3M3YF

Rna polymerase ii elongation complex c
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
KAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01192 RNA_pol_Rpb6 RNA polymerase Rpb6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.940.10 Alpha Beta Alpha-Beta Complex Eukaryotic RPB6 RNA polymerase subunit Eukaryotic RPB6 RNA polymerase subunit 3m3yF00
4MQ9E 1WCMF 4C3JF 5C3EF 2E2HF 4OIQE 4YFKE 3M4OF 3GTGF 3PO2F 2NVYF 3HOXF 2WAQK 5M5YF 4Q4ZE 3S1MF 4Q5SE 4BBSF 5IP9F 5D4DE 2VUMF 3S15F 1I6HF 4XSZE 3PO3F 2Y0SI 4A3MF 5TMCE 4A3DF 4A3KF 3S1RF 4OIPE 2E2JF 5E18E 4BXXF 4LLGE 2JA7F 2PMZK 5FLMF 1TWGF 3CQZF 4YFNE 2B63F 3S2HF 4C3IF 4C2MF 3WODE 4YG2E 4A3CF 3RZOF 1SFOF 1I50F 3I4NF 4OIRE 3GTKF 4A3IF 2NVQF 1SMYE 1TWFF 1YNJK 3GTOF 3HOVF 4OINE 3GTPF 2NVTF 1ZYRE 3M3YF 3H0GF 4OIOE 1HQME 2A6EE 3HOWF 4Y7NF 2WB1I 3GTJF 1YNNK 4KN4E 5M3FF 5D4EE 4KMUE 1TWHF 4XLPE 3GTMF 4A3BF 5IP7F 1I3QF 2CW0E 3HOUF 1Y1VF 5E17E 3HKZK 5BYHE 3S16F 5IYDF 2YU9F 5C4JF 2O5JE 2PPBE 4BBRF 5IYBF 3S14F 4LK0E 3DXJE 5TMFE 2JA5F 4LK1E 4KN7E 4ZH4E 5M5XF 4JK1E 3I4MF 4A3EF 2E2IF 3K7AF 3GTLF 4G7HE 5C44F 2A69E 4XLNE 4MEXE 3RZDF 2NVXF 1I6VE 4BY1F 1Y1WF 4G7OE 4MEYE 2R92F 3GTQF 4G7ZE 5IYCF 2JA6F 2A68E 3H3VG 4X6AF 4BY7F 1R9TF 3S17F 4A3GF 2JA8F 4A3LF 3S1QF 2R93F 4AYBK 2A6HE 3HOYF 4YFXE 4C3HF 4LJZE 3EQLE 3HOZF 5FJ8F 5M3MF 1TWAF 1IW7E 5M5WF 1QKLA 5D4CE 2R7ZF 5C4XF 3S2DF 3FKIF 4A3JF 3S1NF 4XSXE 5IPLE 4Y52F 4A93F 2BE5E 1K83F 1TWCF 4A3FF 2O5IE 4GZYE
chains in the Genus database with same CATH superfamily
4MQ9E 5M5YE 1WCMF 4C3JF 5C3EF 1TWGE 4BBSE 2E2HF 4AYBH 4YFKE 4OIQE 3GTGF 3M4OF 3PO2F 2NVYF 3HOXF 1WCME 2B63E 2WAQK 2KRXA 5M5YF 4Q4ZE 2Y0SH 3S1MF 3PO2E 4Q5SE 1Y1WE 2E2JE 4BXXE 4C3JE 5C3EE 4BBSF 5IP9F 5D4DE 2VUMF 3S15F 1I6HF 3HOWE 4XSZE 4A3KE 2Y0SI 4A3MF 3PO3F 4Y52E 5TMCE 2PMZH 4A3DF 3GTJE 4A3KF 3S1RF 4OIPE 2E2JF 5E18E 4BXXF 4LLGE 1I6HE 2JA7F 2PMZK 5FLMF 1TWAE 5FJ8E 3S16E 3M4OE 2E2HE 5E17E 1TWGF 3CQZF 3I4NE 5IP7E 4YFNE 2B63F 1EIKA 3S2HF 5IYDE 3RZOE 4A3CE 4C3IF 4C3HE 4C2MF 4A3IE 3GTKE 3WODE 1TWHE 4YG2E 4A3CF 3RZOF 3S2HE 1SFOF 1I50F 3I4NF 4OIRE 3GTKF 2JA6E 4A3IF 2NVQF 1SMYE 1TWFF 3M3YE 1YNJK 