3L2RA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2rA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2rA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2rA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2rA03
4DU3A 2ZQBA 3ZSVA 3AVFA 4EZ9A 2A1RA 4KHSA 3DLHA 1RDAA 2NLUA 3I0SA 4CHOA 1VSLA 4OVAA 2EKOA 4QAGA 3HVRA 1IKYA 3VQ7A 5HP1A 3O3FA 2YV0X 3HT3A 4CFDA 1T03A 2CKKA 2W42A 3ASKA 4EDUA 3JSMA 4DS4A 5J26A 4BACA 1S9GA 3TAPA 3KJVA 4IFYA 3KLHA 4A4HA 3E9GA 3MP8A 5IAYA 1S6PA 2Z1JA 4GW6A 3T3FA 3HPHA 2X35A 2RF2A 1RT3A 1HYSA 4KTWA 2L3RA 4QCLA 3K57A 2O4XA 3MP1A 2O4GA 2BIVA 4KB0A 1NJWA 3HPOA 3AV9A 1HQEA 3AVCA 3O8VA 4CF2A 4RW8A 4LH4A 5FDLA 4RW9A 1A5XA 2YHBA 2QKBA 3MAQA 2KZZA 3GOXA 3ZT0A 1RNHA 3L3UA 4Z0UA 5I3UA 4DTOA 4ELVA 4W5TA 2X74A 1B9FA 3HXMA 4FLUA 3V1QA 5JS2A 1NKBA 2KTQA 2OZSA 1WJRA 2WACA 4W5NA 3ME9A 1IKWA 4RW7A 4OLBA 4KFBA 4C8LA 4CJFA 2FBYA 3HJFA 3NF7A 4IUTA 1RBRA 4O44A 3KK3A 1SV5A 3V6DA 2YNHA 3ZT3A 1TAQA 2EQJA 3RR7A 2R5AA 3LANA 1OYXA 2M16A 4BE2A 3AO1A 4FLXA 4OKEA 2RI5A 2DFHA 4GMJB 4AHUA 3VQDA 2Q3SA 4DQSA 4QQGA 3L3VA 2RN2A 4BDPA 4BDZA 4W5OA 1BCMA 4KB1A 1GOCA 3U3GA 4AHSA 4KHNA 3QEXA 4FLZA 3PX0A 1X9WA 1T8EA 3HSTB 4M45A 2XY8A 2RHIA 5I42A 3P8HA 4CE9A 1ZBFA 2VG7A 3VQBA 1RDBA 4QW2A 4FJ8A 4DFMA 3HPGA 4DSKA 4DSJA 1U4BA 1NK9A 4DF4A 1X9MA 3SUPA 3HM9A 1RI0A 2E6NA 4N4GA 4IURA 1WJQA 3NNQA 4F2SA 4RG2A 4UC4A 3AVKA 1CZ9A 1LWCA 1XI1A 1VSJA 4H8KA 3ISNC 3NF6A 4DFJA 4PY5A 4CGFA 3KD5E 3P83D 3AVJA 3TI0A 2B8AA 3FEOA 4CJVA 2RJEA 2RO0A 4A4EA 1UA1A 1LWEA 1WSIA 1A5VA 1S6QA 2L8DA 3PX4A 4OPJA 4CJWA 2VG6A 3V9XA 4C5EA 1B9DA 3DLRA 2YNIA 3OJUA 2EFIA 3K5LA 1TV6A 4CJKA 2P0KA 3T1AA 1RBTA 1KVAA 2I5JA 1RBSA 3L2WA 4G1QA 3AA4A 3KLGA 1WNSA 4B08A 3VQPA 2LRQA 1A5WA 5J2QA 3SQ2A 3K58A 2MWOA 2OPSA 2YNFA 2LVMA 1UOCA 5FRNA 1WN7A 4CK2A 4KTZA 4FJGA 3HL8A 3HP9A 2OA8A 4J2EA 4F3TA 1WLJA 4CFBA 1T7PA 5CIUA 2Y1JA 4KREA 1ITGA 5FROA 3EZ5A 3KLEA 3O3HA 4HCCA 4Z02A 3MEAA 1C1CA 2XY6A 3PO4A 4QQ6A 4LY7A 3OYNA 2OZMA 2HHQA 3PO5A 3MXMA 3NE6A 4KHUA 3OYAA 4C8OA 2ETJA 4MQ3A 3OB9A 3NDKA 4FVMA 2HHTA 3M8QA 3PMTA 1MHNA 3V4IA 4PLIA 3IAYA 4E3SA 3PFSA 3D0PA 1WSEA 2R7YA 2BGGA 1K6YA 4N4HA 3ZSZA 1HMVA 1UA0A 3K5MA 1JLCA 1KTQA 3E01A 4YFUA 1ZBLA 4CIEA 4DTSA 2YKMA 2ZE2A 1RBUA 3LX7A 4A4FA 1I3AA 3AA3A 1NJXA 5JS1A 3DB4A 4CEBA 3PY8A 2JGUA 3JYTA 1L3TA 4E89A 3OMCA 4IG3A 3AVLA 4HUFA 1F21A 4CGGA 3VQ4A 3DRRA 3V1RA 4DTJA 4M3UA 4OPKA 2DIQA 3KLFA 4ELTA 1VSDA 3NGYA 3VQCA 4MFBA 4ID1A 1KHCA 5DMRA 4DTRA 3ULDA 4CHPA 4FK0A 1TKXA 3VQ9A 4CIGA 3AO3A 4M3TA 1S1XA 4O0JA 3OYMA 1OZ2A 3SQ1A 4PUOA 1I39A 4DSLA 1CXUA 3LYIA 4DSFA 1VRTA 4C5GA 5HRPA 3ZT4A 3OYLA 5D6WA 2IAJA 4N41A 4X34A 2G8HA 3AVAA 2JZ2A 4N76A 3NGZA 3O3GA 1TVRA 3T19A 2E4LA 3RR8A 3ALYA 3CFOA 1IG9A 3TABA 1TAUA 4DU4A 5M9OA 2XO7A 4AHRA 4AHTA 3C6TA 1SSFA 2F8SA 1NJZA 1QHTA 3QIPA 2P1JA 1NOZA 1RBVA 3DLBA 1YVUA 4DFPA 3IRXA 3TWHA 3LALA 2LCCA 3DLMA 2X4YA 1KLMA 4E19A 1TK8A 1ZBUA 2YHAA 1ASUA 2R57A 3H8ZA 1VSEA 3KUFA 3PUFA 4FU6A 4FM0A 2YNGA 1RTJA 4DLEA 3V9UA 4LD6A 5J1EA 3CG7A 4XIUA 3LH0A 4KRFA 4I9LA 4FJJA 4KV8A 4QOZB 1L3SA 3DLGA 1S1TA 1VSKA 3KK1A 1FK9A 3V9WA 2HHWA 4K8XA 1TK0A 1LAWA 1S5JA 1BGXT 3V9ZA 1Q9XA 4I2PA 3QO9A 4Z4HA 5KH6A 3HK2A 3G0ZA 4LSNA 4KAZA 4F4KA 4DQRA 3RMAA 4NCGA 3RRGA 1Q9YA 3TAGA 2HHXA 3SV4A 3SYZA 3F73A 1RCHA 1JLQA 2WOMA 4BWMA 4CFAA 2GUIA 2HQXA 5HBMA 2B5JA 1QS4A 4LSLA 3QIIA 2O4IA 3MEDA 1KVCA 4TSXA 5KCHA 4HHTA 2HHSA 3ZSWA 1OI1A 4ZTJA 4F3OA 3RMDA 2D9TA 4I2QA 3VQ5A 3QKJA 2K3YA 3OYBA 3M8SA 3PV8A 5C24A 2IS3A 4JRPA 4B8AB 3KLIA 3D45A 1J53A 3K5OA 2E6LA 1X1PA 3RMBA 3TAMA 1WJSA 4M41A 2HVHA 3HVTA 1DTTA 5KCOA 3O4NA 3MEVA 1C0MA 1U04A 3K2PA 2O4XB 3AVGA 3P5JA 1UAXA 4CJPA 1R0AA 4CGDA 2HMIA 1J54A 3U6FA 5CY4A 4IBNA 2X4WA 3G10A 2FBVA 5KRSA 2RKIA 2P5OA 1TK5A 3P8DA 4B8CA 4E7KA 4FJMA 2LTOA 3L2UA 3LPUA 3BGRA 3ITHA 4FK4A 1XHXA 3OQ5A 1YTUA 1KRPA 3HO1A 4OGEA 3LGFA 1LV5A 1NK8A 1VSHA 1XWLA 4E1MA 4OGCA 4CJTA 3AO2A 3B6OA 3AVMA 4FJNA 4FW2A 4M3XA 1NK7A 4B9NA 2LSNA 2F5KA 4E7IA 3S9HA 4CEAA 4DQQA 1Z26A 1XHZA 4NCBA 5KE2A 2ZD1A 1RILA 3AVBA 3SI6A 3AVHA 3DM2A 1D5AA 4CIFA 5C6SA 3VA3A 3ZT2A 4I9QA 1BQMA 4E0DA 3KD1E 1WSHA 2E6MA 1RDCA 1XC9A 3S6WA 3I8DA 4IUUA 4H4OA 3WNEA 2EQUA 3LP0A 4FJ5A 4DTMA 3SV3A 3KTQA 2A1SA 1HYZA 3LP3A 4CJLA 2LDMA 3V1OA 2EX3A 4HVJA 3ASMA 2OPRA 1KFSA 3LLRA 4M3RA 3ZSRA 4LD0A 4NS5A 2X6NA 5D6XA 1XNIA 1W0HA 3VQAA 1SKWA 1KLNA 4DSIA 5J2PA 1TGOA 2B6AA 3NFAA 5J39A 1SL2A 3NF9A 1KVBA 3QJ6A 1BQNA 4E7HA 2D0BA 3QNNA 2DFEA 4BDYA 2FBXA 4PWDA 1YTAA 3KK2A 3K5NA 2G8VA 1VK0A 3QNOA 1KSPA 3FLGA 1SL0A 1YT3A 2Z1IA 3NCIA 2BANA 2Z1HA 2RJFA 3SZ2A 3MEGA 1C1AA 2IG0A 1OZ3A 4CGIA 1N27A 4CK3A 1W9HA 1HQUA 4BWJA 4IG0A 4DWIA 4DSEA 4AHCA 3NH2A 1J9AA 3DLKA 3WNFA 4FLVA 1ZBIA 4FJHA 2RHYA 3SNNA 1FXXA 1TL3A 4PA1A 2JLEA 1QTMA 4YNQA 4M3ZA 1VSIA 5KRTA 1HNIA 3CM5A 1NK6A 2VG5A 4CRIA 3L2QA 4CGJA 5HROA 1BL3A 3WNGA 4CJEA 1LW0A 3MP6A 2RHUA 3L42A 4FCYA 5J2MA 1BIUA 4AHVA 1B92A 4ZHRA 2FC0A 3PX6A 4FJ9A 3EYZA 2G8WA 2G3RA 3IG1A 4BE0A 3OYHA 3AA5X 3CM6A 2OPPA 4CERA 4KI6A 4HUGA 1NK0A 3TAQA 2G8UA 3H6ZA 