3M8YA

Phosphopentomutase from bacillus cereus after glucose-1,6-bisphosphate activation
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 143
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3m8yA02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3m8yA01
1Y6VA 3T01A 4KAVA 3UNYA 3MK2A 1ANJA 2IUCA 5EGHA 5INHA 1P49A 3M8WA 2W5SA 4UOPA 1K7HA 5L0EA 4LR9A 1HDHA 5IJSA 1E1ZP 2GSNA 3Q3QA 3BDGB 3M8ZA 2GLQA 3WAXA 3UN3A 5L0KA 3NKNA 5DLWA 3T00A 2W5TA 3BDHA 3CMRA 4LR2A 3WAYA 5HRTA 1ALJA 1URBA 3MK1A 4GTWA 5C66A 3A52A 2D1GA 1EJJA 1EI6A 1N2KA 1KHNA 4GTZA 3DPCA 2X98A 4ZG6A 3NKOA 4ZG7A 4ZG9A 1Y7AA 5L0BA 3IGZB 2XRGA 2GSOA 3NKPA 1E33P 1ED8A 5LRMA 4QAXA 5GOVA 1EW9A 2W5XA 1KH7A 1N2LA 4LQYA 1ED9A 1URAA 1E3CP 4UPIA 4LREA 4B56A 1AJAA 1KHJA 2RH6A 1SHNA 2W5WA 2XR9A 4FDIA 2QZUA 5IJQA 5K4PA 1SHQA 4CYSA 5LRNA 1ALKA 3OT9A 3NKRA 3MK0A 2IUCB 1KH4A 2W5QA 4FDJA 3M8YA 2W5VA 4KAYA 1ELYA 3KD8A 3UN5A 4LRDA 2VQRA 1AJDA 1ALHA 2W8SA 3B5QA 4KM4A 4MHXA 5KXAA 4GTXA 3DYCA 1B8JA 1ALIA 2GSUA 4TN0A 1AJBA 3TX0A 1AJCA 2GA3A 1ANIA 3M7VA 4UPLA 1FSUA 2ANHA 2W5RA 1ZEBA 1KH5A 4CXKA 1ZEFA 1O98A 4UORA 1AUKA 2W8DA 4UOOA 4N7TA 1KHKA 4CXUA 5GRRA 3NVLA 3E2DA 4LRBA 3BDGA 1EW8A 4NWXA 5EGEA 4ZGAA 3NKQA 3WBHA 3SZZA 1KH9A 3WAVA 4LRAA 1KHLA 3IGYB 3T02A 4MIVA 3NKMA 3BDFA 4KJGA 4CYRA 4GTYA 5DLVA 3IDDA 4LRFA 2IFYA 4LR7A 5LIAA 1O99A 4MY4A 3WAWA 1EW2A 1HQAA 5DLTA 2G9YA 1ELXA 4LRCA 1E2SP 1ZEDA 5AJ9A 1EQJA 3TWZA 3UN2A 3SZYA 3UO0A 3ED4A 5TJ3A 5LQQA 1HJKA 3TG0A 4YR1A 4CXSA 4UPKA 1ELZA 2ZKTA 4UPHA 4NWJA 3LXQA 4LR8A 4KJDA
chains in the Genus database with same CATH superfamily
