3K3AA

Crystal structure of b/perth neuraminidase d197e mutant in complex with oseltamivir
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
389
structure length
389
Chain Sequence
PEWTYPRLSCPGSTFQKALLISPHRFGETKGNSAPLIIREPFIACGPKECKHFALTHYAAQPGGYYNGTRGDRNKLRHLISVKLGKIPTVENSIFHMAAWSGSACHDGKEWTYIGVDGPENNALLKIKYGEAYTDTYHSYANNILRTQESACNCIGGNCYLMITDGSASGISECRFLKIREGRIIKEIFPTGRVKHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTETYLDTPRPDDGSITGPCESNGDKGSGGIKGGFVHQRMASKIGRWYSRTMSKTKRMGMGLYVKYDGDPWTDSDALALSGVMVSMEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKETWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Basis of Resistance to Neuraminidase Inhibitors of Influenza B Viruses.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Hydrolase
source organism Influenza b virus
total genus 102
structure length 389
sequence length 389
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2009-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 3k3aA00
1W8OA 1W21A 4XJ8A 4B7RA 4YZ2A 2QWKA 2BZDA 4MWLA 2QWHA 4YW2A 2W20A 4QN3A 4XMIA 4FPFA 4XOGA 1A4QA 4GZPA 1B9SA 4FOYA 1INVA 4MJVA 4NN9A 2BF6A 1Z50A 4FPHA 4CPYA 1F8DA 2AGSA 2F29A 1L7FA 2QWJA 1NCCN 2VK7A 3NSSA 3H73A 2YA6A 4MX0A 4KS2A 5B2DA 1V0ZA 4CPOA 3O9KA 2QWCA 1F8EA 4FZHA 2C4LA 4KS4A 4X6KA 1V3EA 4XMAA 3TICA 3W09A 3K37A 4HZVA 3GVKA 1NNAA 2VW0A 4K1JA 4X49A 2HT8A 2VW2A 4QN5A 4YZ1A 1F8CA 4MJUA 1F8BA 2VK6A 5M1ZA 4HZXA 1VCJA 4MZAA 4GZWA 3GVJA 2AH2A 4H53A 4XE9A 4FP3A 2YA5A 4UF7A 1INWA 4XYXA 5HUGA 4HZZA 3TIAA 1V3CA 1S0JA 4HZWA 4FPLA 4FPEA 1N1SA 4K1KA 3ALXA 2B8HA 4GEZA 3BEQA 1V3DA 2XZIA 2QWGA 1NNCA 4FQ4A 4K1IA 1NCBN 4M3MA 4SLIA 3TI5A 1MS5A 4XIKA 4WEFA 4JF7A 4X4AA 3H72A 2F10A 5F9TA 3INBA 1USRA 1S0IA 5B2CA 1Z4WA 1V0FA 4DGRA 3ALWA 3B7EA 4HIZA 1MZ6A 4QN6A 1Z4ZA 2HT5A 4Q6KA 4QNPA 2W38A 4YZ5A 1WCQA 4NC5A 4M4VA 3K36A 2F12A 3D12A 3SLIA 2X9MA 3OPZA 2HTYA 2CMLA 3H6JA 4XJWA 1KITA 4J9TA 2F0ZA 2XZJA 2HTUA 1MS4A 4WA3A 4MWUA 1WCSA 1INFA 1MS0A 4CPNA 1B9VA 1NSCA 4QN7A 2A75A 2HU0A 2XCYA 2RKCA 1NSDA 4MWWA 4CPLA 2BATA 4GB1A 5HX0A 4GZOA 4WA4A 1L7HA 2F27A 3CKZA 4XJUA 4YW3A 4B7MA 5HUNA 3CL2A 4MWRA 4I00A 1N1VA 5JYYA 4B7NA 4XILA 1INYA 1Z4YA 1XOGA 2F24A 4MWXA 4X47A 3SALA 4FPKA 3CYEA 4FOVA 2F25A 4XJ9A 4HZYA 4FVKA 1BJIA 4FOWA 2VK5A 4XHXA 4YW1A 1INGA 3GVLA 4XJQA 3O9JA 4FPCA 4H52A 1NMBN 2C4AA 4BBWA 4M4UA 1IVGA 4KS1A 1SO7A 2QWAA 2F26A 1Z4XA 1N1TA 1IVBA 2QWIA 1VCUA 3TI3A 4YW5A 3H71A 5HUKA 1V3BA 4FPJA 2HU4A 1W0OA 4YZ4A 5NN9A 2HTWA 1W1XA 4YW4A 3K39A 3TI8A 1NCAN 1EUSA 1A4GA 1A14N 2HTQA 1INXA 3JU4A 1SLIA 2F13A 4D8SA 1W8NA 4GJTA 2HTRA 4B7JA 4MWYA 5HUMA 3A72A 4WEGA 4XJRA 2F28A 1W20A 1E8UA 1V0EA 3TIBA 3K38A 1L7GA 4XJAA 2SLIA 4YZ3A 3PJQA 4FOQA 1NNBA 1DILA 2JKBA 2SILA 1NMAN 2YA8A 4KS3A 4MWVA 2VSMA 4FJ6A 2AEPA 1SNTA 1W0PA 