3LDYA

An extraordinary mechanism of dna perturbation exhibited by the rare-cutting hnh restriction endonuclease paci
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
142
structure length
142
Chain Sequence
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKATFLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGYSPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
pubmed doi rcsb
molecule keywords restriction endonuclease PacI
molecule tags Hydrolase/dna
source organism Pseudomonas alcaligenes
total genus 48
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.220 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Herpes Virus-1 3ldyA00
3M7KA 3LDYA
chains in the Genus database with same CATH superfamily
4F1PA 2NAAA 2E6RA 4BBQA 4WA6A 5LCWB 3LRQA 2JUNA 4LADB 2YSJA 1RMDA 2YURA 1F62A 2LQ6A 4R7EA 2YU4A 2KYUA 4Z0RA 1WEVA 4AP4A 5G04B 3DWDA 1MM2A 1XWHA 4GNFA 2EA6A 3EB5A 3N9LA 2ECGA 4AYCB 3ZPV1 1X4JA 5FEYA 5B76A 2YHOA 2C2VS 4GB0A 4B7YC 4CA1A 1WENA 1G25A 4UP0A 3LVQE 4XI1A 2G43A 3SOWA 1LDKC 3RTRB 5TRBA 3SOUA 2VJFB 3L1XA 2MD7B 2ECJA 3O33A 3KV5A 2F6NA 2DSMA 2D8UA 4C9ZA 2I50A 1T1HA 3T7LA 4A4CA 2KFTA 4LK9A 2JRJA 2ECVA 2JMJA 4N3WA 5AIUA 4LKAA 2OWAA 2VPGA 2K16A 3RPGB 5C11A 2E61A 4YAXA 1WEOA 2JM3A 2CSVA 3U5NA 2L7PA 3LQHA 4MVTA 2FFWA 4YBSA 5I3LA 4WZ0A 2Y1MA 2VPBA 4A4BA 4P5OB 4OGCA 5D1KB 5D1LB 2RI7A 3L11A 4WZ3B 3FAOA 2ECTA 2AN6A 3O70A 2XP0A 4A49A 4YABA 2ECNA 2K17A 2XOZA 2CSYA 3KQIA 2CKLA 4QQ4A 4R8PK 2ECIA 2C2LA 5KH7A 2G45A 5JG6A 1JM7A 2XEUA 5TBNA 3SUBA 2LGVA 2Y43A 5K3QA 4L58A 4AVXA 2FSAA 3U5PA 4I7BA 2L5UA 2F6JA 2EGPA 3N9PA 4S3OB 3N9NA 4FO9A 4B86C 1X4IA 2VJEA 2EGMA 3FEHA 1ZBDB 4UI9B 2PNXA 2M3HA 4FJCA 2L80A 5SVYA 3T9KA 1VYXA 4MSXA 1WEPA 5H9MA 4F52B 5H1UA 2UZGA 2F42A 4R2YA 3GL6A 1WE9A 3MDBC 5DINA 2EXUA 1FBVA 3LVRE 5G0FA 2LN0A 1Z2QA 2LXHC 2MNYA 3RPGC 2CRWA 3H7HA 5SVXA 3L1ZB 3O37A 1CHCA 1MM3A 2MT5A 1K2FA 2LV9A 1JOCA 3MHSA 3GV4A 2LRIC 3PHDA 5SVIA 1WGMA 2KIZA 5AITA 2DJAA 4Q6FA 2VPEA 4L7XA 1Z60A 2JMIA 3HCSA 4FK5A 1MBMA 4AUQB 3FL2A 3V43A 4YATA 2LAUA 2CKLB 3HTKC 3DPLR 5B75A 2VP7A 1U6GB 2YQLA 5B77A 1WIMA 1JM7B 2KREA 5D1MB 2YT5A 3O36A 1X4UA 4WZ2A 1Z6UA 4YADA 2YHNA 1V87A 4S3OC 4ZUXU 2YREA 2VNFA 2OXQC 2VJEB 4UP5A 