3I55S 3KDNA 3PCOB 4YHHJ 5KFVA 4CWBA 2C2KB 4WXWA 4F0HA 1H74A 4YDXA 4A8WA 2XGPA 2BOAA 3BDGB 3D6MB 4F3QA 2KT5A 4ZN3A 3VF0B 3BN7A 4QWBA 1AZSA 2HWIA 4CNYA 4GTZA 1S6PA 5GMDA 3HO1A 4X4PA 2BX6A 3FRZA 4U6PA 1WOOA 3T5LA 3BYRA 1CJVA 1ZZNA 4FDJA 3L9ZA 1UJ5A 2ASYA 3BV8A 3W61A 5H9EJ 4JI3J 1YJRA 3BR8A 5K14A 5KT3A 4UPLA 3CDBA 4K7QA 3SIPB 3CJRA 4F4YA 1URRA 2OIHA 3Q8UA 2HLTA 4LF9J 4CRJA 3NKQA 4U96A 2HS3A 3TJ9A 1S49A 4PXCA 4CO4A 2BVZA 5DGBA 2N7YA 2WCXA 1B7FA 4U9RA 2YNIB 1UWAA 2H5IB 3K58A 1A6LA 4YR1A 2EFNA 3BM7A 2RIJA 4Y0FA 3M8WA 2M8DB 4DEZA 2ZVIA 4A47A 1YJUA 2HHPA 2J0SD 4EZ6A 3SSQA 2J76E 4HTJA 2O1PA 2W4CA 4IO1A 5J2MB 1E33P 1KBRA 4LSNA 4I2PA 3BO3A 5F8MA 2HEKA 1LWFB 3ZTPA 3KLGB 2AW0A 4DV4F 1LEOA 4DV7J 5HVHA 3MI7X 4RW9B 3DRSA 3C14B 4UZCA 5CHCB 3C15A 4KY3A 1FEHA 3KUGA 2DR7A 4RUCA 3A13A 3MAHA 3ZZOA 3EMTA 2YWEA 4CO3A 4L74A 2RDDA 3G4SS 3A3OB 2Q3PA 1UVMA 3DGVA 2R8GA 2HVZA 2HS4A 3RRGA 5H1SV 1GFWB 2E5JA 2DVIA 3DRRB 1R0BG 4DJBA 3BPSP 2MGZB 5ETMA 1REVB 4EK2A 4C11B 4QBUA 2WVFA 2IRXA 4DR2F 5CYQA 3KKFA 3DPCA 4ZG6A 4DSIA 5LRMA 2EKNA 2MDAA 4NRTA 3M2RA 2RF2A 4LQ3A 4NEYA 4JI2F 3BKUA 5I42A 3OHAA 3W1YC 1JNRB 1PAEX 1JX4A 3QT5A 1RWUA 4HT7A 5I3UB 2ZNYA 4ZPAA 1JK9B 5KT4A 2H5EA 4XPEA 5AJ3F 1VIOA 2N4CA 4LFCJ 3FFIA 3P5BP 3NGKA 1TKTB 1U1QA 2MZ1A 4U95A 4U67Q 1S0MA 1RTDB 1SUQA 5AT1B 2EC2A 4LFBJ 4NWXA 4DQSA 4TYAA 4HHJA 1TL5A 2ZJRQ 2IFYA 4FS1A 3TVKA 4S0MA 1QAJA 4XIUA 1KQFB 1EETA 1EKRA 2HMIA 3QPIA 1BE4A 3ITHB 2YWWA 4HH1A 1HR0J 1X0FA 2E29A 1ZAVA 3WC0A 4NLOA 5KFJA 1VQOS 4KAVA 1U7LA 3TEGA 3PEHA 4NCGB 4PQAA 4X64F 5HLFA 1RWWB 4DUYF 2HIQA 1HLWA 1JJHA 1NK5A 4LR2A 2W01A 5KG3A 2AJ4A 2IC3A 2E5LJ 1WC0A 1S1WB 4FS2A 2ZWOA 3MGJA 5G0RB 1IBKJ 3H5SA 1BQMA 4OI1A 1QM9A 2R2SA 2BE7D 1TL1B 2V6AA 1HYSB 3MM5B 2W7OA 2M70A 