4Q5WA 4FJKA 1LW2A 1C0UA 3AO5A 2HB5A 3MEEA 1NKCA 2KFZA 3OYEA 4CEQA 4DQPA 4R5PA 2RPIA 3SJJA 2PQWA 1RTDA 3OYDA 4OVLA 4EZ6A 4DU1A 3RMCA 4F8RA 4KHYA 4DTXA 3C4SA 1JKHA 2YKNA 2X78A 2GFUA 2BE2A 4M42A 4ID5A 1N5YA 2P5GA 1EETA 4CEOA 3TANA 1VRUA 4CF0A 4KTQA 1IKXA 3HYFA 3UIQA 3NTKA 3C6UA 3U3YA 3S3MA 4CF9A 1SL1A 1T05A 4RW4A 2NUBA 3NGIA 3NF8A 3LPTA 3DOLA 4FZXC 1C0TA 2B4JA 3TR8A 3NH0A 1SUQA 3DOKA 3L8BA 3VQ6A 5SZTA 3NBPA 4CJ5A 4CEZA 1JXBA 5KTQA 4HCBA 4HTUA 4HUEA 3TARA 4CECA 3BDPA 1DLOA 2X6SA 4Y1CA 3LWLA 1HYVA 2RHZA 2GBZA 2Y1IA 1S1WA 4B9UA 2BUDA 5C25A 1HJRA 4DF8A 3QEPA 4E7JA 3IS9A 3DMJA 3B6PA 3LP1A 3OYGA 4QVZA 4OKKA 4CJ4A 4J2DA 2X4XA 1ASWA 5E41A 3MO8A 2VWJA 4RG8A 3EAEA 2QQSA 5J2NA 1X9SA 3SUNA 2E5QA 2QQRA 3OMGA 2IOCA 4CJUA 1SKSA 3CFRA 4FLWA 3LZIA 1WAFA 1VSFA 1BI4B 3PMIA 1QSYA 3VN5A 4AH9A 4W5QA 4FZZA 2BKDN 4CJ3A 3RWUA 4M3WA 5HRNA 1D9FA 4B9MA 4C8MA 4EP4A 2HHVA 4CCHA 1KFDA 4O4GA 3LWMA 3OYIA 4II1A 4CEDA 4Q0BA 3FFIA 2XK0A 3LDSA 2M0OA 1QE1A 1EXQA 1O1WA 4E1NA 2QKKA 5D3GA 3QINA 5CZ1A 1QSSA 4IKFA 4CJRA 2XDPA 1UWBA 3OA6A 4KHQA 3M9QA 3AVNA 2XY7A 3SQ4A 4B9SA 3META 1TKDA 2L89A 4FK2A 2FHDA 1ZYQA 3NH1A 4B3OA 2RJCA 2G8FA 2R58A 2PY5A 3C94A 3O4QA 4L59A 4CF8A 2GF7A 4PLLA 1Q8IA 4N56A 4M3YA 2VWKA 3LGLA 3E9FA 2D0AA 4B9TA 3SPZA 5CYMA 1S1VA 3UT1A 2IDOA 1RT5A 1JLFA 4B9LA 4DLGA 1EX4A 3CFPA 4Q5VA 2HW3A 3NAEA 3BDLA 5FRMA 4O5BA 2KQ2A 2AJQA 3TAFA 3FC3A 1ZBHA 2FBTA 4OKJA 4ELUA 2KW4A 2IGIA 1U49A 4B9WA 5SWMA 4NZGA 4W5RA 5HRSA 1N6QA 4FM2A 1S9EA 1QQCA 4IFVA 1JLEA 4JLHA 1BI4A 4FLYA 3DB3A 3THVA 3LZJA 4PL6A 1H3ZA 3V81A 1RT1A 1C1BA 4B9VA 1WAJA 2EQMA 5DK5A 4F2RA 3M8RA 1RDDA 4KO0A 1U47A 3V9SA 3MEWA 3VA0A 4A4GA 4CJQA 4JS5A 3K59A 3C95A 3NTIA 1BIZA 3QIOA 1TL1A 3MXIA 3Q1JA 3AVIA 4AILC 1G5VA 2Z1GA 2XRIA 3CQ8A 1RT6A 4N4IA 1QSLA 2K3XA 3NHGA 2HNDA 3SD4A 4DTUA 3FDRA 1WSFA 2KFNA 1Y97A 5KGWA 4B9XA 3ZT1A 4K8ZA 1IH7A 2KZMA 3RRHA 4Y1DA 4IUVA 4FXDA 1L3UA 1CZBA 4FYDA 4WE1A 3WNHA 3KIOA 4DFKA 1REVA 4CHNA 2RHXA 1C6VA 4KI4A 1BISA 4CEFA 1TKZA 4N5SA 2HNYA 4DG1A 1BHLA 4C8NA 5CZ2A 4BD3A 4DTNA 4IDKA 5C0MA 1WSGA 4NYNA 4HCZA 1D9DA 4JS4A 3QLHA 3QESA 3P1GA 3HP6A 1NK4A 4C5HA 2HNZA 3F70A 3SPYA 4CHYA 4DQIA 4Z4FA 1HPZA 4CJSA 4KHWA 5HRRA 1GOBA 1D8YA 1HRHA 4UQGA 1JL1A 4CFCA 1DTQA 3OS0A 1SKRA 2M1HA 1U48A 4FZYA 1U45A 3QETA 4FLTA 4CEEA 2DIGA 4E7LA 3QEIA 1Z25A 4J2AA 1S1UA 5HLFA 4EP5A 3OYKA 1HNVA 4Z4EA 1RT2A 1WGSA 4FL6A 3DYAA 3F9KA 4O0IA 2P51A 2PZSA 3DRPA 1WSJA 4C8KA 2D5RA 1NJYA 4FJ7A 4FJLA 3OJSA 4BE1A 4NCAA 3SQ0A 4RW6A 3OY9A 3ZSQA 3OVNA 3ZCMA 3NTHA 3A2FA 4OJRA 2XHBA 1NOYA 4Z4CA 2JTFA 1NKEA 4OLAA 2RI3A 2VYTA 4CHZA 1IKVA 1FKOA 2WONA 1RT4A 4O55A 3H08A 4Z4IA 2EHGA 4IUPA 2GV9A 3QEVA 4FM1A 2OYQA 2DAQA 4N47A 2QXFA 3S3OA 3ZEHA 4LH5A 4PQUA 3I0RA 1IO2A 4Z4GA 4DMNA 2PYLA 1G15A 4FW1A 2DY4A 2DFFA 1RTHA 4KKOA 2G8KA 3SCXA 4GY5A 1RT7A 4GVMA 2QK9A 2RI2A 3VQQA 4J2BA 3LAMA 4CESA 4KPYA 1MU2A 4QQDA 4C5IA 3UWNA 4FJIA 3OYFA 1JL2A 3LP2A 5CYQA 1J5OA 3MEUA 3AA2A 3CYMA 1L3VA 1JLAA 1JXEA 3KKSA 5KGXA 4ZTFA 2IC3A 4CF1A 4IUQA 1EP4A 3LAKA 1JLGA 5T7BA 4I7FA 2R5MA 2F8TA 3AO4A 3EY1A 1FKPA 1JLBA 2EQKA 4CK1A 1CXQA 2RJDA 1TKTA 4H4MA 3DI6A 3DRSA 2HQEA 1LAVA 4L8RB 3OYJA 1BCOA 1LWFA 1VSMA 2ITGA 2PYJA 3VQEA 2DTUA 3CEYA 2HVIA 5K14A 3PNWC 1CLQA 3VQ8A 3L2RA 4ICLA 5D6YA 3DLEA 4FJXA 1KCFA 3ZSXA 2BDPA 1GOAA 4JRQA 4CGHA 3QBYA 4CHQA 2GFAA 3SUOA 1RTIA 3SUQA 5KE3A 3TAEA 2G8IA 4DS5A 2YRVA 1ASVA 3ZSYA 3QERA 3M8PA 3OYCA 2MWPA 2OPQA 3ZSOA 1EKEA 4DTPA 3OS2A 2ATQA 5C42A 3RTVA 2D0CA 5IN1A 3QEWA 2F96A 3MECA 5EU7A 4NYFA 1L5UA 3S3NA 3KKRA 3MXJA 3OS1A 5KI6A 3L2VA 1NK5A 2HHUA 2XY5A
chains in the Genus database with same CATH superfamily
2R5ZB 2VC1A 4XH5A 1N77A 3AVFA 5HDNA 4KHSA 1R23A 5AQJA 5H2FC 1RDAA 2OPTA 3CCJQ 2LCSA 1QVGS 3JCMe 3D5RC 3DKMA 4C8QC 4H5RA 1XMXA 4OVAA 1VQLN 2WV1A 2VGMA 2MC4A 4QAGA 1LFPA 1IKYA 4OMNA 3FKIJ 3HTRA 4C2TA 3FXQA 3H3VK 3S1RJ 1UDLA 1FTTA 2K86A 2DCEA 2XVCA 2E1CA 3E19A 1VQLA 4XTVA 2YI1A 3VYSB 1UMQA 5D4RA 4D7MA 1AHDP 3JSMA 3S16J 4BBSJ 4IFYA 3SAFA 4BQAA 1SVMA 3LSRA 3MP8A 3E5XA 2EV5A 4BXFA 2RC4A 4GW6A 3ABKH 3OOPA 3D5SC 1GLLO 1N75A 2O9VA 3HPHA 5EJCA 4LLNA 1ZRCA 4MNUA 1C0FA 3LM9A 4IIOA 1X6OA 1RT3A 3FR0A 4YY3K 1BC8C 1XG1A 3DEWA 1OFCX 3I54A 5IOYA 3CCQT 2L3RA 2KMUA 3LOCA 3BCAA 3CPWP 2HF3A 5K7FA 4RCBA 3MP1A 4MEXF 4KITB 1GDTA 1YJWI 4AUXA 2CP6A 3HPOA 2D1VA 1BL0A 3AV9A 2CH4W 3KFVA 1ZA2B 4LH4A 4XMYA 2V9VA 3BG5A 4QT7A 4Z88A 4JI8K 3E1YA 4DB3A 1YHQQ 2FOWA 5GAMg 2WV0A 3CLOA 1WEFA 2A7YA 3F23A 1FSHA 1QVFA 3I5UA 4DTOA 1U06A 4D8KA 4I6MA 2P9PA 3RZDJ 3CF5F 2ATCB 1ZR2A 1H89C 2KTQA 4E7ZA 3HRTA 2OZSA 2EJ9A 3KEYA 3C0BA 4C8QG 3W2VA 4PJOE 5DUKA 3FXMA 4RW7A 2ZBKA 3FZVA 2FBYA 2ROTA 2QWLA 2XDDA 3CZ6A 4NDLA 1JTXA 1T98A 4RTZA 1OH5A 3MEXA 1RAEB 4MDXA 1EIFA 2UWMA 3CCQN 5FKOA 2ACJA 1BA0A 2HMPA 5DDGA 1EH7A 1X6GA 4HV6A 1ORKA 3N4QA 4DR4K 4R1HA 1R6RA 5D8KB 3AO1A 4XH1A 1P7JA 3CCQA 4OKEA 1YJWT 1IG7A 3E6MA 2RI5A 2M8EA 1YITT 3IH2A 4Y7NJ 4KT6A 4LDXA 4DQSA 1NG7A 1OU8A 4J7FA 4AIDA 3J81E 3F8MA 2RN2A 4W5OA 1NWKA 1BCMA 4CCMA 4IHTA 3U3GA 1MMDA 4AHSA 4KHNA 2Q2EB 4DOVA 