5LKTA 4TKPB 3FM8C 5TDRA 1DVPA 2RR4A 2XOYA 3EB6A 2MNZA 3M99A 2FD4A 4LJNA 1IYMA 4LLBA 5B78A 2YQMA 5J3XA 1VD4A 5EYAF 2QIZA 3KNVA 4W4UA 5LKZA 5DKAA 5SVIB 4YBMA 2IQJA 3M62A 3M7KA 3U5MA 3HCTA 2KWKA 3ZNIA 2Y1NA 3DQVR 3KDEC 4O64A 2YUCA 1HYIA 3O35A 3PUQA 2K1JA 2XOCA 4YC9A 2L0BA 2E6SA 2LGLA 3LJUX 5B8DA 5KH9A 3SHBA 2YYRA 2H0DA 4H9DA 2CT2A 3ZYQA 5B79A 4X3GA 2KWNA 2M85A 2HYED 5G05B 2IDAA 2YVRA 2P57A 1WILA 3ASLA 3E2DA 1WEUA 1HYJA 1E4UA 2LGGA 5TDWA 3Q1DA 3NG2A 1WESA 3M63A 1DCQA 3O47A 4CCGX 2QICA 2MKEA 2EODA 2BAYA 3LQIA 3C5KA 2KE1A 1WEEA 5TABA 5H1TA 2ZETC 4OGEA 2KWOA 3JUEA 5LKXA 4ZDTA 2FUUA 1N87A 2KGIA 2KKXA 4FIPA 4PPEA 2CRRA 2KKYA 2MIQA 2G6QA 2JMDA 3N9QA 4GNEA 2MA5A 4Z0OA 4QF3A 2B0OE 3PLWA 4O62A 3PURA 2M6MA 5FERA 3HCUA 3O34A 3DDTA 3KV6A 1WEQA 2D8SA 1WFKA 4V3LC 2PUYA 2LGKA 4GNGA 2KU3A 4ZQLA 1LDJB 2CSZA 4YBTA 4BHWA 3ZVYA 4N4FA 2LXPC 4PTBA 2KWJA 2KR4A 3QZVA 4V3KC 3T6RA 3ZTGA 3IHPA 4AYCA 2L43A 3SOXA 2FUIA 2ECWA 2CONA 1BORA 2MUMA 2L75A 2H0DB 2K4DA 2YW8A 3FANA 1FP0A 2YSMA 1VFYA 3FJUB 5KH3A 2VPDA 4IC2A 4QF2A 4A0CD 4I7DA 5C13A 3I2DA 3ZVZB 2VJFA 3N9OA 3O7AA 3U5OA 5FB1A 3N9MA 5H1VA 3LQJA 2MD8C 3VK6A 4GNDA 2DX8A 2M1RA 4I7CA 3LDYA 1WEWA 2XB1A 2QJ0A 2MA6A 3ZPVE 2LDRA 3MHHA 2HDPA 2M13A 5FB0A 2KGGA 1WEMA 3C6WA 4IC3A 2RSDA 4NN2A 5LKUA
chains in the Genus database with same CATH topology
4F1PA 3FM8C 3KDEC 4OGEA 4OGCA 2CONA 3JUEA 5K3QA 2D8UA 2RR4A 3MDBC 2XOYA 2YVRA 2P57A 2JUNA 2KKXA 5SVIA 3FJUB 2CRRA 2EXUA 2KKYA 3E2DA 3LDYA 2DJAA 2XP0A 3LVRE 3LVQE 2OWAA 2XOCA 2XOZA 4Z0OA 5SVIB 2FD4A 2E61A 2M13A 2EGMA 3FEHA 2B0OE 4QQ4A 3PLWA 2JM3A 2CSVA 2IQJA 3Q1DA 4O62A 3LJUX 4Z0RA 2YREA 3M7KA 1DCQA 2CRWA 2L7PA 3H7HA 3O47A 5SVXA 3DWDA 5SVYA 2FFWA 2LAUA 2MKEA 3T9KA 4H9DA 3SUBA 3DDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M7K A;  3LDY A; 
#chains in the Genus database with same CATH topology
 4F1P A;  2NAA A;  2E6R A;  4BBQ A;  4WA6 A;  5LCW B;  3LRQ A;  2JUN A;  4LAD B;  2YSJ A;  1RMD A;  2YUR A;  1F62 A;  2LQ6 A;  4R7E A;  2YU4 A;  2KYU A;  4Z0R A;  1WEV A;  4AP4 A;  5G04 B;  3DWD A;  1MM2 A;  1XWH A;  4GNF A;  2EA6 A;  3EB5 A;  3N9L A;  2ECG A;  4AYC B;  3ZPV 1;  1X4J A;  5FEY A;  5B76 A;  2YHO A;  2C2V S;  4GB0 A;  4B7Y C;  4CA1 A;  