4NXNJ 4KJGA 3OVBA 1H73A 2GVDA 4F67A 4UPKA 2YPZA 1RT2A 2VQFJ 5J2PB 1ITPA 1YBUA 2CQ0A 3UNYA 2HSEB 4LFAJ 2NQPA 4G3IA 5E33A 2RB7A 3C6TA 4IG0A 5IQQA 1RTHB 2I9SA 1FKAF 1G2EA 4EFAC 3GE9A 3WAXA 1T3OA 3M05A 3WIUA 4ED1A 1WWHA 4DR5J 1YQHA 3MPWA 4CT8A 1YTYA 4I4BA 2PEBA 1URNA 3M8RA 4MIWA 3HHLC 2J0WA 1KH7A 2OSRA 1UZHA 3PIOQ 2Y0BB 4WZQA 4QYZJ 2LXUA 3GFXA 3EJMA 3LAKA 4USKA 3HP6A 4LF7J 5D8HB 2AEMA 5AXMA 4UTGA 2QSFA 2CAJA 3P8BB 2EK6A 4HDHA 1VQ5S 3QBCA 2EVZA 4QIVA 1R27B 3VAFA 1NJYA 3CJ5A 4LSLB 4K4SA 3RYLA 1WEYA 4RWXA 1SB6A 5A2QU 4QPTA 1MMNA 2HQ3A 1HBNB 2A2CA 3LP0B 3V6KA 5LQQA 2HNDB 4LJMA 4FBUA 1D9DA 3MMCB 5F8NA 2BE2B 1OYEA 3MEEA 3T01A 1FXRA 3PNIA 2QV6A 4O3PA 2FJAB 2ZH5A 1UA0A 4BWJA 1K44A 1EJ7L 2HQGA 2FPHX 3NGDA 3OFHA 1SH2A 4LIWA 3T1HJ 5GAEU 4EBEA 3G82A 3NGRA 2N3LA 3UCUP 4DL0C 2DNNA 3IGZB 5K5MA 1TVRA 1MN7A 2NYHA 3OLAA 2IMOA 1S1VB 4GC7A 4DHVA 3GFYA 3DLBA 3BPDA 3PJ9A 1FFGB 3OV7A 3S6EA 4HHUA 1GX5A 3M8PB 3ILJA 2JFDA 4X62F 3BS9A 1Y11A 3VGTA 3IGYB 3L7UA 3HULA 4CLSA 2V2QA 1FJGF 4M5MA 1DQAA 2RU9A 2M4MA 2ZM6J 3QLHB 1R6VA 4JI5F 1H72C 1C4AA 3CD6S 4PZVA 3N28A 3KLVA 3P3DA 1N34F 1BWVA 4PG4A 3GQCA 3TP2A 5D4PA 4L72B 1N48A 4OIXA 2KHDA 5IT9Y 2HHHF 4M63A 2HNYB 2B5JB 3SFUA 1ZA1B 3DU6A 1N5TA 4RZRA 3DOKA 2ROEA 1U1RA 1T11A 4EUVA 2DCUB 4C0BA 1MNEA 1HA1A 1ALKA 4H4OA 2W4PA 3DN9A 5L9XA 4EWTA 1KFSA 1B70B 2VPWB 2OFGX 4MT1A 4DPOA 1R43A 2YKMB 1S6QA 1IJFB 1LW2B 3KHGA 1TV6A 5I4MA 4J37A 1LOUA 1SV5B 3IGVA 3DM2B 3UD4P 1N5YB 1FNOA 4OJ3A 4FZVA 2PA8D 1L3VA 1EW8A 2MPUA 2JEGA 2FZKB 1Q7YT 4KO0A 1UEVA 3NOGA 4ED3A 4DL3A 3NAHA 4O44B 2CZ9A 1EW2A 1DTTB 2CRLA 2DGXA 2WZ1A 4GKKJ 2EFQA 2IY5B 1C1CA 1S0VA 3J81j 1ZPVA 2EBGA 4X65F 4USVA 5L8RC 2VZ9A 2WSCC 