3JCM c;  2DXB A;  1RAB B;  3L2Z A;  1QVG P;  3M9Q A;  3A5Z B;  3JCM f;  2RPN A;  2LNV A;  4BD3 A;  1I5L A;  1BI3 A;  1IHV A;  4HCB A;  2OAW A;  1RI9 A;  1M9S A;  2FZK B;  4BDY A;  2QDL A;  3VKI A;  1OU8 A;  1VQN A;  3UT1 A;  1M90 C;  1D1B A;  1Q82 U;  4JS5 A;  3CD6 A;  1RLQ C;  2K5F A;  2LQK A;  1V29 B;  3L2W A;  3BFM A;  2FEI A;  2EGC A;  2WSF E;  4PNO A;  1QCN A;  2PTK A;  2MF2 A;  2HZY A;  3G71 Q;  4JJN K;  1X27 A;  3E9G A;  1VQK A;  3A8M B;  2KMT A;  1HYO A;  3EH1 A;  3OS0 A;  5KYX B;  2JUF A;  2XMF A;  2KRO A;  2CZ7 B;  3TEE A;  1YJW Q;  3HRS A;  1UJY A;  3QJY A;  3HP9 A;  2ZPH B;  2MK5 A;  3M55 A;  1JXM A;  1VIF A;  4IIO A;  3V8J A;  4GLK A;  5J39 A;  2V26 A;  4M7A D;  2KBT A;  3EHR A;  3RES A;  1RAD B;  1RUW A;  4M78 A;  3BE3 A;  3V8K A;  2DLP A;  5LJ5 j;  2DBK A;  5KCH A;  1WQW A;  4QVC A;  3CCM T;  2PZ1 A;  1UFF A;  4M78 B;  3VS3 A;  1TG0 A;  2R57 A;  2XG8 D;  3OA6 A;  4PJO E;  3OW2 P;  3X25 B;  3CXC P;  5CKB A;  1W2B A;  1M3C A;  3CCU T;  4OML A;  1RAG B;  3MO8 A;  3CCJ Q;  1ZUK A;  1WDX A;  2RM4 A;  2YDL A;  3I56 Q;  1SF9 A;  2K6D A;  2GBQ A;  1OQK A;  2FPD A;  4OGE A;  1WJQ A;  2O9V A;  1I1J A;  2D1X A;  3G4S T;  1TU0 B;  4C0D C;  1WXB A;  2CT4 A;  3A8O B;  3O5Z A;  2WSC E;  2EYZ A;  2SRC A;  1UG1 A;  2BIV A;  2A08 A;  4DBF A;  1MMA A;  3C94 A;  3VUB A;  2ESW A;  1GFC A;  4F7U E;  2LJ0 A;  2DZC A;  4YTL A;  3S6W A;  3VV0 A;  5GAM d;  2IG0 A;  1QQJ A;  4N0A A;  3CCE Q;  5J26 A;  3OYJ A;  2LQ8 A;  2BE7 D;  4ZGE B;  4A4E A;  1IHW A;  3HRU A;  4A4F A;  2LX9 A;  2G6F X;  3CPW P;  5AYF A;  2KDS A;  4JZ4 A;  1LCK A;  4C8Q B;  2EQU A;  2QAZ A;  5GMK e;  2D0N A;  3JCM P;  2MIO A;  3V7R A;  1SEM A;  2VXE A;  1AZE A;  1AZG B;  3CMA T;  2NUP A;  1ZBJ A;  2XKO C;  4JJD A;  1JEG A;  2NUP B;  1S72 T;  3RMS A;  4AFS C;  4RTX A;  1I8F A;  1KD1 C;  3QKJ A;  2OJ2 A;  1YJW A;  4KGX B;  2PVG B;  1OX8 A;  1D0Y A;  4C0F A;  4M7A F;  2CUD A;  2KNB B;  1Q86 C;  2JNG A;  3LGF A;  1U06 A;  2F2X A;  2JS2 A;  4J6X A;  4AMC A;  4RUG A;  5GAN h;  2R58 A;  4N4G A;  2JZ2 A;  2RF0 A;  4PJO G;  4DBR A;  1MMG