1FT9A 4MTEA 3J7AF 1M90C 2JT1A 5L3DA 1OH6A 3PX0A 3HSTB 2V9KA 3CCLN 2XY8A 5I42A 4QVCA 1ZBFA 3HOVJ 3GEZA 3VF6A 4GO1A 1MDMB 2IRFG 1OVYA 2DEUA 3RMQA 2E1YA 2QWOA 1U4BA 4DSJA 4DF4A 3ZQLA 1G83A 3QWLA 4N4GA 1X1BA 3M1FA 1WJQA 4PJNA 2E1HA 4F2SA 4RG2A 2GWKA 2MFZA 3IL2A 4P5NA 4IRHA 4KIBA 1JJ8C 3D6RA 3X24B 5CKFA 3RPQA 4PY5A 4CGFA 2O8CA 4XRFA 3P83D 5D7UA 2B8AA 3GDQA 1U9OA 1Q1VA 4WXDA 4CJVA 1REPC 4KGVB 2RO0A 3I56I 3J81O 1UA1A 1A5VA 1YJWN 4XAXB 4DEXA 2L8DA 4R56A 1YITN 2VG6A 3V9XA 2DTZA 1Y96A 3DLRA 2YNIA 3H1QA 1V29B 1I07A 2EFIA 5AONA 4B3TK 3K5LA 4AYBN 4A62A 4CJKA 3QOPA 1Q86O 3P9IA 1YJWA 4YPRA 1YITA 4UB8C 2I5JA 3GMEA 4G1QA 5LJ5f 1YRNB 3SBTA 5GAOl 4AYBA 3ULEA 5E79C 2I2LA 1ZA1B 4BG9A 2QM3A 5HVQC 1RRSA 4G6TB 2PBDA 3KLNA 2DL8A 3R6OA 2LVMA 3M8EA 4B1WB 4FYVB 2JUGA 1IZ1A 1W2BS 4NUBA 3P31A 5FO5A 1Y39A 3MK6A 4J2EA 2BZYA 2OFKA 3G4SQ 1GXPA 3LDNA 1PUFB 3AL0C 2WSEE 4I98B 1CF7B 3HL2A 3RQIA 2KYMA 5CVUA 2CT4A 3KLEA 4BR9A 2GA1A 1IN6A 3I56T 4HCCA 5BPLA 1LVAA 1Q7YU 3FLCO 1SAUA 4JQFA 1UHSA 4B21A 3LA3A 2NOFA 1VQPQ 1ZSZA 3G71I 2JM8A 3CVSA 1VQKQ 3VYTB 1S5LC 1YXQA 2DYRH 4UUSB 4EW0A 2KL4A 1K0SA 2FX0A 2Y30A 1YIJI 3CO7C 1KD1U 3CD6I 4MQ3A 4PHTX 3NDKA 2UXNA 4FVMA 2CU7A 3M8QA 5TKYA 2LDUA 4Q5SF 2QUFA 1HK9A 3CTAA 4YPHA 5LL6S 2VPLA 5DM6L 1TBXA 5KYWA 3PFSA 1Q82U 2P9LA 1WSEA 2I8DA 4E3SA 5TISC 1X3NA 2BGGA 1K6YA 2IGNA 4IOCF 1HMVA 1UA0A 3K5MA 2M0MA 4I02A 4XSXF 2OJ2A 3E01A 4YFUA 1WEGA 1SANA 2Z9OA 5B1BH 1Y57A 1C0WA 5J3LA 5JS1A 2J4RA 2ID6A 1OYWA 3JCMc 3LCNA 1BKBA 3OS5A 5GAHP 1FBSA 1AWJA 4FYWB 3OMCA 2ZJRF 3I56N 2H1KA 4B09A 2XAGA 4JDSA 4DTJA 4EIAA 3VYRB 1G4DA 4G7OF 4M3UA 4KIGA 3NFCA 5LRSA 4OPKA 3G71T 4ELTA 1VQ9Q 3I56A 3VQCA 1RR8C 3OR1C 4UHTA 3CHWA 4OMPA 4DTRA 4ZZLA 3CD6T 3BR2A 4CIGA 3ZQHA 2YU9J 2HKXA 5LHIA 2FE3A 3I35A 1WBDA 2HHHK 5DEQA 1OZ2A 4PUOA 3EUHA 1CXUA 3LYIA 4IL6C 3G0QA 3T1HK 2Q1ZB 3UATA 4BRPA 1VRTA 4E7SA 3QOEA 1KFZA 4PKGA 2IAJA 4J9EA 4X34A 2UZKA 2G8HA 1JKQC 2RQPA 3DP7A 3AVAA 5JFRA 4S05A 2DXIA 2R7QA 3NRVA 2AK5A 3OW2P 3RR8A 4NNJA 3K4JA 1I50J 1R4NB 3TABA 1TAUA 2CZ7B 2OTJQ 2LK2A 2EFQA 3QYEA 4CCJA 5DYMA 1XSDA 3ZP5A 5BRHA 1NOZA 1RBVA 1U5TC 2HZTA 5HODA 3DLBA 3IRXA 2MYSA 4WXHA 3LALA 2FZKB 1Q86R 2X4YA 1U2VA 2RREA 3UKGA 3G71N 5K1YA 3PO2J 4KISA 5H6RA 3H8ZA 1VSEA 1FX7A 1IG8A 4A5MA 2DTRA 2COWA 3CD6N 4U87A 3WU1B 2VQCA 3CG7A 3COAC 3O6BB 4FQGA 1VQ5I 4XIUA 2VBXA 4M75G 3G71A 4NQWB 4JZ3A 3LH0A 5ILSA 3OIPA 2MA3A 2X1EA 3BZ6A 3ZEUB 1KQ8A 1LJ9A 4NL3A 1UJ8A 4QOZB 3E5UA 1HYOA 3ERMA 1ENHA 4HSBA 3QJYA 3CD6A 2HHWA 4K8XA 3K4NA 2VLAA 1K83J 3A5MC 3C2BA 2K9QA 2BE9B 2EV0A 1LAWA 1MBEA 2NNYA 1FN7A 4CZLA 4I2PA 4CVNE 4IOXA 3OYYA 4RWTA 1LEBA 2MSYA 3RMAA 1MBJA 2E7XA 5E20A 1Q1HA 2HHXA 3HHGA 1RDUA 1YX3A 3F73A 3F6OA 4RMOA 5EX5A 2QQ8A 4DV2K 4RTTA 4BRHA 4M63C 3BF3A 1V4SA 2WOMA 1U0JA 4UY8O 2VXDA 2VKNA 4CFAA 1ACMB 1QS4A 2W24A 2FSWA 2DNUA 3LAJA 1IAWA 4JK8A 5GAOr 1Q81C 3ELKA 4M9SA 3I53A 3DKYA 2K3PA 4H0PA 1WJEA 2KP6A 5FD5A 1Z7LA 5BN9A 1SFOJ 4U88A 1VQNT 2CV1A 1O3TA 2Y69H 4UB6C 3JSPA 4DOZA 2EH3A 3VQ5A 5EZGA 3SXYA 2DOFA 2K02A 4A3BJ 1ZRFA 3QKJA 4AF1A 4BUPA 4BRKA 1VQ5T 3OSVA 5C24A 2IS3A 1XCBA 5AR0A 3BG6A 1FEXA 1IV6A 2XPWA 3RIRA 2ZJPF 3D45A 4LG0B 2E6LA 2RV8A 1M3QA 2ZWHA 3RMBA 3TAMA 3Q9VA 2E88A 4YELA 4KRTA 3P39A 3D7SB 3HVTA 5F1XA 1HNXK 2XB0X 1BA5A 2FNAA 4M77A 1C0MA 4HA8A 1NGHA 3P5JA 1UAXA 4CJPA 3J7AO 2J6KA 5CY4A 1I5ZA 4KUMA 1UGRB 4JRIA 1GVDA 1R36A 3TP0A 5KRSA 3I55Q 1ATRA 2P5OA 1TK5A 5TGTA 2D4WA 1M2OA 3P8DA 5LMNK 1OH7A 2VJJA 5J47A 4FOEA 2ESNA 2KKOA 3M1CA 2LTOA 3S2WA 3L2UA 3VS6A 3BGRA 4ILJA 4XLEA 1JXMA 2KDSA 1Y64A 4JLGA 1VQNN 5J4YA 1M8VA 4ZC3A 4F52A 5DTDA 4OGEA 2EJFA 3CMEI 1U6ZA 4AD9A 2DE0X 3ERED 3OIOA 4ELZC 2JN0A 1VSHA 3EG2A 1VQ5N 4CJTA 2H6BA 3C7NA 1P2FA 4IWVA 2LP5A 3KZBA 3M58A 2EFWA 2F5KA 4CEAA 1N9RA 1VQ5A 4MZTA 2M3AA 2UUBK 1K61A 1AZGB 3PIPA 2DA1A 1LOJA 2XKOA 3DM2A 5HL7L 5AZIA 2ZNZA 4PJOB 4I9QA 2WTEA 5FJ8J 2O61A 3CJBA 4IRGA 1W4MA 4D7NA 3A8OB 1WSHA 2E6MA 1RAAB 3WTSC 1RDCA 3IH3A 4OFEA 3S6WA 2KPMA 4IUUA 4H4OA 4FJ5A 2M2EA 3X26B 1X2MA 4M7AC 1V5EA 2LDMA 1MBHA 1XMOK 1BR2A 4L6V5 3SDGA 2Q8KA 3ATVA 1B72B 3BE3A 4WFNL 3ASMA 7AT1B 1KFSA 4M3RA 1MH3A 2PLYA 2FF4A 2CGJA 3M07A 4M77F 3CMET 3RYRA 1G99A 4HF2A 5BREA 2STTA 2QWNA 3TKYA 1OEBA 2E6ZA 5LL6Z 4V19K 3BZCA 4K0KK 3VQAA 4DSIA 2JVHA 3HTVA 5JHUA 4F17A 1Q18A 4XKWA 2B6AA 4NLCA 5J39A 1VYUA 1YX5A 2PI0A 4KMUX 3UA6A 2DFEA 3UNGC 4B48A 2IPOB 1DPRA 1YI2Q 2FBXA 1WHLA 1UJYA 1W36C 2F5CA 4GXOA 3W6KB 2HSEB 3ZBDA 4F55A 1KSPA 1E17A 4GYIA 3HPWA 3ULRB 1SSHA 1OKRA 2G9WA 2LFBA 2Z1HA 4B1ZA 4HBLA 2DFUA 1FJLA 2YUOA 1GFDA 2ESWA 2K3BA 4IG0A 4DWIA 1D0ZA 1ZQ1A 3FJPA 5M1QA 3DXKB 3PNTA 2XRNA 1B8IB 3PLAA 2O8EB 4EGYA 3PIPF 2IS6A 1ZBIA 3SWNA 3AAQA 2XASA 1NGEA 3CMEN 1YF5L 4ELYC 2IVOA 5ILVA 3G6EQ 3SNNA 5IYDJ 1FXXA 1FSEA 3IHUA 2R5YA 3W2AA 1XUPO 2WB1N 1QTMA 4BHPA 2L2PA 2KVQG 3LDLA 3CMEA 1ZKGA 4YNQA 2OJED 1VSIA 4Y52J 3X28B 2LX9A 2WAQN 3FIFA 4DCHA 2W00A 1FBQA 5K7ZA 3CBMA 2D2WA 4BUGA 2WB1A 2KK4A 2K27A 4LF5K 3FF5A 1LW0A 1HR0K 4I76A 6PAXA 4E9FA 4HF1A 2P4TA 5J2MA 4O5VA 1BIUA 4L3QA 2WAQA 2NVTJ 