2YKNB 3NP5A 2XHCA 4JI0F 2O01C 3Q8RB 1N33J 1M5KC 4GRSA 4V1Ak 1PBUA 3BDHA 1URBA 1N36F 4ZITA 2FLOA 2DO4A 4J9KA 3R5AA 4FF1A 1NJXA 2BJ3A 5KG6A 2QYGA 3ET6B 3Q2SC 2UZAA 4C8KA 1NJWA 4K4TA 1PCAA 4RBTA 4LF4F 2DNGA 4LF5F 1S79A 3UDEA 2ZD1B 3QJJA 1MMLA 2B9XA 2QYCA 2QMUB 3O3LA 2DHSA 1WNEA 4KGXB 1DQ8A 3ADAC 2CQBA 2ZKUA 4OI6A 1FF2A 2WW8A 1P1LA 1OY8A 2Z8QA 4CYRA 4DL5A 1O6XA 1QD1A 4QU7A 1XTZA 3ILIA 1FWLA 3KYLA 3DXSX 4AXJA 4C4WA 3RAXA 1SIWB 1KR4A 3MURP 3NXZA 3D2WA 3DRYA 2AKWB 4N47A 2BACA 2BBEA 2W9BA 4BBYA 1HMVA 2K3KA 2OD4A 5KFSA 2DKOB 3O8WA 7FDRA 2E5IA 3LA0A 5CAAA 1RWNB 4A8KA 1T05B 2JEIA 5HMYA 2RS2A 4K4XA 3SDEB 4DL6A 4PWDA 3OT9A 4F26A 4WFAQ 3ISND 4TY8B 4NLSA 3OR2A 3TAMA 1UL3A 1HWLA 3QIPB 2KXHA 1CJVB 4JP8A 2APOA 1ZEBA 5HANA 1BGXT 2FDNA 4FYXB 2PFDA 2MHEA 3BEGB 1XR5A 1VLYA 1Q7LB 2C28A 4I6YA 3OSNA 5D4LA 3GPAA 5KFLA 5KT7A 4K0KF 5DS7A 1YJTA 1EQJA 3R2DJ 1S57A 3UO0A 4ZIVA 1S1TA 1RTJA 4OL8A 5KFTA 2B4UA 5F3ZA 2FTRA 2HGMA 1IUJA 3FNNA 3UPFA 3MMBA 4I68A 3ISNC 4Q8EA 1WF1A 2XEXA 2KDOA 1U2RA 4NMXA 4I2QB 3SSRA 3UVJB 3WAYA 5GAEI 1EJJA 1S1XB 4C97A 1FA0A 4HHHA 4KT0C 1P8GA 3QSIA 4GKJJ 4DR3J 4BC9A 3AD8C 4Y28C 2C2DA 1VK3A 3D0IE 1WI8A 3ZFVA 4ILMA 4ZCLA 1IKYB 4M8LA 2FGOA 1ZM4A 3R6LB 2VPZB 2PMHA 2IAJB 2UV8G 2YWKA 1B3TA 4I69A 4N41A 3DI6A 2CPHA 1S0NA 4HL9A 1VBYA 1OSCA 2MJNA 3A12A 4OYZA 2VODA 5EGYA 1IWGA 2QLXA 1OO0B 3AA8A 3R7SB 2UVWA 5E0OA 3IP0A 3N5FA 3CCRS 5L46A 5IM0B 4QWEA 1JIHA 3EVMA 2IUCA 1FX4A 1N6QA 3QWPA 2M7SA 3C19A 4P6QA 1KVIA 4DV6F 5B0DA 1TL3A 2UXBF 3Q83A 1ED9A 2ABYA 3R5GA 1RHQB 2ZUAA 3MEGA 1H3DA 4Q7AA 2V2VA 3HK2A 4TN0A 2OPRA 1ANIA 5I3QA 3T1YJ 3IWXA 3AODA 3SSSA 1JLQA 2C1EB 2IM2A 1F60B 2NZCA 2XMTA 3IWLA 1TU0B 4ID5B 2P9GA 