A;  5I2S A;  2FRY A;  3TRE A;  3RUX A;  2VKN A;  5DLQ E;  3L2Q A;  2L0A A;  1GBQ A;  2LP5 A;  2DNU A;  1WNL A;  4EMK A;  1B34 A;  3H9N A;  5LJ3 h;  5GMK m;  2XK0 A;  1X01 A;  4HCZ A;  3QSU A;  4XQ3 A;  3EG9 B;  4EMK B;  4PFO A;  1B34 B;  4OMN A;  1T3S A;  4Z8A A;  1XOV A;  1TUC A;  2VVK A;  4E2F B;  1T0J A;  1K8A R;  3MP8 A;  2DZ9 A;  1H64 1;  4F7U G;  4J6Y A;  2EW3 A;  3M54 A;  2KSS A;  2COW A;  2KR3 A;  5GAM j;  4OB0 B;  3V7C A;  3H8Z A;  2OI3 A;  4OMP A;  1K76 A;  5ECA A;  1KSW A;  5HK3 A;  1SPK A;  3ASK A;  1KQ1 A;  3QDR B;  3X20 B;  4ANJ A;  1PKT A;  3MCA B;  4C92 C;  5I2M A;  3VJP A;  3CCM Q;  2HNI A;  4M78 E;  3VS6 A;  2DYI A;  2RO0 A;  1IZ6 A;  2A3L A;  2DTI A;  4M77 F;  5D6W A;  1Y7X A;  1G8X A;  4PJM A;  5KYU A;  1V76 A;  3HTR A;  1M8M A;  3GIB A;  3CCU Q;  4M7D C;  1LPL A;  1TS9 A;  2KI7 A;  2NLU A;  2C0T A;  3PIP A;  4XU2 A;  1Y57 A;  5GAM g;  1NJI U;  1Y07 A;  3DB3 A;  3EGX A;  3FC3 A;  3CC2 T;  4OB3 B;  2JVV A;  1FXX A;  4F04 B;  1M1F A;  4Z02 A;  2VGN A;  2WAC A;  1Q7Y C;  1N8R R;  3EGX B;  3JCM X;  4BAC A;  2C0O A;  1X2K A;  2AKK A;  1VQ9 A;  1K9M C;  1QMC A;  1RLP C;  1OZ3 A;  1OI1 A;  2NWM A;  2YLB A;  1YIT T;  3RR6 A;  4GLM A;  1K8A U;  3LH0 A;  2OTJ Q;  1JO8 A;  1OYX A;  1VQP A;  1OZ2 A;  3H6Z A;  4E7J A;  2P84 A;  3A8H B;  2KXC A;  1AEY A;  4EIK A;  2DXT A;  2HKQ B;  2RI3 A;  2KK4 A;  4E47 A;  2P0Q A;  2L3Q A;  3OQ5 A;  1YIJ T;  1VQ5 T;  1X69 A;  1KHI A;  4OF1 A;  1YWP A;  5D7U A;  4PL6 A;  1U8R A;  1EFN A;  2COY A;  3JCM h;  1X75 C;  4DEY A;  3M0P A;  2QTX A;  4C92 D;  3JCM W;  1F1B B;  1PCX A;  1M90 R;  2D8H A;  1S72 Q;  4P5N A;  3QWY A;  2W0Z A;  2R5M A;  2X3W D;  4M7D D;  1NG2 A;  4FW1 A;  3FRN A;  1FWZ A;  5GAN d;  3E1S A;  2RHY A;  1BCO A;  4QVZ A;  3CCR A;  1ZSZ B;  3OS1 A;  2X9H A;  4M78 G;  3G1J A;  5GAN 8;  3VUZ A;  2HDA A;  1HJD A;  2EBP A;  1UEC A;  2DRK A;  2DL4 A;  3FIF A;  5LJ3 d;  1K73 C;  1IRX A;  2RHX A;  5IT9 E;  4OVA A;  2KT1 A;  4J9D A;  4VUB A;  2RI2 A;  2FPF A;  2L3P A;  2X4J A;  2FL7 A;  2VUB A;  2KXD A;  2D6F A;  3QYG B;  2JM8 A;  1SHG