2IJLA 4A12A 3A8HB 1ZXOA 2P6SA 2EZKA 3MWPA 2J7IA 3JCMX 3AA5X 3CM6A 2BVMA 4MDAA 3JXUA 4KN7X 2R7TA 1GHCA 2H3EB 3R0JA 4LB5A 3H6ZA 4CZZA 1LW2A 3AO5A 3VUZA 4JKAA 2RPNA 2HB5A 3MEEA 1NKCA 5BRFA 4A3IJ 1I1SA 4FX4A 3ML6A 3PFIA 3OYEA 4XOTA 3MZ8A 4J01A 2D0PA 5AQOA 4CEQA 1EQYA 2XROA 4DQPA 5LBQA 1POGA 2XHKA 2XSDC 2RPIA 1FYKA 3CCRQ 4N0BA 4ZDOA 1YQLA 4EZ6A 3WEEA 2A0FB 4VUBA 2HBJA 4F8RA 2JNGA 1KG1A 1Z9QA 3C4SA 1QW1A 3RESA 2OV7A 3TSZA 2X78A 2GFUA 4CSWA 4ID5A 3UR3C 3TO9A 3QFPA 4LGWA 2EPFA 3OR2C 4JKDA 2L0AA 4YTLA 4DUZK 2HYGD 1JHHA 3FXRA 4CGZA 3DQVC 4BJ5C 4EJTA 1B9NA 4L9JA 1BG3A 4J83A 3BOQA 2NUBA 4C92D 3CCEQ 4FZXC 2YHYA 2GQVA 3SAHA 1C0TA 2M0CA 5JLHA 2CH4A 4MFDA 3TR8A 5LJ5d 1VOMA 2QDYB 4CI0C 2CQQA 2VODA 4OMFB 2A05A 3DOKA 2A40A 3VS0A 3L8BA 4ZYAA 2KRSA 2JMCA 3A0HC 3DU5A 3A5LC 2QSHX 2R7XA 4CEZA 3AG4H 2O8KA 3ZQGA 2V7ZA 3CJNA 2CP2A 4C92A 4BROA 3THXA 2YLBA 2NOLA 4A69C 2HNIA 4OAZA 3WXIA 1HYVA 3VGLA 5C25A 3CF5L 4B1RA 4DV4K 5AQLA 5GAOq 1K9MC 4DF8A 4RB0A 3IS9A 4IF4A 3DMJA 4GLKA 1ETVA 1SAXA 4MLEA 1I5OB 3VF4A 1YOVB 3CP8A 2VWJA 3GTMJ 1DGWY 1X19A 1PCXA 1PYVA 2QQSA 5DD8A 3AHUA 5AYFA 3JW4A 4UVAA 3FXJA 1GCPA 4NXNK 2F9TA 4KUDK 3RI4A 4QTRA 5BS6A 3A02A 4RBOA 1RGIA 1KQSS 1BDGA 1FPQA 4RTVA 1AWXA 3CFRA 3I0XA 1WAFA 1XB4A 3QAHA 3TMOA 1BI4B 4X9CA 1P6RA 2V1XA 5L3CA 2Y4YA 1JJ2M 4AVPA 2BZ8A 3HYIA 1TT5B 5DM7R 1E3OC 2YWWA 1FLIA 3O1WA 1SFUA 4O6JA 2P5VA 2GOMA 4M3WA 1D9FA 2HU9A 2CRGA 3LQRA 2EYYA 4C8MA 2CW7A 3I5RA 4CCHA 3RR6A 4M3BA 4XEIA 2XDBA 1BR4A 4RLQA 3UA7A 4II1A 3JRFA 4WQ5C 4ON0A 3FFIA 4M9XA 3VW4A 4E1NA 2E2HJ 2B63J 3TU4K 4J9CA 4Q4ZF 4BGBA 4CJRA 2VT2A 3PVQA 4M77E 2XGDA 4BL0B 1FMWA 3META 4C92F 1TKDA 2OF7A 1ZYQA 4NOYA 3O9QA 2CSQA 3V8LA 1UG1A 2R58A 3PQJA 1R1UA 3ZQIA 2GF7A 2J06A 4M7DG 2W7NA 4FWPA 1LWYA 1W5CC 1ETQA 4M78D 5LFAA 4JD2A 3JCMf 3UT1A 3GTLJ 1T3VA 1RT5A 1JLFA 4B9LA 4DLGA 1EX4A 5D5WB 3SJMA 2V7YA 3HM5A 3VTHA 1ATNA 3KK7A 3VEZA 2HDCA 3K6GA 2HXIA 3PT9A 4O5BA 2JW4A 2HVSA 5J4VA 2FBTA 1RUWA 1R4MB 4D9JA 2P0PA 1U49A 3IAS2 5HLTA 2HFHA 4BC5A 1RI9A 4M78A 1M9SA 4FM2A 4IFVA 2YU3A 2P9PB 8AT1B 3WXLA 2DK3A 3BY5A 2RD1A 4PL6A 5BPMA 2F2WA 2QF7A 1C1BA 2HTJA 3K9TA 3QICA 3HZ6A 4EMHA 3A98A 2RQWA 2PJRB 1PJRA 3A1PA 4RAYA 1LEAA 1ZUKA 3V9SA 2NUPA 3EEQA 4JS5A 4Y91A 3M5AA 3NTIA 2ZMEA 1J2XA 2AP1A 1ATSA 1BIZA 4YEJA 4HZFA 3L6QA 3EZWA 3MXIA 1KG6A 2ICWG 3N5NX 3LFKA 4N4IA 2FMYA 3HRUA 1V4TA 1HBXG 2DBKA 4EM0B 2GUPA 3SD4A 1YW8A 5EF6A 4DTUA 1U6GA 3WU0A 1WSFA 3E6DA 2KFNA 2L0KA 4CH7A 1Y97A 4IJNA 1WBBA 2JRTA 1SRMA 1SVOA 3FB9A 1RC9A 4BI3A 2VONA 3RRHA 1K7AA 3O9TA 2EGEA 4Y1DA 1LCKA 2VGNA 4IOCL 1XGOA 3PJRA 3M8FA 2H8RA 4BRNA 1L3UA 2VBZA 2MCNA 5KYUB 3O4WA 4M3DA 4BRQA 1N8RO 2YG9A 2A6TA 3WNHA 4DFKA 1A31A 3TQ7P 4BYYA 4M7AD 4OF1A 1ETOA 3QDRB 4BY6C 3MAJA 1NEBA 1BU6O 5A0GA 1SD7A 1C6VA 1G6NA 3IDHA 3GXOA 4OIQF 5J8CA 1G8XA 2ZJRL 3F2KA 2QSGX 1NJIC 2HNYA 4DG1A 2KRHA 4BRAA 1FP2A 2O8CB 2VQGA 2RB6A 4IDKA 1WSGA 4NYNA 4HCZA 2TDXA 3QLHA 4M78F 1YTYA 3G1MA 1TL8A 1YJ9I 3CCVT 2L9SA 2JMAA 1NK4A 3FIWA 4C5HA 3PFYA 3F70A 4FPAA 1NKUA 3E1SA 1Y96B 4Z4FA 2VV5A 1WJDA 1HPZA 4CJSA 1LNWA 4L5EA 3TO7A 1G3WA 2CW0F 1DIZA 5HRRA 2PMZN 1UUEA 4WFAL 1HRHA 1WQ7A 4AG2C 4ZGJB 3M56A 3GP8A 2IS2A 1SKRA 4N4OB 3O9UA 3PM1A 2L4AA 2HTSA 1ESVA 1WZOA 3BEXA 2K5LA 4FZYA 2CQKA 3QETA 4AVZA 2PMZA 1EWQA 3ULEB 4AM7A 3F9MA 3LL3A 2E1NA 1TQMA 3UE5A 1AOYA 4PFPA 1M2VB 1RKWA 5IT9Z 2PTKA 2QWQA 3AT1B 4Z4EA 2EPDA 1RT2A 3LSPA 3HI0A 5AQZA 4HW0A 1K8AC 4OMZA 1AT1B 3DRPA 1WSJA 2W48A 2PBIA 2D5RA 3G25A 2NS0A 1Q81U 1TTYA 1YN8A 3CUQB 3RTRA 4NCAA 2NYXA 1EBMA 1W4SA 3OY9A 2JA8J 3X2QH 1VNDA 1YJ9T 3CCVN 3ZCMA 2V1DA 2UYTA 1G3YA 3GLXA 2DKGA 3RPUD 4XTXA 1YW9A 3F8NA 1B9MA 1IGNA 3QQAA 2XHBA 4UUTA 1ZSZB 1NOYA 1VQ4I 4CHUA 2VYTA 4CHZA 3CCVA 5KYYA 2HDDA 1IKVA 1FKOA 2QA4Q 1P4AA 5F6FA 5CKTA 3H08A 3BFMA 2QI2A 4DQ8A 2UXDK 3QEVA 4FM1A 4Z6YA 4BY1J 5LJ3h 4CYDA 4C3HJ 4IEIA 2QXFA 5KYWB 2X6OA 1MGTA 3RPUA 2EAYA 1G59A 1UTIA 2GIVA 2NOBA 4H5WA 4XLCA 2FUG2 3KCCA 1J0RA 4GY5A 2FJ1A 3K4KA 2DXUA 1O3RA 4GVMA 4U7DA 3NWSA 4HDVA 4KPYA 1MU2A 3OH9A 5KYXA 1QWEA 1QVFM 3SBGA 3FHFA 1YJ9N 5GANd 4FJIA 3LP2A 5CYQA 1IXCA 4B1XB 3BLYA 3AA2A 1I1JA 1QPIA 1MIJA 1JLAA 1HKSA 4ZN3A 4ZTFA 4EVIA 3DEEA 2CH6A 4H0TB 4XU1A 1VQ4T 2AHJB 1YJ9A 2X6XA 2EGCA 2ZJPL 4IO9F 1JLGA 3S6IA 3M0RA 1P7IA 4C92E 2ZPBB 5ICCA 1N8RR 4IZZA 1HPMA 4PFZA 1S22A 1WFWA 2DDBA 2RN7A 1CXQA 3TTFA 1SFXA 4EJUA 2DQLA 2A5XA 1BCOA 2PYJA 1MSEC 5F64A 5FLXK 2DTUA 3CEYA 5JLWA 2CREA 1UECA 4OMLA 2VQLA 2IVNA 1WQ2A 3LDOA 1RAHB 3L2RA 1ZBXA 3MKZA 1JEGA 4BR7A 3ZSXA 4CXFA 2HOAA 1K73C 3HSCA 4UV9A 2BEOA 4K42A 3SUOA 3SUQA 3A5ZB 3HC7A 4DV6K 5EG2A 4ESRA 4HPQA 1M27C 4ZDPA 3QERA 1VQ4N 3M8PA 4PZJA 2OFIA 3OYCA 1EKEA 3K2ZA 3O5ZA 5E1WA 2V51B 2ATQA 1D8JA 1J9IA 4XLFA 3VYGA 2D0CA 2K6DA 5CKEA 3QEWA 1V55H 5KPZA 3MECA 3U9ZA 1VQ4A 4P5OA 1MZBA 2COBA 5AN4A 3LM2A 3MXJA 4CZCA 3I71A 4EM1A 3L2VA 5AQFA 2ASOA 1SHFA 1JJ2S 4JKCA 3DFGA 1A04A 4JAXA 3EG3A 2NLUA 3I0SA 1KQ1A 1QQJA 5GJVB 2W10A 3BTIA 2AIRB 2FSKA 2DPPB 1QHAA 3MZHA 5EEHA 4ESFA 4RTUA 3TO6A 4DBFA 4H5TA 1R5HA 3CPWM 1AD5A 2LJ0A 5FLMJ 