4YHHF 1FESA 4NZ0A 3EUNA 5JVGQ 5DLFA 2A0FB 1ZEDA 4OQJA 5AE1A 3KLHB 2KT2A 3EWGA 1WG5A 3KJQB 4DR6F 2RSQA 3QMQA 4MFBA 2F3JA 2BR0A 4X66F 5FJ4A 3P6YC 4MTPA 4IFVA 4U8YA 4TQRA 2MSTA 3DDKA 2V8DA 3F0NA 4OZ2A 1N56A 4OI0A 4FXDA 4Y34A 1YK9A 3T3FA 2XMMA 1VJWA 1D1UA 2IPOB 2V69A 4V19X 3GIRA 4ITSA 4OYMA 4IH6A 2LEBA 1XBWA 1S76D 4PXEA 1HBMA 1S9GA 2FY8A 1I3OB 2QEXS 2KXNB 2IC3B 5T7LA 2DXDA 4LF9F 3CJ4A 3JQMA 1ELYA 4MKBA 3Q8VA 3HVTA 5C25A 2MXYA 1ZTTA 5KT2A 1BXNA 3M7VA 1BQMB 1FTRA 3M30B 4G1PA 2Y0SD 3EGNA 4DQRA 4MYUA 2H54B 2Q66A 3FEXB 3LGNA 2FHMA 1T94A 4MKYA 4BWMA 5KG1A 1EIYB 4R0EA 3W3SA 1N5QA 4RL1A 5LIAA 4O3SA 2FGCA 2V5HG 1VQLS 3D3CJ 4Y65A 5C5JA 3TG0A 2E7WA 3LP1A 3HM9A 2YNGB 4P2FA 5D77A 2LCWA 1BWEA 1R0AB 2DGVA 3HVRA 1HNIB 2ATCB 3EPGA 3UDLA 3RW6A 1R8AA 2YNHA 2B9YA 1RT2B 4DQPA 1KTVA 2W2QP 3DYAB 2DO0A 3OW2R 4UQTA 1SJFA 4PYAA 3W60A 1RT7A 3M9NB 3G2XA 4X4SA 2P9EA 1MG7A 1AA1B 1HPZA 3QFHA 2POKA 2RAQA 3ENVA 2AJQA 1YBTA 3V2UC 4DV7F 3H5UA 1RYSA 4TKTA 3MCMA 5A8KB 2E1PA 1SHNA 5JXSA 2H4WB 5D6GA 5IT9U 2V8PA 2BJ8A 1TAUA 1E6YB 2RQ4A 5KG7A 4ZK7M 2MQOA 1M1HA 4DUZJ 5CYMB 5HN0A 1J27A 3KJVB 3NS5A 2AQ4A 2HFVA 3KOAA 2JVRA 1NPKA 3ZNUA 3HSJA 3KNGA 1H38A 3P5TL 4YY3F 2W25A 2XY6A 4UW2A 3DDNA 3VZIA 2ROGA 2HYIB 5KFAA 2Y3YA 3DLKA 1K9MT 1KHVA 1RLDA 3KHRA 2HWTA 2LEAA 5D0HA 3VVUA 3MR6A 2HW3A 4ILLA 4F4KA 2BANA 3B82A 3QGIA 4UOPA 4WP3A 3AQPA 3FSYA 4JBCA 3MEEB 4YB1P 1Y3JA 1NSPA 4M94A 3NL0A 3HX9A 3O44A 4PXDA 3I56S 4TYBA 1S7HA 3NLCA 2GC8A 2OI2A 1HFEL 2ZH8A 3OXGA 4RW6A 2P6SA 3HT3A 1CJUA 3C6UA 1QSYA 1JNZB 4LFCF 4ECVA 4GMKA 5DGAA 1XJWB 3CUNA 2DGUA 4LFBF 4WE1A 1FI4A 6FD1A 2R3VA 1U47A 1YJ7A 1RADB 1H7WA 3GIKA 4B9SA 4RPFA 1FTCA 2RS8A 1HR0F 3TI0A 