2VWDA 4FPOB 4GDJA 4FPGA 2VW1A 4MC7A 4MZEA 1B9TA 2QWDA 4GZXA 3K3AA 1IVDA 4GDIA 2YA4A 3SILA 4KS5A 4CPMA 4MWJA 1E8VA 1MS1A 1V2IA 2QWEA 2BERA 3TI4A 1MZ5A 6NN9A 4MWQA 3SANA 4K3YA 4GZQA 2AEQA 1N1YA 4XIOA 4FP2A 2ZB6A 2YDTA 1MS8A 1XOEA 1Z4VA 7NN9A 1MR5A 4NCSA 4CPZA 2XZKA 1NCDN 3A71A 1MS9A 2QWBA 1EUUA 1NN2A 1USXA 2VVZA 2HT7A 4B7QA 1EUTA 1MS3A 2QWFA 3NN9A 3T1EA 1IVFA 2YA7A 2F11A 3B69A 2YDPA 4FPYA 1INHA 2ZB5A 1NMCA 2W5NA 4GZSA 4K1HA 1EURA 2FHRA 4M4NA 1MWEA 3D11A 1IVEA 4XHBA 4XJZA 1E8TA 4WA5A 1DIMA 2VSKA 4QN4A 1IVCA 2HTVA 1SLLA 1NSBA 3CL0A 4GZTA 2W5OA 3TI6A 2SIMA
chains in the Genus database with same CATH superfamily
1W8OA 1W21A 4XJ8A 4B7RA 3A9HA 2W8BB 4YZ2A 2QWKA 2BZDA 4MWLA 3ZGCA 4GN8A 2QWHA 4YW2A 2W20A 4QN3A 4XMIA 4ZGCA 4FPFA 2POOA 4XOGA 1A4QA 2IAPA 4GZPA 5GX4A 1B9SA 4FOYA 1INVA 4MJVA 4GN9A 4NN9A 2BF6A 1Z50A 5GX1A 4FPHA 4CPYA 1F8DA 1SUUA 2AGSA 4UOUA 2F29A 2OJHA 1L7FA 2QWJA 1NCCN 2VK7A 5GX5A 3NSSA 3H73A 2YA6A 4IQKA 4MX0A 4KS2A 5B2DA 3SOVA 2HQSA 1V0ZA 4CPOA 3O9KA 2QWCA 3II7A 4PWZA 4IYGA 5FWWA 1F8EA 2DYHA 3S8ZA 2WOZA 4FZHA 2C4LA 1NPEA 4KS4A 4O5SA 4X6KA 1V3EA 4XMAA 3V1SA 1IJQA 2ZWAA 3BYCA 3TICA 5D9CA 3ZGDA 4DG6A 3W09A 3K37A 4HZVA 2IAVA 3GVKA 5EX7A 1C9UA 1H6LA 1NNAA 2VW0A 2GVUA 4K1JA 4X49A 2HT8A 2VW2A 5D9DA 4QN5A 4ZLRA 4YZ1A 1N6EA 1F8CA 4HW6A 1ZI0A 4MJUA 4D52A 1F8BA 2VK6A 5M1ZA 4HZXA 4GN7A 1S1DA 1VCJA 4MZAA 3HLHA 1CRUA 4GNBA 4GZWA 4HHQA 3GVJA 2AH2A 2ISMA 4H53A 4XE9A 4R40A 4FP3A 4GNCA 4CH9A 2VAQA 2YA5A 1ZGKA 4UF7A 1INWA 4XYXA 5HUGA 4HZZA 3TIAA 1V3CA 1S0JA 4HZWA 4FPLA 4FPEA 5EO7A 1N1SA 5FNTA 3ALXA 4K1KA 2B8HA 3FVZA 4GEZA 5F72C 3BEQA 5CGJA 1V3DA 2XZIA 1X2RA 2QWGA 2IAUA 5FNUA 1NNCA 4FQ4A 4K1IA 1NCBN 1RWLA 4M3MA 1N6FA 5GX3A 4SLIA 2Z32A 3TI5A 3TC9A 1RWIA 1MS5A 4XIKA 4WEFA 4JF7A 2FPCA 5FNQA 4X4AA 4CHBA 1N7DA 3H72A 2F10A 2IAXA 5F9TA 3INBA 1X2JA 1USRA 1S0IA 5B2CA 1Z4WA 1V0FA 4DGRA 3ALWA 3B7EA 2DG1A 4HIZA 1MZ6A 4QN6A 1S18A 1Z4ZA 5H47A 2HT5A 3LI4A 2W8BA 3WWAA 4Q6KA 4QNPA 2W38A 4YZ5A 1WCQA 4L7BA 3AMSA 4NC5A 5D9BA 4M4VA 3K36A 2F12A 3D12A 2H2NA 3SLIA 2X9MA 4IFNX 3OPZA 2HTYA 4AGIA 2CMLA 3H6JA 5GTQA 4XJWA 1KITA 4J9TA 2F0ZA 2XZJA 1C5KA 1MS4A 2HTUA 4WA3A 4MWUA 1WCSA 1INFA 1MS0A 4CPNA 1B9VA 1NSCA 4QN7A 2A75A 2HU0A 2XCYA 2RKCA 3HLIA 1NSDA 4MWWA 4CPLA 2BATA 4GB1A 5HX0A 1POOA 4GZOA 4WA4A 3KGGA 1L7HA 2F27A 2IAOA 3CKZA 3I1CA 4XJUA 4YW3A 4B7MA 4AHAA 5HUNA 1CQ1A 3CL2A 4I00A 4MWRA 1QBIA 1N1VA 5JYYA 4N1BA 1OFZA 4B7NA 4XILA 4L7DA 1INYA 1Z4YA 5FZNA 1XOGA 2F24A 4MWXA 1E1AA 4CSDA 1U6DX 4IFLX 4X47A 3SALA 4FPKA 3P5BL 2P4OA 4ZY3A 3CYEA 3Q6PA 4FOVA 4D4UA 2F25A 1WP5A 4XJ9A 5GX2A 4HZYA 3WN7A 2IATA 4FVKA 2H2UA 1BJIA 4FOWA 3U0SA 2VK5A 4XHXA 4YW1A 1INGA 3GVLA 5FNRA 4XJQA 4O5TA 3O9JA 4FPCA 4H52A 4AGTA 2GHSA 1NMBN 3G4EA 2C4AA 4BBWA 4M4UA 1IVGA 4KS1A 3S2KA 4G3NA 5FZJA 3AMRA 