4Y7NE 2NVTE 3GTOF 3HOVF 5C4XE 4OINE 5FLME 2JA7E 3GTPF 2NVTF 1ZYRE 3M3YF 2WAQH 3H0GF 4OIOE 4QIWK 1HQME 2A6EE 3S1RE 4Y7NF 2WB1I 3GTJF 3HOWF 3S15E 3GTLE 1YNNK 4KN4E 2JA8E 5M3FF 4A3ME 3HOYE 3PO3E 2R93E 5D4EE 4KMUE 1TWHF 4XLPE 3GTMF 4A3LE 3S17E 5C4JE 4A3BF 5IP7F 2YU9E 4A3GE 4X6AF 1I3QF 2JA5E 2CW0E 3HOUF 1Y1VF 4BY1E 3HKZK 4BBRE 5BYHE 5IYBE 3S14E 5IYDF 2YU9F 3S16F 5C4JF 3GTQE 2R92E 3GTME 2O5JE 2PPBE 3CQZE 4BBRF 5IYBF 3S14F 1I3QE 3DXJE 4LK0E 5TMFE 5C44E 4LK1E 2JA5F 4KN7E 3S1NE 4ZH4E 5M5XF 4JK1E 1TWCE 4A3FE 4A3EF 2E2IF 3I4MF 3K7AF 3GTLF 5IP9E 4QIWH 2A69E 5C44F 4G7HE 3FKIE 4A3EE 4XLNE 4MEXE 2E2IE 5M5WE 3HOVE 3RZDF 2NVXF 1I6VE 1Y1VE 4BY1F 3HOUE 1Y1WF 3GTPE 3S1ME 4G7OE 4MEYE 1I50E 2R92F 3GTQF 2NVYE 2WB1H 3HOXE 4G7ZE 3GTGE 3H3VF 3S1QE 3HOZE 1TWFE 5IYCF 2JA6F 1K83E 2A68E 3H3VG 4A93E 4BY7F 5M3FE 1R9TF 3S17F 2JA8F 4A3BE 4A3GF 1DZFA 4A3LF 3S1QF 2R93F 4AYBK 2A6HE 2VUME 3HOYF 4YFXE 1R9TE 2R7ZE 4BY7E 5IYCE 3H0GE 4C3HF 4A3JE 4LJZE 3EQLE 3HOZF 5FJ8F 5M3MF 3S2DE 1TWAF 1IW7E 5M5WF 3RZDE 2NVXE 1QKLA 5D4CE 2NVQE 2R7ZF 5C4XF 5M3ME 3S2DF 3GTOE 3FKIF 4A3JF 5M5XE 3S1NF 4XSXE 4A3DE 4Y52F 5IPLE 3K7AE 4A93F 2BE5E 4X6AE 1K83F 1TWCF 4C2ME 3HKZH 4A3FF 4C3IE 1SFOE 2O5IE 3I4ME 4GZYE
chains in the Genus database with same CATH topology
4MQ9E 1WCMF 4C3JF 5C3EF 2E2HF 4OIQE 4YFKE 3M4OF 3GTGF 3PO2F 2NVYF 3HOXF 2WAQK 2KRXA 5M5YF 4Q4ZE 3S1MF 4Q5SE 4BBSF 5IP9F 5D4DE 2VUMF 3S15F 1I6HF 4XSZE 3PO3F 2Y0SI 4A3MF 5TMCE 4A3DF 4A3KF 3S1RF 4OIPE 2E2JF 5E18E 4BXXF 4LLGE 2JA7F 2PMZK 5FLMF 1TWGF 3CQZF 4YFNE 2B63F 3S2HF 4C3IF 4C2MF 3WODE 4YG2E 4A3CF 3RZOF 1SFOF 1I50F 3I4NF 4OIRE 3GTKF 4A3IF 2NVQF 1SMYE 1TWFF 1YNJK 3GTOF 3HOVF 4OINE 3GTPF 2NVTF 1ZYRE 3M3YF 3H0GF 4OIOE 4QIWK 1HQME 2A6EE 3HOWF 4Y7NF 2WB1I 3GTJF 1YNNK 4KN4E 5M3FF 5D4EE 4KMUE 1TWHF 4XLPE 3GTMF 4A3BF 5IP7F 1I3QF 2CW0E 3HOUF 1Y1VF 5E17E 3HKZK 5BYHE 3S16F 5IYDF 2YU9F 5C4JF 2O5JE 2PPBE 4BBRF 5IYBF 3S14F 4LK0E 3DXJE 5TMFE 2JA5F 4LK1E 4KN7E 4ZH4E 5M5XF 4JK1E 3I4MF 4A3EF 2E2IF 3K7AF 3GTLF 4G7HE 5C44F 2A69E 4XLNE 4MEXE 3RZDF 2NVXF 1I6VE 4BY1F 1Y1WF 4G7OE 4MEYE 2R92F 3GTQF 4G7ZE 5IYCF 2JA6F 2A68E 3H3VG 4X6AF 4BY7F 1R9TF 3S17F 4A3GF 2JA8F 