5BPIA 3HT3A 3MMYB 2K9GA 1L3LA 1GV2A 5E17F 1K0XA 3O8MA 5F27A 3TAPA 1S9GA 3KJVA 4IHVA 1SRLA 4A4HA 1XJWB 3R8EA 2CWEA 1TXQA 3T1YK 2VC8A 1S6PA 5AFUA 3CJTB 5HLIA 1KQSP 4C8QA 3TOBA 1AZEA 4E70A 1NG2A 3CJCA 2HBLA 1DGKN 3F21A 2RF2A 1BBZA 5JVGL 4O5FA 2E60A 3EFOB 4JI7K 1IUYA 3REBB 3Q0VA 4QCLA 1IRFA 3ESWB 4BQZA 2G7HA 3MPUB 4M78E 2BIVA 1DP7P 1BO5O 3JRIA 4LC9B 3M0PA 3O5BA 4EMKA 1Z7UA 1JI8A 4HWIA 1HQEA 3MCAB 3ABUA 2P5KA 3MN6A 5IXFA 1A5XA 5IH2A 4ENJA 2LC2A 2YHBA 3SK3A 1Y56A 2L2OA 4E6KG 3CCUQ 1Y8RB 3PIPL 4W5TA 2X74A 4PJOC 3E5QA 1BWFO 3V1QA 2F2EA 5DPKA 4OPHA 1ZGWA 3OBWA 2ED1A 4XK8E 3J8AA 1Q7YO 2P9NA 4W5NA 4B44A 1ABOA 4XLPF 1SHGA 5HOOA 2XIDA 3WHCA 3E2UA 5BQTA 2ZCWA 2JTVA 4OLBA 2M0YA 4CJFA 2HQAA 2ZAEA 3CCLQ 2MD0A 4ZZDA 4IUTA 4O44A 3SB2A 1SV5A 3H9GA 3V6DA 2LBFA 2B86A 3ZT3A 1KD1O 1YS6A 4G8XA 1TAQA 2EQJA 4P9UA 3RR7A 4LG3A 2LVSA 3SZPA 4RDUA 2M34A 4PGHA 1TP4A 1OYXA 1KC8C 1X3WB 1Q82O 2VQHA 3JCMJ 1MKMA 1KG5A 4BNCA 4A59A 2JA6J 3H9JA 4GMJB 5JI6A 3VQDA 4A4KA 2CGKA 1XPXA 2LNHB 3U2RA 2M87A 2ZSHB 4C8QF 4QQGA 4BDPA 2Z99A 1Q86C 4KB1A 1R0BG 2IVMA 2QWPA 5LJ5h 1YJWQ 1IJJA 2EJRA 2CS3A 3CCSI 4A0YA 1NGCA 1YITQ 5GAOp 4ESJA 4OU0A 1T8EA 4J9FA 2Y9ZA 1BOAA 2KXCA 3P8HA 3VERA 2VG7A 2HOTA 4J9BA 1AVZC 2OUMA 4FJ8A 3HPGA 4DSKA 3DPTA 2HOEA 5CR4A 1JRIA 2CUZA 4GYGA 3JCMV 1P92A 1ORNA 1IV8A 5CKBA 3SUPA 5GMKh 3HUGB 2F4VK 4UC4A 2DQRA 4LD5A 5LGUA 4X9DA 1CZ9A 3GTJJ 1XDSA 1D0YA 3D4VA 1XI1A 1Z3XA 3THWB 3ZYYX 1X9JA 4LF4K 4F7UG 3TI0A 4KN4X 4B3SK 2MAMA 3CC2I 2KEAA 3FEOA 1NGAA 2M4GA 1FIAA 4MO4A 2RJEA 1N33K 1N78A 1FOYA 1S6QA 1BIAA 2O7OA 2X9DA 4CJWA 1VQ8I 1PWTA 4C5EA 3JCMd 3PO3J 1J09A 1LCUA 4UVCA 1P9QC 1LMZA 1TV6A 4RAFA 1YJNI 1RFQA 3TU5A 1Z91A 1VQ6I 5B3SH 4M3FA 4JKGA 4A61A 1RBSA 3L2WA 4IHWA 3CWTA 1JCEA 1R5ID 3FXUA 2AZVA 3UPUA 1BOBA 4B08A 2LRQA 4LN2A 3K58A 2OPSA 2CV2A 2YNFA 3BG9A 4OMOA 4E9HA 4EMSA 1UOCA 4QVDA 4IPAA 4E6RA 1WN7A 1JO8A 2MD5A 5GAN7 3HM8A 4WCGA 1NPRA 4FJGA 3HL8A 2JG6A 2LTPA 2WAFA 1Z9CA 1U1TA 4XM3A 2DA9A 4C3JJ 4MZMA 4B1UB 2YRDA 3TW6A 3K1MA 2GEMA 4F3TA 4CZJA 3LSMA 2ZCFB 1T7PA 1BUPA 2ZJ2A 5CIUA 3E0JB 3THYA 3CC2T 3NVMA 5M5YJ 3EZ5A 2KGTA 3O3HA 4Z02A 5D5UB 3S2DJ 1VQMI 3MEAA 1T6CA 1VQ8T 4LE9A 3QPLA 4AFZC 2LMJA 1I4K1 2Q0OA 4EV0A 1FP1D 5GAN8 1J5YA 3MXMA 1YJNT 3NE6A 3M53A 1VQ6T 1IC8A 1T2KA 1EFNA 1E3PA 4HF0A 2HHTA 5AFUH 2K9SA 4B8XA 2DERA 1MHNA 3BTLA 1Q7YR 1M3BA 4RAZA 3J81Z 2M9UA 3UKRA 2DAOA 1ON1A 3V4IA 2FMLA 4PLIA 2KAFA 5K5OA 1QHGA 2R7YA 3ZQCA 1LUJB 4N4HA 2L7KA 1KTQA 1UZCA 1BA1A 1KD1R 3CC4Q 1X6BA 5FU7B 5LJ3j 2YSRA 3AL0B 3DLAA 3WGIA 4ZN1A 4FIBA 4DTSA 2ZE2A 4NB5A 2NOEA 3LX7A 4A4FA 3VF2A 3I4MJ 3WEEB 1ODDA 4PKIA 2F5EA 3AA3A 1HKGA 1Q82R 1WWXA 2RGVA 3DB4A 1HLVA 1S72Q 2KT8A 1QVFS 3CC2N 2LH9A 4CEBA 3CPFA 1KAZA 2JGUA 4CC4B 1L3TA 3M59A 1TLHB 2R7RA 4M75D 2FNPA 3AVLA 4HUFA 4R79A 3CO6C 1HNZK 3MD2A 3D0SA 4IHYA 5GAGP 4UNOA 3VQ4A 4CGGA 1VQMT 1FOWA 1VQ8N 2W03A 1EF4A 2MOXA 1FMKA 1X4PA 2CUDA 4KUIA 4LITA 3CC2A 5C15A 2KE9A 3OW2M 2CSIA 1W1FA 4FX0A 5KK1A 2TCTA 1T3LA 1VSDA 2JWLA 1YJNN 3ZOBA 1VQ6N 5C10A 3G1JA 1VQ8A 4RCHA 1NG9A 3R9PA 4CHPA 1TKXA 3S1MJ 3VQ9A 2VKVA 1T3SA 4B22A 2ZPGB 3NWTA 3O08A 2E71A 4M3TA 2CQ7A 1MMSA 1S1XA 3G71Q 4FSSA 3R1XA 1YJNA 4M75A 1TT0A 3NMUA 3SQ1A 1VQ6A 3R6NA 3L4IA 1T44A 4KULA 3M0QA 2QENA 3CETA 1A35A 3OYLA 2A61A 1HXDA 4M74A 4YRVA 5BPNA 2KT1A 1WX6A 3IH7A 1XG7A 1PKTA 2JZ2A 3EHQA 2P81A 4GY2B 2UV1A 4N76A 1WHMA 4C92B 3T19A 2QEXI 2MABA 3W3CA 5HLGA 5F0FA 1R49A 5GAEJ 3C6TA 3JB9D 1X3UA 3O6WA 1OQKA 1GLNA 1VQMN 4PIIA 2D6FA 3M55A 2LCCA 1VUBA 2BZTA 1KLMA 2A68F 1QZ5A 4HTLA 1FJGK 1ZHFA 3ZQQA 1ZBUA 5LRRA 1JT6A 4FU6A 1HKCA 4FM0A 4CZIA 1VQMA 3JRHA 2E5NA 3KFWX 1A6IA 3AGRA 1H88C 5GPCA 3HZJA 3EN9A 2YHWA 4I9LA 4CUGA 2EWSA 5HK3A 3R4KA 1A6QA 2VUBA 3K9KA 1RUNA 2VOPA 1YHQI 1N25A 1IDZA 1S5JA 4ENNA 2MH2A 1BGXT 3K2AA 1Q9XA 4BGDA 1HA8A 3LMMA 3GOIA 1MGQA 4Z4HA 2Q36A 4YORA 4F4KA 3S32A 4DQRA 4NCGA 2ADUA 3RRGA 2B0LA 5FLXE 2ZXHA 3TAGA 2QEXT 4DIQA 1QVGM 1RCHA 4C8QE 4J00A 1UHFA 2DA3A 4BRLA 2O01E 1MBFA 3EGDB 1RAFB 1BM9A 2GUIA 1ZQ3P 3GFLA 2HQXA 4A3DJ 4KICA 2P84A 1I27A 1S1NA 4M75F 2B5JA 2VUMJ 2GIZA 3TSUA 3QIIA 2O4IA 5AJ3K 4HHTA 2HHSA 2JVVA 4N0AC 5EC7A 1P7MA 2GTOA 4HX7A 3RMDA 3OMYA 3EGUA 2DTHA 2PVDB 3NQOA 4OB1B 4AT1B 4JHDB 2DFIA 2K3YA 3QYGB 2X4JA 3PV8A 4M4ZA 5IXBA 5DCMA 4B8AB 1X1AA 3K4MA 3KLIA 1HJDA 5ECAA 3K5OA 1VQNQ 4KNYA 2PJPA 5KAFC 3BDUA 1YHQT 4JX5A 3MQ0A 5FLXO 1SFKA 1VQ5Q 2CUEA 2KRFA 4I2OA 3TDUC 5E26A 1DTTA 1I3QJ 1ZELA 2L02A 2W4SA 3O4NA 4CI6A 1D3BB 1B4AA 3OSGA 4EGZA 1YLFA 1SD4A 1U04A 3K2PA 2O4XB 2FEIA 3QWYA 2IA0A 3ZL7C 1R0AA 4CGDA 2QEXN 1J54A 2RQQA 2EZLA 4IBNA 5AQVA 3HRMA 2V52B 3WE2A 5LJWA 4HQEA 3QO3A 3VB2A 4DK9A 1IRGA 3GCMA 4U0YA 2QEXA 4E7KA 4CZMA 4FJMA 1MH4A 5IT9E 4M78B 3ITHA 4FK4A 3K69A 1QQMA 1O7FA 2ESHA 2Y0SN 3TBIA 2RQTA 2HZDA 5DLQE 3EPZA 4HG2A 1NK8A 4BRMA 2QTDA 5GAMj 4E1MA 4ORZA 3B6OA 3CJ7A 3AVMA 1P4WA 4B6MA 2Y0SA 4FW2A 3HHTB 5D6EA 2LSNA 4E7IA 4DQQA 1YHQN 4NCBA 3Q3SA 1UGSB 5CKDA 5KE2A 5M3MJ 2ZD1A 3SI6A 2GGRA 3H45C 2AQEA 5IHNA 3DKWA 1GLAG 4CIFA 3KYLA 1MPGA 3OTOK 4BI8B 3ZT2A 1ETXA 