1SO7A 2QWAA 3SOBB 3ADEA 2F26A 1Z4XA 1N1TA 3O4PA 4C1YB 4A0PA 1IVBA 2QWIA 1VCUA 2IASA 3TI3A 4YW5A 4D52C 2IAWA 3V65B 3H71A 5HUKA 4IN4A 2DSOA 1V3BA 4FPJA 2HU4A 1W0OA 4YZ4A 5NN9A 2HTWA 1W1XA 4YW4A 3A9GA 3K39A 3TI8A 1NCAN 1EUSA 1A4GA 1A14N 2HTQA 3Q6KA 1INXA 3JU4A 3SRGA 1SLIA 2F13A 2IARA 4D8SA 1W8NA 4GJTA 4IMBA 3L6VA 2HTRA 1CRZA 2FPBA 4L7CA 3WW9A 1V04A 4MWYA 5HUMA 4B7JA 2ZZKA 3WDZA 3A72A 4WEGA 4XJRA 2F28A 1W20A 1E8UA 1V0EA 3UC1A 3TIBA 3K38A 1L7GA 4XJAA 2SLIA 4YZ3A 3PJQA 4FOQA 1NNBA 1DILA 2JKBA 2SILA 2ZW9A 1NMAN 2G8SA 2YA8A 3HRPA 4KS3A 1IUCA 3KYAA 4MWVA 2VSMA 4FJ6A 2AEPA 3SOQA 1SNTA 4XMBA 1W0PA 2GVWA 3IAXA 2VWDA 4YY8A 4FPOB 3VNGA 1IUBA 4GDJA 3V64C 4FPGA 2VW1A 2FLUX 3DASA 4MC7A 4AH4A 4Q1UA 4MZEA 1B9TA 2QWDA 1K32A 3FW0A 3G4HA 4GZXA 3K3AA 1IVDA 3LI3A 4GDIA 1CVMA 1N6DA 1Q7FA 2YA4A 4GNAA 3SILA 4KS5A 4CPMA 4MWJA 1E8VA 1MS1A 1V2IA 2QWEA 2BERA 3TI4A 1MZ5A 2FP8A 6NN9A 4MWQA 3SANA 4K3YA 4GZQA 2IAQA 2DG0A 2AEQA 2XN4A 1N1YA 4XIOA 4FP2A 2ZB6A 2YDTA 1MS8A 1XOEA 1Z4VA 7NN9A 1MR5A 4NCSA 4CPZA 2XZKA 1NCDN 3A71A 1MS9A 2IVZA 2QWBA 1EUUA 1NN2A 4D52B 1USXA 2VVZA 2HT7A 3NO0A 4B7QA 1EUTA 5EO8A 1MS3A 2QWFA 3NN9A 3T1EA 1IVFA 3LI5A 2YA7A 2F11A 4C1YA 3B69A 2YDPA 4FPYA 1INHA 2ZB5A 1NMCA 2W5NA 4GZSA 1QLGA 2VPJA 2FP9A 4IFJA 4K1HA 1EURA 2FHRA 4M4NA 2V91A 1MWEA 3D11A 1IVEA 3DR2A 3S94A 4XHBA 4XJZA 1E8TA 3E5ZA 4WA5A 1DIMA 3VNHA 1PJXA 2QE8A 4HHOA 2GVXA 3Q6TA 2VSKA 4QN4A 4ASCA 1IVCA 5FNSA 3SREA 2HTVA 1SLLA 1NSBA 3CL0A 4JMLA 4GZTA 2W5OA 3TI6A 2SIMA 3S8VA 2GVVA
chains in the Genus database with same CATH topology
1W8OA 1W21A 4XJ8A 4B7RA 4YZ2A 2QWKA 2BZDA 4MWLA 2QWHA 4YW2A 2W20A 4QN3A 4XMIA 4FPFA 4XOGA 1A4QA 4GZPA 1B9SA 4FOYA 1INVA 4MJVA 4NN9A 2BF6A 1Z50A 4FPHA 4CPYA 1F8DA 2AGSA 2F29A 1L7FA 2QWJA 1NCCN 2VK7A 3NSSA 3H73A 2YA6A 4MX0A 4KS2A 5B2DA 1V0ZA 4CPOA 3O9KA 2QWCA 1F8EA 4FZHA 2C4LA 4KS4A 4X6KA 1V3EA 4XMAA 3TICA 3W09A 3K37A 4HZVA 3GVKA 1NNAA 2VW0A 4K1JA 4X49A 2HT8A 2VW2A 4QN5A 4YZ1A 1F8CA 4MJUA 1F8BA 2VK6A 5M1ZA 4HZXA 1S1DA 1VCJA 4MZAA 4GZWA 3GVJA 2AH2A 4H53A 4XE9A 4FP3A 2YA5A 4UF7A 1INWA 4XYXA 5HUGA 4HZZA 3TIAA 1V3CA 1S0JA 4HZWA 4FPLA 4FPEA 1N1SA 4K1KA 3ALXA 2B8HA 4GEZA 3BEQA 1V3DA 2XZIA 2QWGA 1NNCA 4FQ4A 4K1IA 1NCBN 4M3MA 4SLIA 3TI5A 1MS5A 4XIKA 4WEFA 4JF7A 4X4AA 3H72A 2F10A 5F9TA 3INBA 1USRA 1S0IA 5B2CA 1Z4WA 1V0FA 4DGRA 3ALWA 3B7EA 4HIZA 1MZ6A 4QN6A 1S18A 1Z4ZA 2HT5A 4Q6KA 4QNPA 2W38A 4YZ5A 1WCQA 4NC5A 4M4VA 3K36A 2F12A 2H2NA 3D12A 3SLIA 2X9MA 3OPZA 2HTYA 2CMLA 3H6JA 4XJWA 1KITA 4J9TA 2F0ZA 2XZJA 2HTUA 1MS4A 4WA3A 4MWUA 1WCSA 1INFA 1MS0A 4CPNA 1B9VA 1NSCA 4QN7A 2A75A 2HU0A 2XCYA 2RKCA 1NSDA 4MWWA 4CPLA 2BATA 4GB1A 5HX0A 4GZOA 4WA4A 1L7HA 2F27A 3CKZA 4XJUA 4YW3A 4B7MA 5HUNA 3CL2A 4MWRA 4I00A 1N1VA 5JYYA 4B7NA 4XILA 1INYA 1Z4YA 1XOGA 2F24A 4MWXA 4X47A 3SALA 4FPKA 