A;  4PLL A;  3GNG A;  1UE9 A;  3INZ A;  3GBQ A;  3G4S A;  1YFN A;  4BI4 A;  2MWP A;  4J9C A;  3REA B;  4WTO B;  1NE8 A;  1C0M A;  2QQ9 A;  2RJC A;  1M90 U;  2F2W A;  4M75 A;  4J83 A;  1QW1 A;  1QVP A;  2JOY A;  2ZCF B;  3L2R A;  5CQX A;  1KIK A;  3QXE B;  5IH2 A;  4IUP A;  1OV3 A;  4M75 B;  1VQ7 A;  2MPX C;  1B7T A;  4C0G A;  1QWF A;  1TWB A;  2LJ3 A;  2FZG B;  3VS2 A;  2KYB A;  3EG2 A;  4M7A B;  1TSF A;  2GQV A;  5IHN A;  4J7F A;  2A0F B;  2HQX A;  1QVF A;  1D0Z A;  2DD5 A;  4FYX B;  2HBW A;  3O8V A;  2XDP A;  1WI7 A;  1YCY A;  4RMO A;  4FL6 A;  2YUN A;  4C92 F;  2A36 A;  4JZ3 A;  2YWW A;  5HK0 A;  2CP5 A;  1Q81 C;  3NTH A;  5IHK A;  3CMA A;  3CC2 Q;  5C0M A;  4II1 A;  1YHQ A;  3HPW A;  1OU9 A;  4C5I A;  4XTZ A;  3CPF A;  3SWN C;  2JT4 A;  1K9A A;  3MEA A;  3H0I A;  4DOV A;  1X6B A;  3CCQ Q;  5GAN j;  2XU8 A;  2P0K A;  3VU3 C;  5GAN 5;  1YIT Q;  2J6O A;  3DLL A;  2YXY A;  2CZ0 B;  1RAE B;  3RKY A;  1KC8 R;  3X24 B;  1A0N B;  2ENM A;  5LJ3 j;  3RER A;  4IUR A;  2YSQ A;  3G7Z A;  4R0K A;  4PLI A;  2MAM A;  4OMQ A;  2X35 A;  3CCJ T;  2ABL A;  1UJ0 A;  5GAO m;  1YIJ Q;  1VQ5 Q;  1CKA A;  5CQY A;  4FT4 A;  2G3R A;  2OTL T;  4ATO A;  4M77 A;  1VYT A;  5GAN g;  1WFW A;  1YNZ A;  1W6X A;  5DM7 R;  2JTM A;  2KRN A;  4Q5W A;  4M77 B;  2GFU A;  2AHJ B;  2DL8 A;  2RQR A;  2EQK A;  3FB9 A;  4RTZ A;  2GTO A;  3PIO A;  5FU7 C;  3FLG A;  5M9O A;  1RI0 A;  4IUQ A;  1W2B P;  2VGM A;  2D0Q B;  2JXB A;  5LJ3 g;  4LDY A;  3CCE T;  3OBY A;  2MYS A;  2C06 A;  1FX7 A;  2EGE A;  2HSE B;  2PVD B;  5LJ5 d;  2DTH A;  1M3A A;  3AHU A;  3JSC A;  2KAF A;  2RD1 A;  3BY7 A;  2QA4 T;  4RTW A;  2DM1 A;  3CCV T;  5AT1 B;  1GFD A;  2E5K A;  4E7S A;  1M1G A;  2LCL A;  3OYY A;  1YJ9 A;  3CCL T;  3I5R A;  2K7A A;  2B86 A;  2JW4 A;  3JCM V;  3EGU A;  1PNJ A;  2V8I A;  1KD1 U;  3GOX A;  1PD0 A;  2HSP A;  3M56 A;  4E7Z A;  3QWX X;  3KFV A;  1S1N A;  4J8O A;  1ZLM A;  2YUO A;  1ZHI A;  1X43 A;  3J81 E;  3HRT A;  1Q86 U;  2VXF A;  1O75 A;  4HCC A;  3JB9 G;  4RTY A;  2E3H A;  5KE2 A;  1HD3 A;  3IQL A;  1KQS A;  1GXI E;  1BB9 A;  2NUT B;  2H3E B;  1IO6 A;  4HT9 A;  2A37 A;  2YT6 A;  1RAA B;  2O88 A;  2J05 A;  4M75 E;  3GNF B;  1VIE A;  2F1L A; 