3RMSA 1YHQA 3VSLA 1WI3A 2FPEA 1GXQA 2XIGA 2H56A 3I8DA 4NC6A 2A42A 5AQWA 3I3LA 3KTQA 3E9PA 2PN6A 3KX2A 3FM3A 2GWRA 4LFUA 1BYMA 3BT9A 3JRAA 2FVUA 1HQCA 1IXDA 3QUIA 4JJBA 5D5VB 4HVJA 1LWWA 3MKYB 5LJ5j 3RVCA 4PGGA 2X3XD 3G4SI 2OPRA 3TL4X 3LLRA 1MNMC 3ZSRA 5H1SQ 3L9FA 1AHJB 3KEOA 4V2GA 4DR1K 4LD0A 4JYKA 3RSEA 4KDPA 4ESBA 3EKSA 4U7BA 5D6XA 1K73U 2EYWA 3H3OB 4ENMA 1IN5A 5J2PA 1ZGJA 3NFAA 1I1GA 1Z1DA 1UJ0A 3R60A 1KVBA 1VQPI 4E7HA 5AQHA 5GMKj 2NOHA 1QQOA 1JTYA 2K85A 4QS7A 4PWDA 1S8NA 1U78A 3BJ6A 3KK2A 3K5NA 3M6GA 3GZ6A 4K11A 2G8VA 3TTCA 4MDWA 1Z6TA 2H8HA 4M7AB 1HOMA 2KHMA 4J8FA 2BY3A 2XI9A 2Z1IA 3NCIA 1FNNA 3SZ2A 4PCQA 4HEA2 1BW6A 1C1AA 1M5Q1 1U9NA 4CGIA 1N27A 1WIEA 5MLCQ 3I64A 2VN2A 3S2HJ 1HQUA 1M3CA 4AFUC 1W7PA 2V26A 4DSEA 2BW3B 1WSUA 1PSEA 4AHCA 4CZKA 1KG4A 3UKUB 2P9IB 1ZSZC 3JB9H 4OPAA 1J9AA 3Q7CA 1TWAJ 4CO8A 2PVGB 3DAWA 3A0BC 5E84A 1UELB 1S3XA 3KPHA 1MBGA 2XG8D 2EFOA 2Z2SB 4PKCC 1J5EK 2KISA 1IV0A 2JN6A 1VQPT 1UFMA 2L9VA 2VL8A 4EA5A 4M3ZA 2ZF5O 1QP2A 1W2BM 1S7OA 4RGSA 2PEXA 1WXBA 3CM5A 1NK6A 4II3A 4CRIA 2F5TX 3HOWJ 4R8HA 5M1OA 2E4HA 4DR3K 3WQUA 2LQNA 2RHUA 4CICA 1K9AA 3HKZN 2KSSA 4DV7K 2VE9A 1B92A 3VS1A 2FC0A 4HLXA 2JWKA 2G3RA 4A5AA 4BE0A 2DODA 4ETSA 2BE7D 4J9IA 4CERA 4KI6A 4IQJA 4HUGA 5LJ3g 3HKZA 4Q5WA 4FJKA 1NM1A 1WJAA 4UY8I 1MJ9A 3QFUA 1DGRM 2E20A 5LJ3e 1XTDA 4HVVA 5AQTA 4HVWA 2OTJI 4HT8A 4RGXA 3U1DA 2VKEA 1HDDC 2Z5UA 3Q9SA 2Y90A 4FPBA 4FTHA 3SJJA 4BXUA 1RTDA 3G4SA 3JAMK 4X6AJ 4OVLA 4DU1A 5FKNA 3EE8A 3PGGA 4JJDA 2R0QC 2XHCA 2GELA 2Y9YA 1VQPN 4JKEA 2CMPA 3REOA 3EUHC 4DTXA 5LY3A 2O5RA 2ZXWH 2XAQA 5AT1B 5EXWA 9ANTA 2C0IA 2BE2A 2YUSA 2HOSA 4M75E 1N5YA 2LY9A 1VQPA 2P5GA 2NOJB 1EETA 2JSPA 1VRUA 1K1ZA 3JRGA 3SLCA 1WPKA 2LKPA 3UIQA 1NGJA 3J7AP 3ZCOA 3OBYA 3D5LA 4RM2A 2TRTA 2WADA 4RB1A 5E3MA 3NGIA 2X3WD 3LPTA 2G0EA 3M8JA 1O3QA 4FSXA 4EQQA 3SMPA 1KC8U 1NE8A 4JKFA 1EA3A 5GAOn 1MUNA 4PDKA 1V76A 5LEKA 4KHPK 2C6YA 2OTJT 3P8BB 2KIQA 1S3JA 4RGUA 3SZGA 3H5RA 3WODF 3VMFB 3GTQJ 1FY7A 1XNRK 3FHZA 4HUEA 2R93J 2X6SA 2R4GA 4N9IA 5BR8K 3T0YA 3KZZA 4Y1CA 2AS5F 2JPCA 1WPYA 2EA4A 1QCFA 1S1WA 1WNLA 4GRIA 1WXUA 4E7JA 4HX4A 2MLGA 2EBIA 4J6WA 2DK8A 4BREA 2ZPFB 3CF2A 3I9V2 1IN8A 4RLFA 1M90R 4CJ4A 4M7DD 3VRZA 2ZFUA 2BHZA 1ASWA 3E97A 2K5CA 4RG8A 2HKOA 2ELHA 3EAEA 3CLQA 1TNTA 1QVTA 2P7VB 2NS8A 4Y33A 4Z89A 5GADP 2A6EF 3Q0WA 5D4SA 4A6DA 2DX1A 2IA2A 2E5QA 2R5ZA 1BR1A 2RMOA 3T69A 5LHHA 4CJUA 4F93B 4XN0A 2EJGA 1X27A 4DV1K 2OTJN 1VSFA 4RAGA 4M7DA 4DV3K 3JCMh 2BOLA 3PNVA 3F22A 3VN5A 3FM5A 4AH9A 1N6AA 3ZFJA 2EBPA 1CZAN 4J9GA 4F3QA 1PVEA 1N3AA 4JOMA 2QWMA 3DV8A 2OTJA 2BKDN 3HJEA 4JPBW 3IUOA 4JZ4A 3RWUA 4PJJA 2SRCA 3BW1A 3EFRA 2A08A 3CXCP 3LSGA 2IIMA 3WXKA 4EP4A 1JB0E 4RCCA 1UFFA 2DL7A 5E8IA 4L9TA 2L4MA 3CBPA 4W1UA 3LDSA 2XU8A 4YFXF 4YIFA 4DR7K 3O8HA 2QKKA 5D3GA 2FD5A 5IP6A 1JU5C 4OMYA 1PC0A 3B6AA 2XDPA 1F5TA 2FU4A 2N8GA 3T8TA 3S17J 5CQYA 2JTMA 1X69A 3K4CA 3S15J 4IEJA 5BNGA 3NH1A 4WXCA 1G3TA 3FX3A 2RJCA 2G8FA 3VGKA 3O4QA 1JHFA 4CF8A 1QZEA 1K4TA 1T33A 4PLLA 3LGLA 1QCOA 3E9FA 3BWGA 2HQ5A 3LDQA 3QU3A 4B9TA 5CYMA 2KKZA 2I10A 1QP3A 1XTAA 4PSXA 5FW9A 4EMKB 4Q5VA 3SDZA 1M4ZA 4KGZB 1TU0B 4V19S 1BBYA 1TWHJ 4A3EJ 2LQKA 5LGNA 1RPWA 4XONA 2KQ2A 3QBWA 3TAFA 3FC3A 3BP8A 3KE2A 2YSQA 3H0GJ 3IWFA 3I33A 4OKJA 3T5XA 1D0XA 4XU0A 1Q81O 2YLCA 2LYCA 5SWMA 2LD5A 1S9EA 2STWA 5J3BA 1QQCA 1YP5A 1JLEA 5DV5A 4HRIA 1N8RC 4M7DF 5GAMe 1WI9A 3E7LA 3QYBA 5HNHA 3MN7A 1K78A 2PMHA 2L7MP 4J5YA 1YI2I 2P9NB 4KBOA 2Z33A 3V81A 1HLUA 2EQMA 1V1CA 3M8RA 5FGMA 1G2HA 1XS9A 1U47A 1I0CA 4NC8A 1E0EA 3GZNB 3VA0A 4A4GA 5GP9A 2P9SA 3K59A 3MKWB 3QIOA 2MGQA 5IYCJ 5C44J 4EW4A 1Z05A 2Z1GA 4F92B 1QPMA 3ZR8X 5EDNA 1ILYA 5IP9J 2M30A 4C23A 3K7AJ 5LJ5g 1W70A 3FDRA 3CQXA 1GLFO 2O8DB 1PP7U 1WQWA 4XRSG 3BY6A 4B1VA 4YIIA 5IOZA 2BBYA 4H0VB 3VTIA 4CC2A 2KZMA 1ULYA 3G6EI 5KYNA 3IMXA 4HOBA 1MDMA 2YPRA 4IUVA 3R0AA 3ABTA 4FXDA 2H27A 3PUBA 3DCFA 2K4JA 2DL5A 1YYVA 2JUFA 5AZJB 3MWMA 2MC3A 2JTEA 2QYZA 3CBOA 4XU2A 3CXCA 2HDAA 3M3YJ 3A8LB 1YI2T 4FOIA 4A57A 5GMKe 3F0CA 4IZ9A 2D1HA 2UXXA 3LSIA 1XGNA 2ID3A 9ATCB 3V42A 1BISA 3M0TA 2ENMA 2FA5A 1BHLA 4BVPA 3BQYA 1F36A 1B07A 1PG5B 5C0MA 1R8OB 1D9DA 3D7EO 3QB0A 3I0WA 3QP5A 3GTKJ 2RNGA 3HP6A 2KI7A 2HNZA 3A5OC 2MIOA 4C0DB 3SPYA 4CHYA 4DQIA 2NLXA 3EGXA 2LMDA 3GFJA 4L9VA 1GOBA 4FYYB 1D8YA 3CCVQ 5DUIA 1DTQA 2HAXA 1CQTA 3JRCA 4A3GJ 4JKGB 3G6ET 3IV5A 3CCRI 4JLIA 3CWUA 4A63B 2GM4A 1V5FA 4BY6B 3FZHA 2DL3A 2M1HA 3A01A 1U48A 1U45A 1H9GA 4FLTA 1U8BA 4ZH4F 3HSBA 2DMUA 3TPQA 4E7LA 2HS5A 3BPXA 4J2AA 3P9CA 1USSA 1YI2N 2XHIA 2BZXA 3OYKA 1HNVA 2M51A 3L4QA 4N4NB 3V7SA 2D1XA 3TCJA 1QWFA 2DL4A 3IKVA 3PQKA 4FL6A 2E10A 2K5FA 5FD6A 3DYAA 3F9KA 3LH5A 2P51A 1YI2A 4EM2A 3A5NC 1TOVA 1PKSA 1KYWA 1YCSB 4IO8A 1NJYA 4FJ7A 2KJCA 5B5EC 4OIOF 3SQ0A 2GX9A 5HNFA 1HUXA 5FU7C 2WBNA 2ABKA 2YJEA 1F1ZA 3L0QA 3KZIC 3MMVA 1YQKA 3I4NJ 3REAB 1HD3A 3RDVA 2IIRA 1IUFA 1WYXA 3C1DA 1Q81R 4OLAA 2A5WA 2WONA 3SMSA 2R7WA 1RT4A 3SHWA 2VOOA 4RTFD 3G6EN 4RMNA 1JBMA 4Z4IA 3CCRT 2CW8A 4H5NA 4L5IA 4NHJA 2DAQA 3C6HA 2DA5A 