3CYEA 4FOVA 2F25A 4XJ9A 4HZYA 4FVKA 2H2UA 1BJIA 4FOWA 2VK5A 4XHXA 4YW1A 1INGA 3GVLA 4XJQA 3O9JA 4FPCA 4H52A 1NMBN 2C4AA 4BBWA 4M4UA 1IVGA 4KS1A 1SO7A 2QWAA 2F26A 1Z4XA 1N1TA 1IVBA 2QWIA 1VCUA 3TI3A 4YW5A 3H71A 5HUKA 1V3BA 4FPJA 2HU4A 1W0OA 4YZ4A 5NN9A 2HTWA 1W1XA 4YW4A 3K39A 3TI8A 1NCAN 1EUSA 1A4GA 1A14N 2HTQA 1INXA 3JU4A 1SLIA 2F13A 4D8SA 1W8NA 4GJTA 2HTRA 4B7JA 4MWYA 5HUMA 3A72A 4WEGA 4XJRA 2F28A 1W20A 1E8UA 1V0EA 3TIBA 3K38A 1L7GA 4XJAA 2SLIA 4YZ3A 3PJQA 4FOQA 1NNBA 1DILA 2JKBA 2SILA 1NMAN 2YA8A 4KS3A 4MWVA 2VSMA 4FJ6A 2AEPA 1SNTA 1W0PA 2VWDA 4FPOB 4GDJA 4FPGA 2VW1A 4MC7A 4MZEA 1B9TA 2QWDA 4GZXA 3K3AA 1IVDA 4GDIA 2YA4A 3SILA 4KS5A 4CPMA 4MWJA 1E8VA 1MS1A 1V2IA 2QWEA 2BERA 3TI4A 1MZ5A 6NN9A 4MWQA 3SANA 4K3YA 4GZQA 2AEQA 1N1YA 4XIOA 4FP2A 2ZB6A 2YDTA 1MS8A 1XOEA 1Z4VA 7NN9A 1MR5A 4NCSA 4CPZA 2XZKA 1NCDN 3A71A 1MS9A 2QWBA 1EUUA 1NN2A 1USXA 2VVZA 2HT7A 4B7QA 1EUTA 1MS3A 2QWFA 3NN9A 3T1EA 1IVFA 2YA7A 2F11A 3B69A 2YDPA 4FPYA 1INHA 2ZB5A 1NMCA 2W5NA 4GZSA 4K1HA 1EURA 2FHRA 4M4NA 1MWEA 3D11A 1IVEA 4XHBA 4XJZA 1E8TA 4WA5A 1DIMA 2VSKA 4QN4A 1IVCA 2HTVA 1SLLA 1NSBA 3CL0A 4GZTA 2W5OA 3TI6A 2SIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8O A;  1W21 A;  4XJ8 A;  4B7R A;  4YZ2 A;  2QWK A;  2BZD A;  4MWL A;  2QWH A;  4YW2 A;  2W20 A;  4QN3 A;  4XMI A;  4FPF A;  4XOG A;  1A4Q A;  4GZP A;  1B9S A;  4FOY A;  1INV A;  4MJV A;  4NN9 A;  2BF6 A;  1Z50 A;  4FPH A;  4CPY A;  1F8D A;  2AGS A;  2F29 A;  1L7F A;  2QWJ A;  1NCC N;  2VK7 A;  3NSS A;  3H73 A;  2YA6 A;  4MX0 A;  4KS2 A;  5B2D A;  1V0Z A;  4CPO A;  3O9K A;  2QWC A;  1F8E A;  4FZH A;  2C4L A;  4KS4 A;  4X6K A;  1V3E A;  4XMA A;  3TIC A;  3W09 A;  3K37 A;  4HZV A;  3GVK A;  1NNA A;  2VW0 A;  4K1J A;  4X49 A;  2HT8 A;  2VW2 A;  4QN5 A;  4YZ1 A;  1F8C A;  4MJU A;  1F8B A;  2VK6 A;  5M1Z A;  4HZX A;  1VCJ A;  4MZA A;  4GZW A;  3GVJ A;  2AH2 A;  4H53 A;  4XE9 A;  4FP3 A;  2YA5 A;  4UF7 A;  1INW A;  4XYX A;  5HUG A;  4HZZ A;  3TIA A;  1V3C A;  1S0J A;  4HZW A;  4FPL A;  4FPE A;  1N1S A;  4K1K A;  3ALX A;  2B8H A;  4GEZ A;  3BEQ A;  1V3D A;  2XZI A;  2QWG A;  1NNC A;  4FQ4 A;  4K1I A;  1NCB N;  4M3M A;  4SLI A;  3TI5 A;  1MS5 A;  4XIK A;  4WEF A;  4JF7 A;  4X4A A;  3H72 A;  2F10 A;  5F9T A;  3INB A;  1USR A;  1S0I A;  5B2C A;  1Z4W A;  1V0F A;  4DGR A;  3ALW A;  3B7E A;  4HIZ A;  1MZ6 A;  4QN6 A;  1Z4Z A;  2HT5 A;  4Q6K A;  4QNP A;  2W38 A;  4YZ5 A;  1WCQ A;  4NC5 A;  4M4V A;  3K36 A;  2F12 A;  3D12 A;  3SLI A;  2X9M A;  3OPZ A;  2HTY A;  2CML A;  3H6J A;  4XJW A;  1KIT A;  4J9T A;  2F0Z A;  2XZJ A;  2HTU A;  1MS4 A;  4WA3 A;  4MWU A;  1WCS A;  1INF A;  1MS0 A;  4CPN A;  1B9V A;  1NSC A;  4QN7 A;  2A75 A;  2HU0 A;  2XCY A;  2RKC A;  1NSD A;  4MWW A;  4CPL A;  2BAT A;  4GB1 A;  5HX0 A;  