#chains in the Genus database with same CATH homology
 4Y28 E;  3M59 A;  3OYG A;  1S72 T;  3M4G A;  1UEB A;  3RMS A;  3SWN B;  5GAM e;  3OYN A;  1VQL A;  3UDC A;  1I8F A;  3OYM A;  4KUL A;  1KD1 C;  2RJE A;  3M4Y A;  3QKJ A;  4XTV A;  1YJW A;  4BI3 A;  4NL2 A;  2VC8 A;  4KUD K;  2PVG B;  4J5Y A;  4A54 A;  4M7A F;  4C0F A;  2Y4X A;  2HD0 A;  2DIG A;  5HY6 A;  2PU9 B;  3M5A A;  1MHN A;  1QVG S;  1Q86 C;  2E6Z A;  2JNG A;  3LGF A;  1UGP B;  2Y90 A;  5GAO q;  1VQK T;  4QW2 A;  1W4S A;  3KXT A;  4J6X A;  5GAN 7;  5GAN h;  4JRP A;  2R58 A;  2RJF A;  4N4G A;  2F5K A;  5I21 A;  2JZ2 A;  4PJO G;  4KBM B;  2EYQ A;  3LLR A;  4JLG A;  3I55 A;  2BKD N;  2RI5 A;  4Y91 A;  2EFI A;  5I2S A;  2XI9 A;  5D6Y A;  4OP0 A;  4XU1 A;  4X9D A;  3TRE A;  3I55 T;  4KUI A;  2JN0 A;  5CCA A;  4PJO C;  3CBO A;  3RUX A;  3JCM d;  3PFS A;  1R8O B;  5DLQ E;  4ZN1 A;  2QEX A;  3L2Q A;  5DY9 A;  2L89 A;  2QEX T;  1G3S A;  1WNL A;  4EMK A;  4ZTJ A;  1B34 A;  2I2L A;  3CC7 A;  5GAN 4;  5LJ3 h;  1H3Z A;  5GMK m;  5GAO l;  2XK0 A;  1X01 A;  3P8D A;  4L5G A;  3CC7 T;  2YHT A;  4HCZ A;  2LC4 A;  3QSU A;  1LNX A;  3OS5 A;  4XQ3 A;  4EMK B;  5L8R E;  1B34 B;  3HFO A;  2P4T A;  3N5B B;  2X4Y A;  5GMK j;  3L2V A;  3GPL A;  4E7H A;  1KHC A;  1XOV A;  2ZPI B;  1N8R U;  3QUI A;  3OBW A;  3X28 B;  2ZZD A;  3CCQ T;  1N6A A;  2GFA A;  4C8Q D;  5C6S A;  3L1A A;  1PSE A;  3MEV A;  2FYK A;  2BUD A;  3MP8 A;  2DZ9 A;  1H64 1;  4V2S A;  4F7U G;  3LYI A;  3TU4 K;  3EFS A;  2XD0 A;  4J6Y A;  3OB9 A;  5FU7 B;  3M54 A;  2KSS A;  3ZEH A;  4ELY C;  3NFC A;  1ZBX A;  4FT2 A;  2DO3 A;  2QDY B;  4DOW A;  5GAM j;  1I81 A;  4OB0 B;  3JB9 D;  5LJ5 h;  3V7C A;  5CKE A;  3H8Z A;  3LX7 A;  5DLO A;  3HSB A;  2DTO A;  1Q7Y U;  3F70 A;  2CKK A;  5GAN 6;  5HK3 A;  4NL3 A;  3OYD A;  2DJZ A;  1G3W A;  2LDM A;  2LRQ A;  2X4X A;  4D6W A;  4F7U B;  5CK9 A;  3ASK A;  2KY9 A;  3FJP A;  1IRE B;  1JJ2 A;  2JTF A;  3OS2 A;  4C92 G;  1KQ1 A;  4M77 E;  