1WEN A;  1G25 A;  4UP0 A;  3LVQ E;  4XI1 A;  2G43 A;  3SOW A;  1LDK C;  3RTR B;  5TRB A;  3SOU A;  2VJF B;  3L1X A;  2MD7 B;  2ECJ A;  3O33 A;  3KV5 A;  2F6N A;  2DSM A;  2D8U A;  4C9Z A;  2I50 A;  1T1H A;  3T7L A;  4A4C A;  2KFT A;  4LK9 A;  2JRJ A;  2ECV A;  2JMJ A;  4N3W A;  5AIU A;  4LKA A;  2OWA A;  2VPG A;  2K16 A;  3RPG B;  5C11 A;  2E61 A;  4YAX A;  1WEO A;  2JM3 A;  2CSV A;  3U5N A;  2L7P A;  3LQH A;  4MVT A;  2FFW A;  4YBS A;  5I3L A;  4WZ0 A;  2Y1M A;  2VPB A;  4A4B A;  4P5O B;  4OGC A;  5D1K B;  5D1L B;  2RI7 A;  3L11 A;  4WZ3 B;  3FAO A;  2ECT A;  2AN6 A;  3O70 A;  2XP0 A;  4A49 A;  4YAB A;  2ECN A;  2K17 A;  2XOZ A;  2CSY A;  3KQI A;  2CKL A;  4QQ4 A;  4R8P K;  2ECI A;  2C2L A;  5KH7 A;  2G45 A;  5JG6 A;  1JM7 A;  2XEU A;  5TBN A;  3SUB A;  2LGV A;  2Y43 A;  5K3Q A;  4L58 A;  4AVX A;  2FSA A;  3U5P A;  4I7B A;  2L5U A;  2F6J A;  2EGP A;  3N9P A;  4S3O B;  3N9N A;  4FO9 A;  4B86 C;  1X4I A;  2VJE A;  2EGM A;  3FEH A;  1ZBD B;  4UI9 B;  2PNX A;  2M3H A;  4FJC A;  2L80 A;  5SVY A;  3T9K A;  1VYX A;  4MSX A;  1WEP A;  5H9M A;  4F52 B;  5H1U A;  2UZG A;  2F42 A;  4R2Y A;  3GL6 A;  1WE9 A;  3MDB C;  5DIN A;  2EXU A;  1FBV A;  3LVR E;  5G0F A;  2LN0 A;  1Z2Q A;  2LXH C;  2MNY A;  3RPG C;  2CRW A;  3H7H A;  5SVX A;  3L1Z B;  3O37 A;  1CHC A;  1MM3 A;  2MT5 A;  1K2F A;  2LV9 A;  1JOC A;  3MHS A;  3GV4 A;  2LRI C;  3PHD A;  5SVI A;  1WGM A;  2KIZ A;  5AIT A;  2DJA A;  4Q6F A;  2VPE A;  4L7X A;  1Z60 A;  2JMI A;  3HCS A;  4FK5 A;  1MBM A;  4AUQ B;  3FL2 A;  3V43 A;  4YAT A;  2LAU A;  2CKL B;  3HTK C;  3DPL R;  5B75 A;  2VP7 A;  1U6G B;  2YQL A;  5B77 A;  1WIM A;  1JM7 B;  2KRE A;  5D1M B;  2YT5 A;  3O36 A;  1X4U A;  4WZ2 A;  1Z6U A;  4YAD A;  2YHN A;  1V87 A;  4S3O C;  4ZUX U;  2YRE A;  2VNF A;  2OXQ C;  2VJE B;  4UP5 A;  5LKT A;  4TKP B;  3FM8 C;  5TDR A;  1DVP A;  2RR4 A;  2XOY A;  3EB6 A;  2MNZ A;  3M99 A;  2FD4 A;  4LJN A;  1IYM A;  4LLB A;  5B78 A;  2YQM A;  5J3X A;  1VD4 A;  5EYA F;  2QIZ A;  3KNV A;  4W4U A;  5LKZ A;  5DKA A;  5SVI B;  4YBM A;  2IQJ A;  3M62 A;  3M7K A;  3U5M A;  3HCT A;  2KWK A;  3ZNI A;  2Y1N A;  3DQV R;  3KDE C;  4O64 A;  2YUC A;  1HYI A;  3O35 A;  3PUQ A;  2K1J A;  2XOC