4GZO A;  4WA4 A;  1L7H A;  2F27 A;  3CKZ A;  4XJU A;  4YW3 A;  4B7M A;  5HUN A;  3CL2 A;  4MWR A;  4I00 A;  1N1V A;  5JYY A;  4B7N A;  4XIL A;  1INY A;  1Z4Y A;  1XOG A;  2F24 A;  4MWX A;  4X47 A;  3SAL A;  4FPK A;  3CYE A;  4FOV A;  2F25 A;  4XJ9 A;  4HZY A;  4FVK A;  1BJI A;  4FOW A;  2VK5 A;  4XHX A;  4YW1 A;  1ING A;  3GVL A;  4XJQ A;  3O9J A;  4FPC A;  4H52 A;  1NMB N;  2C4A A;  4BBW A;  4M4U A;  1IVG A;  4KS1 A;  1SO7 A;  2QWA A;  2F26 A;  1Z4X A;  1N1T A;  1IVB A;  2QWI A;  1VCU A;  3TI3 A;  4YW5 A;  3H71 A;  5HUK A;  1V3B A;  4FPJ A;  2HU4 A;  1W0O A;  4YZ4 A;  5NN9 A;  2HTW A;  1W1X A;  4YW4 A;  3K39 A;  3TI8 A;  1NCA N;  1EUS A;  1A4G A;  1A14 N;  2HTQ A;  1INX A;  3JU4 A;  1SLI A;  2F13 A;  4D8S A;  1W8N A;  4GJT A;  2HTR A;  4B7J A;  4MWY A;  5HUM A;  3A72 A;  4WEG A;  4XJR A;  2F28 A;  1W20 A;  1E8U A;  1V0E A;  3TIB A;  3K38 A;  1L7G A;  4XJA A;  2SLI A;  4YZ3 A;  3PJQ A;  4FOQ A;  1NNB A;  1DIL A;  2JKB A;  2SIL A;  1NMA N;  2YA8 A;  4KS3 A;  4MWV A;  2VSM A;  4FJ6 A;  2AEP A;  1SNT A;  1W0P A;  2VWD A;  4FPO B;  4GDJ A;  4FPG A;  2VW1 A;  4MC7 A;  4MZE A;  1B9T A;  2QWD A;  4GZX A;  3K3A A;  1IVD A;  4GDI A;  2YA4 A;  3SIL A;  4KS5 A;  4CPM A;  4MWJ A;  1E8V A;  1MS1 A;  1V2I A;  2QWE A;  2BER A;  3TI4 A;  1MZ5 A;  6NN9 A;  4MWQ A;  3SAN A;  4K3Y A;  4GZQ A;  2AEQ A;  1N1Y A;  4XIO A;  4FP2 A;  2ZB6 A;  2YDT A;  1MS8 A;  1XOE A;  1Z4V A;  7NN9 A;  1MR5 A;  4NCS A;  4CPZ A;  2XZK A;  1NCD N;  3A71 A;  1MS9 A;  2QWB A;  1EUU A;  1NN2 A;  1USX A;  2VVZ A;  2HT7 A;  4B7Q A;  1EUT A;  1MS3 A;  2QWF A;  3NN9 A;  3T1E A;  1IVF A;  2YA7 A;  2F11 A;  3B69 A;  2YDP A;  4FPY A;  1INH A;  2ZB5 A;  1NMC A;  2W5N A;  4GZS A;  4K1H A;  1EUR A;  2FHR A;  4M4N A;  1MWE A;  3D11 A;  1IVE A;  4XHB A;  4XJZ A;  1E8T A;  4WA5 A;  1DIM A;  2VSK A;  4QN4 A;  1IVC A;  2HTV A;  1SLL A;  1NSB A;  3CL0 A;  4GZT A;  2W5O A;  3TI6 A;  2SIM A; 
#chains in the Genus database with same CATH topology
 1W8O A;  1W21 A;  4XJ8 A;  4B7R A;  3A9H A;  2W8B B;  4YZ2 A;  2QWK A;  2BZD A;  4MWL A;  3ZGC A;  4GN8 A;  2QWH A;  4YW2 A;  2W20 A;  4QN3 A;  4XMI A;  4ZGC A;  4FPF A;  2POO A;  4XOG A;  1A4Q A;  2IAP A;  4GZP A;  5GX4 A;  1B9S A;  4FOY A;  1INV A;  4MJV A;  4GN9 A;  4NN9 A;  2BF6 A;  1Z50 A;  5GX1 A;  4FPH A;  4CPY A;  1F8D A;  1SUU A;  2AGS A;  4UOU A;  2F29 A;  2OJH A;  1L7F A;  2QWJ A;  1NCC N;  2VK7 A;  5GX5 A;  3NSS A;  3H73 A;  2YA6 A;  4IQK A;  4MX0 A;  4KS2 A;  5B2D A;  3SOV A;  2HQS A;  1V0Z A;  4CPO A;  3O9K A;  2QWC A;  3II7 A;  4PWZ A;  4IYG A;  5FWW A;  1F8E A;  2DYH A;  3S8Z A;  2WOZ A;  4FZH A;  2C4L A;  1NPE A;  4KS4 A;  4O5S A;  4X6K A;  1V3E A;  4XMA A;  3V1S A;  1IJQ A;  2ZWA A;  3BYC A;  3TIC A;  5D9C A;  3ZGD A;  4DG6 