5FLX E;  2GF7 A;  2E1H A;  1K9M U;  3G6E A;  1N9S A;  2Y4Y A;  3QDR B;  3PT9 A;  3X20 B;  3X26 B;  4ZTF A;  2KVQ G;  3MCA B;  4C92 C;  2L3R A;  5I2M A;  5LJ5 g;  3PNW C;  4HKE A;  3VJP A;  5HKC A;  2HNI A;  4M78 E;  4C0D B;  2EQM A;  2RO0 A;  2EIF A;  1IZ6 A;  2A3L A;  1U1S A;  2DTI A;  4M77 F;  1Y7X A;  2R5A A;  5D6W A;  5GAM h;  1XQH A;  4ME7 A;  1X6O A;  1N8R C;  2QQA A;  3GIB A;  4BY6 B;  4C92 B;  2OTJ T;  4FSX A;  4M7D C;  2M16 A;  3CME A;  2F69 A;  3J80 E;  2VV5 A;  1M8V A;  3VYG A;  3OYH A;  3CME T;  4M75 G;  1YBY A;  1RL2 A;  3OW2 S;  2NLU A;  3CXC S;  3PIP A;  4XU2 A;  5FU6 C;  3CC2 A;  5GAM g;  4MML A;  1NJI U;  1Y07 A;  3DB3 A;  4ELZ C;  4C8Q A;  2DXU A;  2XDD A;  4M75 C;  1BIA A;  4N4H A;  3FC3 A;  3CC2 T;  3UWN A;  4OB3 B;  2JVV A;  4RKU E;  1FXX A;  3QJ6 A;  4IUV A;  1VQ6 A;  4N4I A;  1M1F A;  4Z02 A;  4MDX A;  2VGN A;  2WAC A;  1Q7Y C;  4XK8 E;  2HBP A;  4TVR A;  5FU6 B;  4A4G A;  4IUT A;  5A0L A;  1VQ6 T;  4PJO D;  3JCM X;  3CCQ A;  4DQ2 A;  4BAC A;  1NPR A;  1VQ9 A;  2LT4 A;  2M9U A;  3PGG A;  4CRI A;  3QZ5 B;  3OYA A;  1K9M C;  1Y96 A;  2XDB A;  1WGS A;  1VQ9 T;  1OZ3 A;  1OI1 A;  2CGH A;  1YIT A;  3OYF A;  3BDL A;  1YJN A;  2DXC A;  2YLB A;  3CEY A;  1YIT T;  5GAN f;  1WQ7 A;  2E41 A;  2RHZ A;  3V8L A;  1YJN T;  3G71 A;  1N27 A;  1U1T A;  4XU3 A;  1K8A U;  3LH0 A;  3G71 T;  5LL6 S;  3VYH B;  1OYX A;  3C95 A;  4BUG A;  3OYL A;  1AHJ B;  5CR2 A;  4R55 A;  1VQP A;  2DIQ A;  4C0Z A;  2EJ9 A;  3QYH B;  3A8G B;  1OZ2 A;  2RJD A;  3E19 A;  3H6Z A;  3LGL A;  5GAO p;  4E7J A;  1VQ4 T;  1VQP T;  4M7A E;  3A8H B;  3QII A;  2EJG A;  3ME9 A;  1VQL T;  3S3N A;  5FRM A;  2VYT A;  4E7L A;  4A4H A;  4L59 A;  3QBY A;  2DXT A;  2RI3 A;  3MEU A;  4OB2 B;  5LJ3 f;  1YIJ A;  3WVE B;  1YJW T;  1NJI C;  1VQ5 A;  2KK4 A;  2H3J A;  2P0Q A;  4E47 A;  2F5T X;  3OQ5 A;  1YIJ T;  2DK3 A;  2ZPG B;  1VQ5 T;  2RA2 A;  3EFR A;  4EPC A;  1QVF S;  4MMK A;  3MHX A;  1KHI A;  4E7K A;  4J7I A;  4OF1 A;  4WF2 A;  4BI8 B;  3CPW S;  4PL6 A;  3E9F A;  1U8R A;  2CYZ B;  3JCM b;  4C8Q F;  3JCM h;  1BYM A;  1LJO