2FQ3A 1SEUA 2LF8A 4KFCA 4ZGEB 2JPSA 3ZEHA 1EWRA 4FISA 4PQUA 3G6EA 1NZ9A 3I0RA 3H3UA 4Z4GA 4DGWB 5LHGA 1Z77A 1K6OA 4RS8A 1IREB 5D8LB 1YVNA 1X43A 1FBUA 1RAIB 4M9ZA 2L54A 1JCGA 4IFEA 3TSPA 4KKOA 5A2QK 2WUSA 1M1KC 2G8KA 3FHNA 2K4YA 3SCXA 2W82A 4GCVA 2DYIA 1N39A 2XAUA 1EJ9A 1PSFA 2E2QA 3CUOA 2P9KA 2RI2A 2OAZA 3LAMA 4C5IA 5E3LA 1KSWA 3TEDA 5GAN4 3OYFA 1JL2A 2HCKA 1MMAA 4D0PA 1PU6A 2EINH 1JKRC 1XX5A 4C92C 2WWYA 3GW2A 1M1FA 3KKSA 5DM7F 1FIPA 2IC3A 4IUQA 4QSHA 3LAKA 5T7BA 2LCLA 3E6CC 1D1AA 5F2RA 3CCRN 3CPEA 2DD4A 1YIJT 2R5MA 2F8TA 1NYGA 3V8KA 5GIOA 2DM1A 3AO4A 3EY1A 1FKPA 2CFXA 1JLBA 4NBQA 4M75B 1MWMA 4GVEA 5H20A 4K25A 3B6CA 2M7BA 3FK7A 3CCRA 4L8RB 2KT0A 1LWFA 1VSMA 3EETA 4YOQA 2VXEA 1U5SA 3HBTA 4EJVA 3L1AA 2DOAA 2L9RA 3CDIA 1CLQA 2HQNA 3A8GB 3QWXX 5CVIA 4UVBA 3WQTA 5H6QA 2HKQB 1T08B 3JAME 1S7AA 1KG3A 2KFDA 4CGHA 3C65A 2CQXA 4CHQA 2GWJA 3QODA 1XSVA 3CIPA 2NRRA 1I6XA 3G1OA 3DPLC 4CBWA 1VQ7Q 2YRVA 2F9WA 4ZYHA 3HXLA 1ASVA 2PU9B 1USTA 4M7DE 1GLJO 1C6VX 3JRZA 4NL2A 3ENOA 3RSNA 2VJ5A 2V9PA 5F08A 3D2EA 4PL7A 3ZEUA 5C42A 1D1CA 4TV7A 3CJRB 4GNIA 1YIJN 1Y6IA 3GUDA 5KPRA 5EU7A 1MA9B 1OH8A 2R7OA 3H92A 1L5UA 3EH1A 3S3NA 3KKRA 4WF2A 3OS1A 5KI6A 3JCMQ 1OKJA 1NK5A 2VIXA 1ETKA 3FBIB 4IOAL 4DU3A 5DM6F 1YIJA 1ARKA 3ZSVA 5JLXA 4EZ9A 2XGXA 1KQSM 3QZ9B 3HFNA 3DLHA 3MCZA 3JAMO 4C1NI 4DUYK 5J1RA 1OCRH 2EKOA 1B34A 5I21A 2KLAA 3HVRA 2P5LC 1LDKB 5HP1A 2OA4A 2ZNYA 2O9LA 2HNHA 3O3FA 2YV0X 4JEPA 2DTOA 2M1BA 3ZQ7A 5AIQA 4II2A 1YBYA 2BXZA 2AHQA 4CFDA 1T03A 2CKKA 3KP7A 1RABB 2NZTA 1DJ7B 3FRNA 2VE8A 1F4KA 2W57A 4DS4A 3KLHA 4I0AA 4XLAA 2XRLA 4JX6A 3QHSA 2M4KA 5ICFA 2L7ZA 5IAYA 5EG0A 1KQJA 2Z1JA 5M3FJ 3BF1A 2D8HA 2IVPA 4C1NK 4LG0A 4M77D 5HDKA 1NMNA 2X35A 1UB4A 2M02A 3JRDA 4OFAA 1KD1C 5DCMB 4W97A 4M78C 1HYSA 1UGVA 1T56A 5K5QA 3P4IA 2KR3A 4Y0WA 1R00A 3J7AY 4ZJZA 4KTWA 1ZUYA 3VEYA 3K57A 5FPEA 4J9DA 4LDWA 1Q82C 5L3FA 4U0VA 1S6LA 3PSIA 2O4GA 4KB0A 2MH9A 2QG9B 3DBHB 4XTYA 3AVCA 2IEKA 3O8VA 4RW8A 2D1KA 2F2XA 2H1LA 2KRNA 2EIJH 1SFEA 2L3DA 2QKBA 4JI6K 3MAQA 2QYOA 2MLKA 2ASMA 3V7CA 1WHHA 3HGYA 3GOXA 1HF0A 3ZT0A 4LF7K 3RKXA 4Z0UA 2Y48A 5I3UA 1BB9A 5LJVA 1NKBA 5KQ8A 4XL9A 4MO7A 1F1BB 1OULA 4JX4A 2WACA 1IBLK 2Z3YA 1WLPB 1HX1A 4AMCA 2CUBA 1IKWA 2K2VA 3GWZA 2FG0A 4EJWA 4KFBA 4C8LA 1OQYA 3NF7A 1RBRA 2F7TA 4Y15A 3OL3A 4XK4A 2BY0A 1VYVA 2DJIA 3ZPLA 4E9GA 2HL5C 4CW7B 1ZLJA 5GAHJ 4PUSA 4GKKK 2R5AA 1ZR4A 3BG3A 2UU9K 4F7UA 3LANA 2M16A 1DDNA 3KTUA 1ZUUA 3ROUA 3WVDB 2BTTA 1HKBA 4KT0E 3PIOA 4BE2A 2BY2A 3QXEB 4QPOA 3N4MA 4B9QA 4L9NA 4JI3K 4AHUA 1XC5A 2IGOA 2O8BB 1XDUA 2WA0A 3ID6A 2FEZA 2AXTC 3CDHA 4BKXA 5HKCA 4BDZA 1PD1A 2KBTA 1GOCA 3R61A 5J8FA 3QEXA 3ZMTA 2CO5A 3S1NJ 2CGHA 1SAZA 4FLZA 4EJOA 3W0LA 1OPLA 1UHWA 4A2UA 5ERIA 2HYFA 2RHIA 2MPXC 1BOTO 2EILH 1RDBA 2DD5A 1WHKA 3IHOA 4QW2A 4KH4A 1ZBSA 4DFMA 3K4BA 2JVGA 3WU2C 2EQIA 4XQ3A 1NK9A 3QYFA 1WB9A 4EHUA 2VJ4A 3RSEB 2GTJA 4X1VA 2QWWA 2FXUA 2IA1A 3AVKA 3EQLF 1Z9ZA 4HCKA 1D5VA 1LWCA 1U3EM 3MKLA 3NF6A 2A6AA 4DFJA 4NB4A 2JA2A 1ERDA 3AVJA 3F0ZA 3KETA 4ISFA 3E6BA 2V8KA 4F14A 1EV7A 2XF6A 5GANf 2OZ6A 3RCOA 2OTLI 2RVCA 4A4EA 2GLOA 3CERA 1S29A 1LWEA 1WSIA 4L5JA 3QP6A 3L2CA 2NVQJ 3BUZB 4UUVA 3PX4A 4OPJA 1K9MR 4EAHD 3OJUA 4FE4A 2DOEA 1FW6A 3A8YA 1NM7A 3JREA 4GV3A 4ZGDB 5HY6A 2P0KA 4PFOA 1SC7A 2GBQA 1K4SA 1RBTA 1KVAA 1BJAA 2ZJQL 3DXKA 4YFNF 2QSFX 3V4GA 1B8IA 2ED0A 2NOGA 3AA4A 3VYUB 1OCTC 1W6XA 1MV0B 5F0XA 1WNSA 3SDBA 3C0CA 1N3CA 4F7UF 2GNCA 1RRQA 2YX7A 3PIOF 4IVNA 1S7EA 2W41A 3KP3A 3U8XA 3D2FB 2IS1A 1DU6A 5FRNA 2E1MB 2F69A 1NJIO 5HS7A 2A07F 5EGOB 4JK7A 1O9SA 3WTWC 2EFNA 1WLJA 4CFBA 1YE9A 2OQRA 4M7AG 2Y1JA 1ITGA 3WTXC 1JKPC 3VS2A 5CE3A 2OTLT 2F4IA 3M7GA 1KO9A 4P9FA 1OX8A 4BEHB 1C1CA 2XY6A 5EVZA 4BRDA 2EZIA 4QQ6A 4LLLA 2YRCA 1MUDA 2EW3A 2J05A 2E2JJ 2OZMA 2HHQA 3M9AA 3PO5A 1VYTA 1FC3A 4H0YB 3R3LA 4M72A 1TSFA 1PHTA 4C8OA 1P90A 2ETJA 1XQSC 4H5VA 2E1ZA 3OB9A 1VQ8Q 2QBYA 3PMTA 1ZG3A 2I0NA 3ZQFA 2EB7A 3K0LA 1PVSA 2LY2A 2RKHA 1HU0A 3D0PA 1VQ6Q 1GLEG 3BROA 2DA2A 2A3ZA 3ZSZA 4TVRA 1JLCA 3OV8A 1HCRA 4AG1C 2P8TA 4V2SA 4OP0A 1K8AO 1XNQK 4FETA 4CIEA 2YUPA 1RBUA 3TTDA 3UF4A 2ZGYA 2HYJA 1LNXA 3DWLA 4KA4A 1WUAA 1NLVA 1ON2A 1TNSA 4E89A 2OTLN 4OAYA 2EYXA 4S0HB 2MG4A 2QTVA 3VJPA 2PUKB 4A3JJ 1UHCA 3V1RA 2K5IA 2PUOB 3MCPA 1QA6A 3KLFA 2HVQA 2OTLA 1V5GA 3NGYA 2CV0A 4MFBA 4H0EA 4ID1A 4Q47A 4A3LJ 3GF2A 2KJBA 1KHCA 3ULDA 2DVJA 2E35A 5J6XA 3AO3A 4M6VA 1RKTA 3BC8A 2K79A 4DYRA 4A6EA 4P1WA 5K5RA 1WI7A 1HKQA 1I39A 4DSLA 2F48A 1TG0A 1XGMA 4DSFA 5CYVA 4C5GA 2NVXJ 5D6WA 1KQ2A 2D0QB 1TYQB 1FYNA 3LSKA 3GTPJ 2OU2A 3R2XC 4EJZA 2HL3A 1GBQA 4OINF 1ZX6A 4BC2A 5LGTA 4YOVA 3K0SA 3SYTA 3O3GA 1TVRA 3S41A 3EG1A 2F4OB 4BRIA 3CFOA 1M90U 2EZHA 2CH5A 2XB5A 4P96A 4DU4A 5M9OA 2XO7A 4Z94A 2XGEA 2F8SA 1NJZA 5EEGA 4WK8F 1QHTA 3VODA 2HEOA 3CMAI 4M6YA 2MK5A 2FBIA 5JVTA 4DFPA 1J7KA 4UXNA 4YDUC 2LREA 3VOVA 4KMFA 3WHBA 3X20B 1ASUA 2R57A 3WGHA 4MDBA 3LDPA 3KUFA 2YNGA 3DBLB 4LK0F 4LD6A 3S8PA 1TWBA 2NWMA 1LPQA 4KV8A 4DQ2A 1L3SA 5F1JA 1S1TA 3KK1A 2E65A 2HPIA 3JCMg 3V9WA 3IC7A 