A;  3W09 A;  3K37 A;  4HZV A;  2IAV A;  3GVK A;  5EX7 A;  1C9U A;  1H6L A;  1NNA A;  2VW0 A;  2GVU A;  4K1J A;  4X49 A;  2HT8 A;  2VW2 A;  5D9D A;  4QN5 A;  4ZLR A;  4YZ1 A;  1N6E A;  1F8C A;  4HW6 A;  1ZI0 A;  4MJU A;  4D52 A;  1F8B A;  2VK6 A;  5M1Z A;  4HZX A;  4GN7 A;  1S1D A;  1VCJ A;  4MZA A;  3HLH A;  1CRU A;  4GNB A;  4GZW A;  4HHQ A;  3GVJ A;  2AH2 A;  2ISM A;  4H53 A;  4XE9 A;  4R40 A;  4FP3 A;  4GNC A;  4CH9 A;  2VAQ A;  2YA5 A;  1ZGK A;  4UF7 A;  1INW A;  4XYX A;  5HUG A;  4HZZ A;  3TIA A;  1V3C A;  1S0J A;  4HZW A;  4FPL A;  4FPE A;  5EO7 A;  1N1S A;  5FNT A;  3ALX A;  4K1K A;  2B8H A;  3FVZ A;  4GEZ A;  5F72 C;  3BEQ A;  5CGJ A;  1V3D A;  2XZI A;  1X2R A;  2QWG A;  2IAU A;  5FNU A;  1NNC A;  4FQ4 A;  4K1I A;  1NCB N;  1RWL A;  4M3M A;  1N6F A;  5GX3 A;  4SLI A;  2Z32 A;  3TI5 A;  3TC9 A;  1RWI A;  1MS5 A;  4XIK A;  4WEF A;  4JF7 A;  2FPC A;  5FNQ A;  4X4A A;  4CHB A;  1N7D A;  3H72 A;  2F10 A;  2IAX A;  5F9T A;  3INB A;  1X2J A;  1USR A;  1S0I A;  5B2C A;  1Z4W A;  1V0F A;  4DGR A;  3ALW A;  3B7E A;  2DG1 A;  4HIZ A;  1MZ6 A;  4QN6 A;  1S18 A;  1Z4Z A;  5H47 A;  2HT5 A;  3LI4 A;  2W8B A;  3WWA A;  4Q6K A;  4QNP A;  2W38 A;  4YZ5 A;  1WCQ A;  4L7B A;  3AMS A;  4NC5 A;  5D9B A;  4M4V A;  3K36 A;  2F12 A;  3D12 A;  2H2N A;  3SLI A;  2X9M A;  4IFN X;  3OPZ A;  2HTY A;  4AGI A;  2CML A;  3H6J A;  5GTQ A;  4XJW A;  1KIT A;  4J9T A;  2F0Z A;  2XZJ A;  1C5K A;  1MS4 A;  2HTU A;  4WA3 A;  4MWU A;  1WCS A;  1INF A;  1MS0 A;  4CPN A;  1B9V A;  1NSC A;  4QN7 A;  2A75 A;  2HU0 A;  2XCY A;  2RKC A;  3HLI A;  1NSD A;  4MWW A;  4CPL A;  2BAT A;  4GB1 A;  5HX0 A;  1POO A;  4GZO A;  4WA4 A;  3KGG A;  1L7H A;  2F27 A;  2IAO A;  3CKZ A;  3I1C A;  4XJU A;  4YW3 A;  4B7M A;  4AHA A;  5HUN A;  1CQ1 A;  3CL2 A;  4I00 A;  4MWR A;  1QBI A;  1N1V A;  5JYY A;  4N1B A;  1OFZ A;  4B7N A;  4XIL A;  4L7D A;  1INY A;  1Z4Y A;  5FZN A;  1XOG A;  2F24 A;  4MWX A;  1E1A A;  4CSD A;  1U6D X;  4IFL X;  4X47 A;  3SAL A;  4FPK A;  3P5B L;  2P4O A;  4ZY3 A;  3CYE A;  3Q6P A;  4FOV A;  4D4U A;  2F25 A;  1WP5 A;  4XJ9 A;  5GX2 A;  4HZY A;  3WN7 A;  2IAT A;  4FVK A;  2H2U A;  1BJI A;  4FOW A;  3U0S A;  2VK5 A;  4XHX A;  4YW1 A;  1ING A;  3GVL A;  5FNR A;  4XJQ A;  4O5T A;  3O9J A;  4FPC A;  4H52 A;  4AGT A;  2GHS A;  1NMB N;  3G4E A;  2C4A A;  4BBW A;  4M4U A;  1IVG A;  4KS1 A;  3S2K A;  4G3N A;  5FZJ A;  3AMR A;  1SO7 A;  2QWA A;  3SOB B;  3ADE A;  2F26 A;  1Z4X A;  1N1T A;  3O4P A;  4C1Y B;  4A0P A;  1IVB A;  2QWI A;  1VCU A;  2IAS A;  3TI3 A;  4YW5 A;  4D52 C;  2IAW A;  3V65 B;  3H71 A;  5HUK A;  4IN4 A;  2DSO A;  1V3B A;  4FPJ A;  2HU4 A;  1W0O A;  4YZ4 A;  5NN9 A;  2HTW A;  1W1X A;  4YW4 A;  3A9G A;  3K39 A;  3TI8 A;  1NCA N;  1EUS A;  1A4G A;  