A;  1SSF A;  1X75 C;  3ER0 A;  4LDX A;  4ZN3 A;  3JCM Q;  3CBP A;  4NOY A;  1NPP A;  1KQS S;  3KBG A;  1K73 U;  2GCX A;  3DB4 A;  2QTX A;  4XAX B;  4PJO A;  4C92 D;  4QQ6 A;  3JCM W;  4BDZ A;  2E65 A;  1K8A C;  2E10 A;  3L2U A;  5LJ5 f;  3JB9 F;  4P5N A;  3LWI A;  4QVD A;  3MEW A;  2QQB A;  4XTX A;  2IVW A;  4PJO B;  2M1H A;  2R5M A;  5EG2 A;  2K5L A;  4RCB A;  2DKG A;  3JCM g;  4M7D D;  2QQR A;  2K4Y A;  2ZGW A;  1WJR A;  3LW5 E;  3CCJ A;  1M1K C;  4QQG A;  3FRN A;  1FWZ A;  3M58 A;  3OYB A;  5GAN d;  1JBM A;  3E1S A;  3OSS C;  4M77 G;  2RHY A;  4O5V A;  3WVD B;  3I56 A;  1VQ8 A;  3SFM A;  3HL8 A;  4QVZ A;  5CVI A;  3I56 T;  3CCR A;  3T9N A;  4M75 D;  2HQE A;  4M77 C;  3ZBD A;  5GMK l;  2PUK B;  3OS1 A;  4DA4 A;  5GAM f;  3CCR T;  3CC4 A;  4M78 G;  4RCC A;  4RG2 A;  5GAN 8;  2PQW A;  3GF5 A;  4MDW A;  5CKF A;  3TCJ A;  3VUZ A;  3CC4 T;  2E70 A;  2V8K A;  5IN1 A;  4M78 C;  4O6J A;  1YI2 A;  4BB7 A;  2DAQ A;  3JCM J;  2E6N A;  4F7U A;  2CZ1 B;  2OAU A;  2WSE E;  1YI2 T;  4BE1 A;  3FIF A;  5LJ3 d;  3QZ9 B;  5GMK h;  5FRN A;  4C5H A;  1K73 C;  2RHX A;  5CKD A;  1JRI A;  2RHU A;  3C12 A;  2RHI A;  2RK1 A;  5IT9 E;  2HAX A;  4OVA A;  1JB0 E;  4JRK A;  1BKB A;  3CCE A;  5J3B A;  4JDS A;  4UC4 A;  1HXD A;  4B9X A;  1VQO A;  4VUB A;  3P8B B;  2RI2 A;  2ZPE B;  3HHT B;  3G6E T;  1UGR B;  2X4J A;  4LD9 K;  4C92 A;  1VQO T;  2FL7 A;  4PJO F;  2EJF A;  2VUB A;  3QG1 A;  3UPU A;  2YLC A;  4XTU A;  5A2Q E;  2D6F A;  4FU6 A;  3SB2 A;  4X34 A;  1BI2 A;  3QPH A;  3QYG B;  5KCO A;  3JAM E;  5GAN e;  3PMI A;  3KUF A;  4PLL A;  3GNG A;  1KQ2 A;  1VQM A;  3CCS A;  2V8J A;  1QP3 A;  4M7D A;  3INZ A;  3G4S A;  1UGQ B;  5IAY A;  2FVU A;  4LDV A;  3CCS T;  4BI4 A;  4A53 A;  2FHD A;  2PUO B;  1TH7 A;  2MWP A;  1Q81 U;  1M5Q 1;  3OYK A;  1BI0 A;  2QXF A;  4M7D B;  4JRQ A;  4LDU A;  5CAI A;  3S3M A;  1W2B S;  1NE8 A;  3C4S A;  2QQ9 A;  2RJC A;  3MET A;  4GY5 A;  1M90 U;  1D3B B;  2QQS A;  4IUU A;  3JB9 H;  4M75 A;  4M7A G;  2K2V A;  4J83 A;  1P92 A;  4A4K A;  4CI0 C;  2L8D A;  1QW1 A;  1QVP A;  2JOY A;  2ZCF B;  