A;  4YC9 A;  2L0B A;  2E6S A;  2LGL A;  3LJU X;  5B8D A;  5KH9 A;  3SHB A;  2YYR A;  2H0D A;  4H9D A;  2CT2 A;  3ZYQ A;  5B79 A;  4X3G A;  2KWN A;  2M85 A;  2HYE D;  5G05 B;  2IDA A;  2YVR A;  2P57 A;  1WIL A;  3ASL A;  3E2D A;  1WEU A;  1HYJ A;  1E4U A;  2LGG A;  5TDW A;  3Q1D A;  3NG2 A;  1WES A;  3M63 A;  1DCQ A;  3O47 A;  4CCG X;  2QIC A;  2MKE A;  2EOD A;  2BAY A;  3LQI A;  3C5K A;  2KE1 A;  1WEE A;  5TAB A;  5H1T A;  2ZET C;  4OGE A;  2KWO A;  3JUE A;  5LKX A;  4ZDT A;  2FUU A;  1N87 A;  2KGI A;  2KKX A;  4FIP A;  4PPE A;  2CRR A;  2KKY A;  2MIQ A;  2G6Q A;  2JMD A;  3N9Q A;  4GNE A;  2MA5 A;  4Z0O A;  4QF3 A;  2B0O E;  3PLW A;  4O62 A;  3PUR A;  2M6M A;  5FER A;  3HCU A;  3O34 A;  3DDT A;  3KV6 A;  1WEQ A;  2D8S A;  1WFK A;  4V3L C;  2PUY A;  2LGK A;  4GNG A;  2KU3 A;  4ZQL A;  1LDJ B;  2CSZ A;  4YBT A;  4BHW A;  3ZVY A;  4N4F A;  2LXP C;  4PTB A;  2KWJ A;  2KR4 A;  3QZV A;  4V3K C;  3T6R A;  3ZTG A;  3IHP A;  4AYC A;  2L43 A;  3SOX A;  2FUI A;  2ECW A;  2CON A;  1BOR A;  2MUM A;  2L75 A;  2H0D B;  2K4D A;  2YW8 A;  3FAN A;  1FP0 A;  2YSM A;  1VFY A;  3FJU B;  5KH3 A;  2VPD A;  4IC2 A;  4QF2 A;  4A0C D;  4I7D A;  5C13 A;  3I2D A;  3ZVZ B;  2VJF A;  3N9O A;  3O7A A;  3U5O A;  5FB1 A;  3N9M A;  5H1V A;  3LQJ A;  2MD8 C;  3VK6 A;  4GND A;  2DX8 A;  2M1R A;  4I7C A;  3LDY A;  1WEW A;  2XB1 A;  2QJ0 A;  2MA6 A;  3ZPV E;  2LDR A;  3MHH A;  2HDP A;  2M13 A;  5FB0 A;  2KGG A;  1WEM A;  3C6W A;  4IC3 A;  2RSD A;  4NN2 A;  5LKU A; 
#chains in the Genus database with same CATH homology
 4F1P A;  3FM8 C;  3KDE C;  4OGE A;  4OGC A;  2CON A;  3JUE A;  5K3Q A;  2D8U A;  2RR4 A;  3MDB C;  2XOY A;  2YVR A;  2P57 A;  2JUN A;  2KKX A;  5SVI A;  3FJU B;  2CRR A;  2EXU A;  2KKY A;  3E2D A;  3LDY A;  2DJA A;  2XP0 A;  3LVR E;  3LVQ E;  2OWA A;  2XOC A;  2XOZ A;  4Z0O A;  5SVI B;  2FD4 A;  2E61 A;  2M13 A;  2EGM A;  3FEH A;  2B0O E;  4QQ4 A;  3PLW A;  2JM3 A;  2CSV A;  2IQJ A;  3Q1D A;  4O62 A;  3LJU X;  4Z0R A;  2YRE A;  3M7K A;  1DCQ A;  2CRW A;  2L7P A;  3H7H A;  3O47 A;  5SVX A;  3DWD A;  5SVY A;  2FFW A;  2LAU A;  2MKE A;  3T9K A;  4H9D A;  3SUB A;  3DDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...