1A14 N;  2HTQ A;  3Q6K A;  1INX A;  3JU4 A;  3SRG A;  1SLI A;  2F13 A;  2IAR A;  4D8S A;  1W8N A;  4GJT A;  4IMB A;  3L6V A;  2HTR A;  1CRZ A;  2FPB A;  4L7C A;  3WW9 A;  1V04 A;  4MWY A;  5HUM A;  4B7J A;  2ZZK A;  3WDZ A;  3A72 A;  4WEG A;  4XJR A;  2F28 A;  1W20 A;  1E8U A;  1V0E A;  3UC1 A;  3TIB A;  3K38 A;  1L7G A;  4XJA A;  2SLI A;  4YZ3 A;  3PJQ A;  4FOQ A;  1NNB A;  1DIL A;  2JKB A;  2SIL A;  2ZW9 A;  1NMA N;  2G8S A;  2YA8 A;  3HRP A;  4KS3 A;  1IUC A;  3KYA A;  4MWV A;  2VSM A;  4FJ6 A;  2AEP A;  3SOQ A;  1SNT A;  4XMB A;  1W0P A;  2GVW A;  3IAX A;  2VWD A;  4YY8 A;  4FPO B;  3VNG A;  1IUB A;  4GDJ A;  3V64 C;  4FPG A;  2VW1 A;  2FLU X;  3DAS A;  4MC7 A;  4AH4 A;  4Q1U A;  4MZE A;  1B9T A;  2QWD A;  1K32 A;  3FW0 A;  3G4H A;  4GZX A;  3K3A A;  1IVD A;  3LI3 A;  4GDI A;  1CVM A;  1N6D A;  1Q7F A;  2YA4 A;  4GNA A;  3SIL A;  4KS5 A;  4CPM A;  4MWJ A;  1E8V A;  1MS1 A;  1V2I A;  2QWE A;  2BER A;  3TI4 A;  1MZ5 A;  2FP8 A;  6NN9 A;  4MWQ A;  3SAN A;  4K3Y A;  4GZQ A;  2IAQ A;  2DG0 A;  2AEQ A;  2XN4 A;  1N1Y A;  4XIO A;  4FP2 A;  2ZB6 A;  2YDT A;  1MS8 A;  1XOE A;  1Z4V A;  7NN9 A;  1MR5 A;  4NCS A;  4CPZ A;  2XZK A;  1NCD N;  3A71 A;  1MS9 A;  2IVZ A;  2QWB A;  1EUU A;  1NN2 A;  4D52 B;  1USX A;  2VVZ A;  2HT7 A;  3NO0 A;  4B7Q A;  1EUT A;  5EO8 A;  1MS3 A;  2QWF A;  3NN9 A;  3T1E A;  1IVF A;  3LI5 A;  2YA7 A;  2F11 A;  4C1Y A;  3B69 A;  2YDP A;  4FPY A;  1INH A;  2ZB5 A;  1NMC A;  2W5N A;  4GZS A;  1QLG A;  2VPJ A;  2FP9 A;  4IFJ A;  4K1H A;  1EUR A;  2FHR A;  4M4N A;  2V91 A;  1MWE A;  3D11 A;  1IVE A;  3DR2 A;  3S94 A;  4XHB A;  4XJZ A;  1E8T A;  3E5Z A;  4WA5 A;  1DIM A;  3VNH A;  1PJX A;  2QE8 A;  4HHO A;  2GVX A;  3Q6T A;  2VSK A;  4QN4 A;  4ASC A;  1IVC A;  5FNS A;  3SRE A;  2HTV A;  1SLL A;  1NSB A;  3CL0 A;  4JML A;  4GZT A;  2W5O A;  3TI6 A;  2SIM A;  3S8V A;  2GVV A; 
#chains in the Genus database with same CATH homology
 1W8O A;  1W21 A;  4XJ8 A;  4B7R A;  4YZ2 A;  2QWK A;  2BZD A;  4MWL A;  2QWH A;  4YW2 A;  2W20 A;  4QN3 A;  4XMI A;  4FPF A;  4XOG A;  1A4Q A;  4GZP A;  1B9S A;  4FOY A;  1INV A;  4MJV A;  4NN9 A;  2BF6 A;  1Z50 A;  4FPH A;  4CPY A;  1F8D A;  2AGS A;  2F29 A;  1L7F A;  2QWJ A;  1NCC N;  2VK7 A;  3NSS A;  3H73 A;  2YA6 A;  4MX0 A;  4KS2 A;  5B2D A;  1V0Z A;  4CPO A;  3O9K A;  2QWC A;  1F8E A;  4FZH A;  2C4L A;  4KS4 A;  4X6K A;  1V3E A;  4XMA A;  3TIC A;  3W09 A;  3K37 A;  4HZV A;  3GVK A;  1NNA A;  2VW0 A;  4K1J A;  4X49 A;  2HT8 A;  2VW2 A;  4QN5 A;  4YZ1 A;  1F8C A;  4MJU A;  1F8B A;  2VK6 A;  5M1Z A;  4HZX A;  1S1D A;  1VCJ A;  4MZA A;  4GZW A;  3GVJ A;  2AH2 A;  4H53 A;  4XE9 A;  4FP3 A;  2YA5 A;  4UF7 A;  1INW A;  4XYX A;  5HUG A;  4HZZ A;  3TIA A;  1V3C A;  1S0J A;  4HZW A;  4FPL A;  