3L2R A;  1KC8 U;  2EQJ A;  5LJ3 e;  4JLI A;  5CQX A;  4M7A C;  3QXE B;  1DJ7 B;  1G3T A;  4IUP A;  3DLM A;  4M75 B;  4XTY A;  3SDZ A;  4KT0 E;  1VQ7 A;  2ZPB B;  5CIU A;  4C0G A;  3MP1 A;  4N0A C;  5A0G A;  2M0O A;  1BI1 A;  3JCM c;  1N9R A;  2RH2 A;  4F7U F;  1VQ7 T;  2DXB A;  2RB6 A;  2DD4 A;  3L2Z A;  4M7A B;  2GQV A;  4MZM A;  1QVG A;  3Q1J A;  1JJ2 S;  4J7F A;  2HQX A;  2MMP A;  3NTK A;  4OB1 B;  1QVF A;  1VUB A;  2DD5 A;  3M9Q A;  2FB7 A;  4MZT A;  3A5Z B;  3R6O A;  3JCM f;  1G5V A;  3J7A F;  1PSF A;  2LNV A;  3O8V A;  1UB4 A;  4BD3 A;  1I5L A;  1BI3 A;  4HCB A;  2XDP A;  3NTI A;  1HK9 A;  2CS7 A;  1EIF A;  1YCY A;  1UGS B;  4RMO A;  1M9S A;  1XTD A;  4FL6 A;  4JS4 A;  4BDY A;  4C92 F;  4M77 D;  2K57 A;  1M1K U;  2A7Y A;  3VKI A;  5HK0 A;  1Q81 C;  1VQN A;  3NTH A;  3CMA A;  2D9T A;  2DEQ A;  4B9W A;  5C0M A;  4II1 A;  1YHQ A;  1VQN T;  3UT1 A;  3HPW A;  4M78 D;  4HA8 A;  2XHC A;  4NS5 A;  4C5I A;  1Q82 U;  1M90 C;  4JS5 A;  4XTZ A;  3CPF A;  3CBM A;  3SWN C;  1YHQ T;  4C8Q E;  3CD6 A;  1WJS A;  2K5F A;  2LQK A;  5GAN 3;  1KC8 C;  1V29 B;  2MI6 A;  3L2W A;  3MEA A;  5GAO r;  4DOV A;  5GAN j;  2XU8 A;  3BFM A;  3S3O A;  4J6W A;  4BE0 A;  2WSF E;  4PNO A;  2O4X A;  2P0K A;  3VU3 C;  5GAN 5;  4M75 F;  4HT8 A;  2RK2 A;  3GLX A;  1XNI A;  3M57 A;  4EMG A;  3DLL A;  2B8A A;  2MF2 A;  3RKW A;  4E7I A;  5CO7 A;  4ZGD B;  3LWH A;  5CKH A;  3GP8 A;  2ZPF B;  4R56 A;  4JJN K;  2DPP B;  2O4X B;  3E9G A;  5GAN 2;  2CZ0 B;  2P0P A;  5GMK i;  3RKY A;  1VQK A;  3A8M B;  3X24 B;  2KMT A;  2K5I A;  3BDU A;  3OS0 A;  4MZP A;  5LJ3 j;  1BIB A;  3RER A;  4IUR A;  4RG8 A;  2LTO A;  2JUF A;  3G7Z A;  1KG1 A;  4PLI A;  2CZ7 B;  2DVE A;  2MAM A;  2X35 A;  3DKM A;  3TEE A;  1WPY A;  3HRS A;  3MP6 A;  3CCJ T;  1QP2 A;  3OMG A;  3HP9 A;  3QJY A;  2ZPH B;  5GAO m;  2OTL A;  3M55 A;  5CQY A;  3OW2 A;  3OMC A;  4FT4 A;  4OGC A;  4EDU A;  2G3R A;  1Q82 C;  1VQ8 T;  2OTL T;  4ATO A;  1VIF A;  2E64 A;  3M53 A;  4M77 A;  3V8J A;  2QI2 A;  2E12 A;  4GLK A;  5J39 A;  1O9S A;  4EMK C;  4LDW A;  1I4K 1;  5GAN g;  2XID