4A3LF 3S1QF 2R93F 4AYBK 2A6HE 3HOYF 4YFXE 4C3HF 4LJZE 3EQLE 3HOZF 5FJ8F 5M3MF 1TWAF 1IW7E 5M5WF 1QKLA 5D4CE 2R7ZF 5C4XF 3S2DF 3FKIF 4A3JF 3S1NF 4XSXE 5IPLE 4Y52F 4A93F 2BE5E 1K83F 1TWCF 4A3FF 2O5IE 4GZYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ9 E;  1WCM F;  4C3J F;  5C3E F;  2E2H F;  4OIQ E;  4YFK E;  3M4O F;  3GTG F;  3PO2 F;  2NVY F;  3HOX F;  2WAQ K;  5M5Y F;  4Q4Z E;  3S1M F;  4Q5S E;  4BBS F;  5IP9 F;  5D4D E;  2VUM F;  3S15 F;  1I6H F;  4XSZ E;  3PO3 F;  2Y0S I;  4A3M F;  5TMC E;  4A3D F;  4A3K F;  3S1R F;  4OIP E;  2E2J F;  5E18 E;  4BXX F;  4LLG E;  2JA7 F;  2PMZ K;  5FLM F;  1TWG F;  3CQZ F;  4YFN E;  2B63 F;  3S2H F;  4C3I F;  4C2M F;  3WOD E;  4YG2 E;  4A3C F;  3RZO F;  1SFO F;  1I50 F;  3I4N F;  4OIR E;  3GTK F;  4A3I F;  2NVQ F;  1SMY E;  1TWF F;  1YNJ K;  3GTO F;  3HOV F;  4OIN E;  3GTP F;  2NVT F;  1ZYR E;  3M3Y F;  3H0G F;  4OIO E;  1HQM E;  2A6E E;  3HOW F;  4Y7N F;  2WB1 I;  3GTJ F;  1YNN K;  4KN4 E;  5M3F F;  5D4E E;  4KMU E;  1TWH F;  4XLP E;  3GTM F;  4A3B F;  5IP7 F;  1I3Q F;  2CW0 E;  3HOU F;  1Y1V F;  5E17 E;  3HKZ K;  5BYH E;  3S16 F;  5IYD F;  2YU9 F;  5C4J F;  2O5J E;  2PPB E;  4BBR F;  5IYB F;  3S14 F;  4LK0 E;  3DXJ E;  5TMF E;  2JA5 F;  4LK1 E;  4KN7 E;  4ZH4 E;  5M5X F;  4JK1 E;  3I4M F;  4A3E F;  2E2I F;  3K7A F;  3GTL F;  4G7H E;  5C44 F;  2A69 E;  4XLN E;  4MEX E;  3RZD F;  2NVX F;  1I6V E;  4BY1 F;  1Y1W F;  4G7O E;  4MEY E;  2R92 F;  3GTQ F;  4G7Z E;  5IYC F;  2JA6 F;  2A68 E;  3H3V G;  4X6A F;  4BY7 F;  1R9T F;  3S17 F;  4A3G F;  2JA8 F;  4A3L F;  3S1Q F;  2R93 F;  4AYB K;  2A6H E;  3HOY F;  4YFX E;  4C3H F;  4LJZ E;  3EQL E;  3HOZ F;  5FJ8 F;  5M3M F;  1TWA F;  1IW7 E;  5M5W F;  1QKL A;  5D4C E;  2R7Z F;  5C4X F;  3S2D F;  3FKI F;  4A3J F;  3S1N F;  4XSX E;  5IPL E;  4Y52 F;  4A93 F;  2BE5 E;  1K83 F;  1TWC F;  4A3F F;  2O5I E;  4GZY E; 
#chains in the Genus database with same CATH topology