4FPE A;  1N1S A;  4K1K A;  3ALX A;  2B8H A;  4GEZ A;  3BEQ A;  1V3D A;  2XZI A;  2QWG A;  1NNC A;  4FQ4 A;  4K1I A;  1NCB N;  4M3M A;  4SLI A;  3TI5 A;  1MS5 A;  4XIK A;  4WEF A;  4JF7 A;  4X4A A;  3H72 A;  2F10 A;  5F9T A;  3INB A;  1USR A;  1S0I A;  5B2C A;  1Z4W A;  1V0F A;  4DGR A;  3ALW A;  3B7E A;  4HIZ A;  1MZ6 A;  4QN6 A;  1S18 A;  1Z4Z A;  2HT5 A;  4Q6K A;  4QNP A;  2W38 A;  4YZ5 A;  1WCQ A;  4NC5 A;  4M4V A;  3K36 A;  2F12 A;  2H2N A;  3D12 A;  3SLI A;  2X9M A;  3OPZ A;  2HTY A;  2CML A;  3H6J A;  4XJW A;  1KIT A;  4J9T A;  2F0Z A;  2XZJ A;  2HTU A;  1MS4 A;  4WA3 A;  4MWU A;  1WCS A;  1INF A;  1MS0 A;  4CPN A;  1B9V A;  1NSC A;  4QN7 A;  2A75 A;  2HU0 A;  2XCY A;  2RKC A;  1NSD A;  4MWW A;  4CPL A;  2BAT A;  4GB1 A;  5HX0 A;  4GZO A;  4WA4 A;  1L7H A;  2F27 A;  3CKZ A;  4XJU A;  4YW3 A;  4B7M A;  5HUN A;  3CL2 A;  4MWR A;  4I00 A;  1N1V A;  5JYY A;  4B7N A;  4XIL A;  1INY A;  1Z4Y A;  1XOG A;  2F24 A;  4MWX A;  4X47 A;  3SAL A;  4FPK A;  3CYE A;  4FOV A;  2F25 A;  4XJ9 A;  4HZY A;  4FVK A;  2H2U A;  1BJI A;  4FOW A;  2VK5 A;  4XHX A;  4YW1 A;  1ING A;  3GVL A;  4XJQ A;  3O9J A;  4FPC A;  4H52 A;  1NMB N;  2C4A A;  4BBW A;  4M4U A;  1IVG A;  4KS1 A;  1SO7 A;  2QWA A;  2F26 A;  1Z4X A;  1N1T A;  1IVB A;  2QWI A;  1VCU A;  3TI3 A;  4YW5 A;  3H71 A;  5HUK A;  1V3B A;  4FPJ A;  2HU4 A;  1W0O A;  4YZ4 A;  5NN9 A;  2HTW A;  1W1X A;  4YW4 A;  3K39 A;  3TI8 A;  1NCA N;  1EUS A;  1A4G A;  1A14 N;  2HTQ A;  1INX A;  3JU4 A;  1SLI A;  2F13 A;  4D8S A;  1W8N A;  4GJT A;  2HTR A;  4B7J A;  4MWY A;  5HUM A;  3A72 A;  4WEG A;  4XJR A;  2F28 A;  1W20 A;  1E8U A;  1V0E A;  3TIB A;  3K38 A;  1L7G A;  4XJA A;  2SLI A;  4YZ3 A;  3PJQ A;  4FOQ A;  1NNB A;  1DIL A;  2JKB A;  2SIL A;  1NMA N;  2YA8 A;  4KS3 A;  4MWV A;  2VSM A;  4FJ6 A;  2AEP A;  1SNT A;  1W0P A;  2VWD A;  4FPO B;  4GDJ A;  4FPG A;  2VW1 A;  4MC7 A;  4MZE A;  1B9T A;  2QWD A;  4GZX A;  3K3A A;  1IVD A;  4GDI A;  2YA4 A;  3SIL A;  4KS5 A;  4CPM A;  4MWJ A;  1E8V A;  1MS1 A;  1V2I A;  2QWE A;  2BER A;  3TI4 A;  1MZ5 A;  6NN9 A;  4MWQ A;  3SAN A;  4K3Y A;  4GZQ A;  2AEQ A;  1N1Y A;  4XIO A;  4FP2 A;  2ZB6 A;  2YDT A;  1MS8 A;  1XOE A;  1Z4V A;  7NN9 A;  1MR5 A;  4NCS A;  4CPZ A;  2XZK A;  1NCD N;  3A71 A;  1MS9 A;  2QWB A;  1EUU A;  1NN2 A;  1USX A;  2VVZ A;  2HT7 A;  4B7Q A;  1EUT A;  1MS3 A;  2QWF A;  3NN9 A;  3T1E A;  1IVF A;  2YA7 A;  2F11 A;  3B69 A;  2YDP A;  4FPY A;  1INH A;  2ZB5 A;  1NMC A;  2W5N A;  4GZS A;  4K1H A;  1EUR A;  2FHR A;  4M4N A;  1MWE A;  3D11 A;  1IVE A;  4XHB A;  4XJZ A;  1E8T A;  4WA5 A;  1DIM A;  2VSK A;  4QN4 A;  1IVC A;  2HTV A;  1SLL A;  1NSB A;  3CL0 A;  4GZT A;  2W5O A;  3TI6 A;  2SIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...