5JR3A 4D5FA 4JP0A 3VV0A 3ZETA 3PTAA 2XPVA 1X2NA 2VQEK 5AQPA 2ZO4A 1NJIR 3CCUI 2COMA 4M7DB 2DZCA 5I22A 5A2QO 3HTSB 4BRFA 3HK2A 3H5NA 1F43A 4J19A 1UGPB 3FZKA 2AKKA 2JM9A 4HYEA 3SV4A 1K73O 4QWQA 3H3ZA 5IYBJ 2CP3A 2NAZA 3ZMSA 4RTWA 1JLQA 4EJYA 4BWMA 2OX7A 2ZFWA 5HBMA 3ZXSA 4MFEA 5GPAA 4LSLA 2JA7J 4CZFA 3CMAT 3V7RA 3CCLI 3GZ5A 4EMKC 2QEXQ 3F72A 3M57A 3MEDA 4RGRA 3H3NO 1KVCA 4TSXA 5KCHA 2CYYA 2RK2A 2NVYJ 4YOTA 1IN7A 4ZTJA 4F3OA 1MV3A 4QS8A 2FB7A 2OD5A 2D9TA 1NMDA 4XH4A 1VTNC 4LNPA 3OYBA 3M8SA 4D6WA 2ECZA 3U9DA 3VEVA 4JRPA 4WX9A 4IJAA 2WC9A 1LDDA 5J1YA 4O8KA 1XC3A 1J53A 1KU2A 1K8AR 2NS7A 3AG3H 1QBJA 4E4HA 2JMWA 2CQNA 3CCUT 2DI3A 4ATOA 5KCOA 4JBAA 1TUDA 3FK6A 1U1SA 1YITI 3MEVA 4N0AA 3WTTC 1P8ZA 4UNFA 3AVGA 2HMIA 4XBFA 1F9NA 2I5UA 2P0WA 1KG2A 2X4WA 3UB5A 3G10A 1GCQA 1A0NB 3M0UA 1MD0A 4GBQA 2W1OA 2BVLA 2HI3A 3CMAN 5C3EJ 3CCLT 4MHGA 2AZSA 1M8MA 3LPUA 2Q1NA 2W40A 1XHXA 3BTCA 2Z16A 3RJPA 4I6MB 4F7UE 2UXCK 3OQ5A 1M1KU 2QDLA 4F16A 5FFXA 3N05A 3GE1A 3CMAA 4BRGA 2GZWA 4CC3A 3LGFA 2I7NA 1K78B 1LV5A 3ZMDA 2K7AA 2PJRA 1TWCJ 1W5TA 1XWLA 4MMKA 2FF6A 3AO2A 5TJJA 3OSFA 4FJNA 1B59A 4CYCA 4A93J 4M3XA 1VZ0A 4OOIA 1JUPA 1QZZA 2BUPA 3S9HA 2NVUB 1XHZA 5DY9A 2YX4A 2P9SB 3BDDA 3CCUN 2UUAK 1RILA 2NRZA 2Q97A 5AQRA 1D5AA 1AEYA 5C6SA 3FDYA 2WY8Q 1ZYRF 2JJ9A 2NOIA 2KQRA 4X65K 2KIFA 4E0DA 2HMAA 3KD1E 3C12A 1BI0A 1IRXA 3CCUA 1KQ9A 1XC9A 2DETA 1N36K 2DN0A 4KH5A 1QO0D 3RYPA 1NGDA 3QYHB 3GFIA 2LJ1A 1T38A 3IFRA 4H4KC 3SV3A 1HYZA 3BJOA 5KYUA 3LP3A 4CJLA 5FLXZ 3H36A 4B47A 2EX3A 5C2DA 4C0DC 5GAMf 5IY5H 2KQWA 2R7SA 4FWQA 2DF6A 2AT1B 1H641 3CCLA 2PNIA 3CDLA 1MW7A 2FRWA 4B1YB 4LF6K 2PFUA 1XNIA 3RKWA 1W0HA 1SKWA 4DV5K 3GBGA 4FWSA 1TGOA 3MX2A 2W85A 2DA4A 3KP5A 3FXLA 2XF7A 2R7VA 1E2XA 2D0BA 2HZYA 2DEQA 3QNNA 1AWCA 1KC8O 4A5BA 4G7ZF 2R3SA 1NEGA 2KIMA 5DM7L 1Y8QB 1NYFA 3O9RA 1K73R 2A5YB 1VK0A 3QNOA 2JXBA 2V8JA 4JI2K 4AFSC 3JCMb 2WY7Q 3CPWA 2K9LA 2MW8A 4ENKA 2RJFA 2KRCA 2H8WA 1Z3YA 3MN2A 1ZSGA 3EGXB 2IG0A 3EYIA 3TDZC 1UCRA 3FBNB 4G12A 4HSRA 3CC4I 1O57A 2FF3B 3VU3C 1Q95G 1W9HA 4HDUA 2QZ8A 3CCMQ 2F4MB 1E3HA 1M2VA 3A01B 1QHHD 2XAFA 4PJLA 3NH2A 4Y17A 3CP2A 5J1UA 4FM4B 1S72I 5BMZA 4FLVA 1TS9A 2FPFA 3P38A 3RUXA 4JN4A 3I8BA 4BVOA 4XICA 1D8KA 4FJHA 3DKXA 1G3SA 4RTYA 2PMUA 4Z2YA 2XF5A 1TL3A 3CUQA 3SHFA 2JLEA 1VI0A 2HBKA 2O9SA 3I9QA 4JKHA 4Y28E 2OANA 2V1UA 1HNIA 3JTGA 4CZEA 1WVRA 2R7DA 3L2QA 2E2IJ 2I5WA 2L7FP 5CAIA 3TGNA 3WNGA 4CJEA 2D5VA 3MP6A 5CK9A 2LLKA 3EFSA 3AGKA 4FCYA 3FHGA 3L42A 2LZ6B 3K70C 5L23A 4FT8A 1DQUA 2I7PA 4ZHRA 4XTZA 2G8WA 3OYHA 1TQPA 4KIFA 3CC4T 1YQMA 2O0YA 3MDQA 1NK0A 2G8UA 5I9EB 2DT6A 3HRSA 3DWLE 3ASNH 3HOZJ 3FFKB 2KDZA 3DXMA 4CCNA 1S72T 2LR8A 4CBXA 2O3FA 3FE1A 2P9LB 1LOTB 2CGLA 4R5PA 1VA7A 3AG2H 5GTIC 5E8GA 2E19A 1Y0NA 4RKUE 1ZK8A 3OYDA 4IEEA 2KMTA 1ZAOA 4KHYA 4M75C 1QGPA 1ZG1A 1T39A 3HOSA 3C6AA 3K1NA 2HD0A 4LXCA 1JKHA 2DPDA 2P9KB 2YKNA 3BR5A 2DDAA 2XV4S 3GG4A 1QNTA 3EUKL 3THKA 4M42A 4A0XA 3U9GA 2VXFA 3TANA 1AKHA 1OPCA 4KTQA 3CWAA 1HJOA 3HYFA 3NTKA 3H1VX 3U3YA 1IBMK 2NRWA 3NARA 3S3MA 5GINA 2IW5A 4Y4RA 2HVRA 1SL1A 2DVEA 1T05A 4ITVA 4RW4A 3DU6A 3CC4N 1WH5A 2H6CA 4M6XA 1ITYA 2O8FA 4B43A 3VPZA 4OIPF 2P9UA 1AA7A 1ETWA 3TQNA 3BY7A 1RI7A 1LQ1A 1K4US 2HGCA 3CC4A 1KK7A 1S72N 1SUQA 4QPQA 4DW6A 4BAYA 1AU7A 1JUSA 2ITMA 5SZTA 4DEYA 4CJ5A 1R59O 3L1PA 2KHOA 4F91B 1MMNA 1JXBA 4DBHA 4HCBA 1D4XA 4HTUA 1KC8R 1S72A 4CECA 3BDPA 2ABLA 1OR7C 4FT2A 4WYBA 2RHKA 3LWLA 1OLTA 4C3IJ 2RHZA 2GBZA 2Y1IA 4CCOA 2BUDA 4F9OA 2PX9A 3I4PA 3LL7A 2FSNA 1HJRA 4AM6A 4Y13A 1DEJA 1E3MA 1GBRA 5D5XB 4FL9A 3JV3A 3B6PA 3LP1A 4KGXB 2ECBA 4QVZA 4I01A 4OKKA 1VQNI 1VQLQ 4CD1A 2QQBA 2X4XA 5DCFA 3VFZA 4LF8K 3MO8A 1KGSA 3CXCM 4LIVA 4BQLA 2QLZA 3PVLA 4JRKA 1U2VB 5J2NA 4OMMA 2J5OA 3D2EB 2IP2A 2K4BA 2DMOA 4BS9A 1X9SA 3QDKA 3MX5A 2WTUA 2QQRA 2MI6A 3OMGA 1R0CB 2CZ1B 1DKGD 2X1DA 1Z6RA 4FWOA 1SKSA 3ZX2A 4FLWA 3LZIA 1W0TA 3LA2A 3PMIA 4EA4A 1FYMA 5GMKm 2V4JC 1WJFA 4IHSA 3DTKA 4W5QA 3GBQA 3CWSA 2E64A 1OPKA 1X2KA 4FZZA 1GUUA 4B3AA 2CP0A 4JKBA 2JSCA 3KP4A 1B34B 5HRNA 3LSTA 1WJ5A 1SEMA 1HDPA 2XSJC 2H3JA 1KFDA 4O4GA 4C8QD 4WQ4C 3LWMA 2CP5A 3DF8A 2J6FA 4CEDA 4JJCA 2M0OA 3QSUA 4CC7A 1EXQA 4A3KJ 3B73A 5M5XJ 2D0NA 5DLOA 1GLBG 3QINA 3HHHA 5CZ1A 3SAGA 2ZM6K 1QSSA 4XR6A 4IKFA 1ZGAA 4FT4A 4KHQA 5AQNA 3JB9G 3AVNA 5EG0B 3SQ4A 2Y2ZA 5E1ZB 2L89A 2DT7B 4ZNXA 4K41A 2NRHA 3LAPA 3EFOA 3C94A 1UEBA 1QVGP 4GV6A 4Q48A 4N56A 4M3YA 3P7NA 2VWKA 3KEQA 3BCBA 1RLPC 5LJ3d 2P4RA 1I5LA 4PJMA 3OGDA 2D0AA 1SPKA 3GIBA 4A0ZA 5I2SA 2LT4A 2IDOA 1EO1A 3T7ZA 3CFPA 4IX7A 5IHKA 3NAEA 2K7LA 2W04A 1CGPA 4M77B 3CCQQ 2Q0RA 2LQ8A 2QKMB 4D8DA 5HS8A 2NUZA 4XTWA 4XORA 5FRMA 3FZMA 3M3ZA 3CC7I 2JOYA 3LQQA 2X85A 1ZBHA 4LDVA 4ELUA 5CJ9A 4XRSA 3K1PA 4B9WA 4EFHA 3PIOL 3WUHA 3CQYA 2DW4A 4RA2A 3RZOJ 2A69F 4NZGA 3OW2A 3M4YA 1N6QA 1YQRA 4BR4A 1OU9A 4JLHA 1LWVA 1BI4A 5EYRA 3H0IA 3DB3A 2IBDA 2A3SA 2NRAC 3THVA 3LZJA 1H3ZA 5I2MA 2YT6A 4FSVA 3ISPA 1KXPA 3WG9A 2F2VA 4Y92A 4CCKA 4B9VA 1VQNA 2O03A 2OQGA 4F2RA 2DO7A 5CR2A 3SZTA 2OC6A 1RDDA 3QRFF 4KO0A <