 4MQ9 E;  5M5Y E;  1WCM F;  4C3J F;  5C3E F;  1TWG E;  4BBS E;  2E2H F;  4AYB H;  4YFK E;  4OIQ E;  3GTG F;  3M4O F;  3PO2 F;  2NVY F;  3HOX F;  1WCM E;  2B63 E;  2WAQ K;  2KRX A;  5M5Y F;  4Q4Z E;  2Y0S H;  3S1M F;  3PO2 E;  4Q5S E;  1Y1W E;  2E2J E;  4BXX E;  4C3J E;  5C3E E;  4BBS F;  5IP9 F;  5D4D E;  2VUM F;  3S15 F;  1I6H F;  3HOW E;  4XSZ E;  4A3K E;  2Y0S I;  4A3M F;  3PO3 F;  4Y52 E;  5TMC E;  2PMZ H;  4A3D F;  3GTJ E;  4A3K F;  3S1R F;  4OIP E;  2E2J F;  5E18 E;  4BXX F;  4LLG E;  1I6H E;  2JA7 F;  2PMZ K;  5FLM F;  1TWA E;  5FJ8 E;  3S16 E;  3M4O E;  2E2H E;  5E17 E;  1TWG F;  3CQZ F;  3I4N E;  5IP7 E;  4YFN E;  2B63 F;  1EIK A;  3S2H F;  5IYD E;  3RZO E;  4A3C E;  4C3I F;  4C3H E;  4C2M F;  4A3I E;  3GTK E;  3WOD E;  1TWH E;  4YG2 E;  4A3C F;  3RZO F;  3S2H E;  1SFO F;  1I50 F;  3I4N F;  4OIR E;  3GTK F;  2JA6 E;  4A3I F;  2NVQ F;  1SMY E;  1TWF F;  3M3Y E;  1YNJ K;  4Y7N E;  2NVT E;  3GTO F;  3HOV F;  5C4X E;  4OIN E;  5FLM E;  2JA7 E;  3GTP F;  2NVT F;  1ZYR E;  3M3Y F;  2WAQ H;  3H0G F;  4OIO E;  4QIW K;  1HQM E;  2A6E E;  3S1R E;  4Y7N F;  2WB1 I;  3GTJ F;  3HOW F;  3S15 E;  3GTL E;  1YNN K;  4KN4 E;  2JA8 E;  5M3F F;  4A3M E;  3HOY E;  3PO3 E;  2R93 E;  5D4E E;  4KMU E;  1TWH F;  4XLP E;  3GTM F;  4A3L E;  3S17 E;  5C4J E;  4A3B F;  5IP7 F;  2YU9 E;  4A3G E;  4X6A F;  1I3Q F;  2JA5 E;  2CW0 E;  3HOU F;  1Y1V F;  4BY1 E;  3HKZ K;  4BBR E;  5BYH E;  5IYB E;  3S14 E;  5IYD F;  2YU9 F;  3S16 F;  5C4J F;  3GTQ E;  2R92 E;  3GTM E;  2O5J E;  2PPB E;  3CQZ E;  4BBR F;  5IYB F;  3S14 F;  1I3Q E;  3DXJ E;  4LK0 E;  5TMF E;  5C44 E;  4LK1 E;  2JA5 F;  4KN7 E;  3S1N E;  4ZH4 E;  5M5X F;  4JK1 E;  1TWC E;  4A3F E;  4A3E F;  2E2I F;  3I4M F;  3K7A F;  3GTL F;  5IP9 E;  4QIW H;  2A69 E;  5C44 F;  4G7H E;  3FKI E;  4A3E E;  4XLN E;  4MEX E;  2E2I E;  5M5W E;  3HOV E;  3RZD F;  2NVX F;  1I6V E;  1Y1V E;  4BY1 F;  3HOU E;  1Y1W F;  3GTP E;  3S1M E;  4G7O E;  4MEY E;  1I50 E;  2R92 F;  3GTQ F;  2NVY E;  2WB1 H;  3HOX E;  4G7Z E;  3GTG E;  3H3V F;  3S1Q E;  3HOZ E;  1TWF E;  5IYC F;  2JA6 F;  1K83 E;  2A68 E;  3H3V G;  4A93 E;  4BY7 F;  5M3F E;  1R9T F;  3S17 F;  2JA8 F;  4A3B E;  4A3G F;  1DZF A;  4A3L F;  3S1Q F;  2R93 F;  4AYB K;  2A6H E;  2VUM E;  3HOY F;  4YFX E;  1R9T E;  2R7Z E;  4BY7 E;  5IYC E;  3H0G E;  4C3H F;  