A;  3JB9 J;  3V7S A;  4M7A D;  2CZ6 B;  5DM7 R;  2JTM A;  4ZGJ B;  4Q5W A;  4JRI A;  3ZFJ A;  5KH6 A;  4M77 B;  2GFU A;  4M78 A;  2AHJ B;  3RES A;  3V8K A;  2EQK A;  3FB9 A;  5LJ5 j;  2MWO A;  3CCM A;  3QO3 A;  5KCH A;  1G3Y A;  1WQW A;  4QVC A;  3EAE A;  5D6X A;  3CCM T;  3PIO A;  4M78 B;  1LOJ A;  2R57 A;  3OYE A;  2XG8 D;  3HKS A;  5FU7 C;  3FLG A;  5M9O A;  3OA6 A;  3CCU A;  4BE2 A;  3OSV A;  1RI0 A;  1M4Z A;  4IUQ A;  3X25 B;  2LT1 A;  5CKB A;  3WXM B;  5GAO n;  2VGM A;  4PKC C;  3CXC A;  1W2B A;  3CCU T;  2D0Q B;  5LJ3 g;  4C5G A;  3BW1 A;  2K3Y A;  1MGQ A;  4LDY A;  3CCE T;  3RKX A;  3MO8 A;  3URG A;  3PTA A;  3OBY A;  2RM4 A;  3OY9 A;  2C06 A;  2XIC A;  1FX7 A;  5FRO A;  3PMT A;  4OGE A;  2PVD B;  1WJQ A;  5LJ5 d;  3JCM e;  2DTH A;  1VQM T;  4M7D G;  3AHU A;  3JSC A;  3RMQ A;  2KAF A;  4EMH A;  1D3B A;  2RD1 A;  3G4S T;  3A8L B;  4C0D C;  3A8O B;  2QA4 A;  2LVM A;  3BY7 A;  2WSC E;  2X4W A;  4LD6 A;  4X9C A;  4XTW A;  3CCV A;  2QA4 T;  4XU0 A;  2BIV A;  4BY6 C;  3CCV T;  3JRZ A;  3C94 A;  3VUB A;  2E5Q A;  4F7U E;  3CCL A;  1M1G A;  2LCL A;  3QHS A;  2OTJ A;  2DZC A;  3OYY A;  1YJ9 A;  3L42 A;  4PJO E;  5A0D A;  3CCL T;  4M7A A;  4YTL A;  1NZ9 A;  3S6W A;  3VV0 A;  5GAM d;  1YJ9 T;  4FM4 B;  2IG0 A;  4M78 F;  3JCM V;  2KQW A;  4N0A A;  5J26 A;  3OYJ A;  2V8I A;  4C8Q G;  3OYI A;  1KD1 U;  2LQ8 A;  3GOX A;  4OMF B;  3M56 A;  4FIB A;  4ZGE B;  4A4E A;  4QQD A;  3HRU A;  4A4F A;  4C8Q C;  2LX9 A;  4C92 E;  4IKF A;  4J8O A;  1ZHI A;  3P8H A;  3J81 E;  3CPW A;  3HRT A;  2EAY A;  1Q86 U;  2VXF A;  3HFN A;  1O75 A;  2L5Q A;  2PVO B;  3JB9 G;  5AYF A;  2KDS A;  4HCC A;  2EWN A;  4C8Q B;  4JUV A;  5KE2 A;  5LJ5 e;  4M7D E;  2EQU A;  1ZQ1 A;  1KQS A;  3JB9 I;  3FDR A;  5GMK e;  1GXI E;  1Y71 A;  3JCM P;  3V7R A;  2VXE A;  3RIR A;  3CMA T;  3SD4 A;  4HT9 A;  4M7D F;  1Y96 B;  2LCC A;  3OYC A;  2O01 E;  3SWN A;  2EKO A;  4C5E A;  5KE3 A;  3FEO A;  2XKO C;  4M75 E;  2K3X A;  4L6V 5;  2YRV A;  3GNF B;  1S72 A;  1VIE A;  1VQ4 A;  3CD6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...