4A3J E;  4LJZ E;  3EQL E;  3HOZ F;  5FJ8 F;  5M3M F;  3S2D E;  1TWA F;  1IW7 E;  5M5W F;  3RZD E;  2NVX E;  1QKL A;  5D4C E;  2NVQ E;  2R7Z F;  5C4X F;  5M3M E;  3S2D F;  3GTO E;  3FKI F;  4A3J F;  5M5X E;  3S1N F;  4XSX E;  4A3D E;  4Y52 F;  5IPL E;  3K7A E;  4A93 F;  2BE5 E;  4X6A E;  1K83 F;  1TWC F;  4C2M E;  3HKZ H;  4A3F F;  4C3I E;  1SFO E;  2O5I E;  3I4M E;  4GZY E; 
#chains in the Genus database with same CATH homology
 4MQ9 E;  1WCM F;  4C3J F;  5C3E F;  2E2H F;  4OIQ E;  4YFK E;  3M4O F;  3GTG F;  3PO2 F;  2NVY F;  3HOX F;  2WAQ K;  2KRX A;  5M5Y F;  4Q4Z E;  3S1M F;  4Q5S E;  4BBS F;  5IP9 F;  5D4D E;  2VUM F;  3S15 F;  1I6H F;  4XSZ E;  3PO3 F;  2Y0S I;  4A3M F;  5TMC E;  4A3D F;  4A3K F;  3S1R F;  4OIP E;  2E2J F;  5E18 E;  4BXX F;  4LLG E;  2JA7 F;  2PMZ K;  5FLM F;  1TWG F;  3CQZ F;  4YFN E;  2B63 F;  3S2H F;  4C3I F;  4C2M F;  3WOD E;  4YG2 E;  4A3C F;  3RZO F;  1SFO F;  1I50 F;  3I4N F;  4OIR E;  3GTK F;  4A3I F;  2NVQ F;  1SMY E;  1TWF F;  1YNJ K;  3GTO F;  3HOV F;  4OIN E;  3GTP F;  2NVT F;  1ZYR E;  3M3Y F;  3H0G F;  4OIO E;  4QIW K;  1HQM E;  2A6E E;  3HOW F;  4Y7N F;  2WB1 I;  3GTJ F;  1YNN K;  4KN4 E;  5M3F F;  5D4E E;  4KMU E;  1TWH F;  4XLP E;  3GTM F;  4A3B F;  5IP7 F;  1I3Q F;  2CW0 E;  3HOU F;  1Y1V F;  5E17 E;  3HKZ K;  5BYH E;  3S16 F;  5IYD F;  2YU9 F;  5C4J F;  2O5J E;  2PPB E;  4BBR F;  5IYB F;  3S14 F;  4LK0 E;  3DXJ E;  5TMF E;  2JA5 F;  4LK1 E;  4KN7 E;  4ZH4 E;  5M5X F;  4JK1 E;  3I4M F;  4A3E F;  2E2I F;  3K7A F;  3GTL F;  4G7H E;  5C44 F;  2A69 E;  4XLN E;  4MEX E;  3RZD F;  2NVX F;  1I6V E;  4BY1 F;  1Y1W F;  4G7O E;  4MEY E;  2R92 F;  3GTQ F;  4G7Z E;  5IYC F;  2JA6 F;  2A68 E;  3H3V G;  4X6A F;  4BY7 F;  1R9T F;  3S17 F;  4A3G F;  2JA8 F;  4A3L F;  3S1Q F;  2R93 F;  4AYB K;  2A6H E;  3HOY F;  4YFX E;  4C3H F;  4LJZ E;  3EQL E;  3HOZ F;  5FJ8 F;  5M3M F;  1TWA F;  1IW7 E;  5M5W F;  1QKL A;  5D4C E;  2R7Z F;  5C4X F;  3S2D F;  3FKI F;  4A3J F;  3S1N F;  4XSX E;  5IPL E;  4Y52 F;  4A93 F;  2BE5 E;  1K83 F;  1TWC F;  4A3F F;  2O5I E;  4GZY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...