2VC0A 1S97A 3C46A 1V6HA 2NXCA 3TQEA 2IFXA 1DURA 1PJ7A 2KI2A 1KRPA 3TVYA 4ECWA 5GAHU 4PQUB 2VF3A 3CD7A 1A0OB 2IDLA 4ED7A 3J80Y 2AD9A 2M8HA 2GQ2A 5KFCA 3I5AA 1RE1B 2AGQA 2DIUA 1MROA 1RLCL 2E5LF 4OX6A 2J9EA 3CC2S 4NL5A 4ETZA 4NLWA 2E44A 1RT3B 5F9NA 1HNVB 2KRRA 2HFUA 4J9PA 2XRGA 1T3NA 4PG8A 3ZTSA 1RWVB 2VICA 4B56A 3NEKA 2QFIA 3N01A 4IFYB 4ES3A 2FJDB 1Z2ZA 4A8FA 5MLCV 2CPYA 4IG3B 2AGPA 3CCLS 3FQKA 3J81Y 5M2PA 2F5GA 1FXDA 2ZZTA 4F36A 5HP1B 2YKOA 4M5LA 2VFTA 3D54A 2XGQA 1TQLA 1VQ4S 1UPPA 3GYGA 2VQFF 4OHWA 3W2VB 2R7QA 3CJ8A 3BGFA 3KUEA 3CC4S 4J9MA 4TLQA 4Z7CA 4FXWA 2Y8WA 3WX8A 4KO0B 2A10A 4QZVB 3IC1A 3GR0A 2LVWA 3QWUA 3ZZYA 3MM8A 2UUWA 4TN2A 4KHRA 5K8PA 1TL7A 3DDIA 3OR1B 3MR2A 5KFZA 1RCXB 3G6YA 2ACMA 4JOUA 1HBOA 3CJKB 3FC9A 2F9DA 1HWKA 4C98A 2W9CB 3TZYA 2LXIA 4ZVSB 2W2NP 2L41A 3ONQA 4TQSA 4I7FA 4FYWB 2MY8A 4DS4A 4YQWA 2ZVSA 2UXCJ 2ZBRA 3GMGA 3VALA 5C2GA 4DR4F 4JI6F 3HMJG 3W8GA 1QVFR 5J2QA 3JSMA 1G3OA 5L38A 1VISA 5DJBA 1F1BB 2BJ7A 1U8SA 4USUA 1KHWA 3NVLA 4N77A 4NI2B 4E2FB 2YWHA 3CCTA 1N88A 1EP4A 4HACB 3K57A 2QGFB 4PPDA 4ZLPA 5HATA 2XULA 2B51A 2D3OR 1HIYA 2DHHA 3BO2A 1HBUA 4RW8B 1HQUB 2J6UA 4TVAB 4B9NA 1JKHB 5J1EB 3IRWP 3E51A 1VI7A 2Q6BA 1F3VA 1KVKA 4DL2A 3T00A 4G1IA 3GV8B 1EI6A 2NYIA 2C42A 1KD1T 1VR6A 1HMVB 4ICLB 2CQGA 4F0KA 2QE5A 1VC5A 4WK1A 3VAGA 1ELOA 3AD7C 4CYSA 1JLEB 1S9EB 4NYOA 2CADA 4H54A 2PGCA 1S1UB 5LOQA 2ZZNA 4KM4A 1QSLA 3OFGA 2IA6A 4PWDB 2ZM6F 2ANHA 2JH3A 1JQGA 1ZTWA 1QTMA 3RJMB 4I0WA 2J7WA 1NK8A 1P1TA 1VS3A 1R8CA 2I8EA 4LQ9A 1Y4ZB 3CE8A 4NA1A 2JLFA 1UCNA 2UUBJ 2DR6A 3B6BA 4E0DA 4NWJA 3LW5C 3TVZA 4I6AA 1OQ6A 3H98A 2MB0B 2GGPB 3AJDA 3AY0A 2V50A 1RKJA 2XS2A 2HFSA 2X1FA 3RAMA 5DLWA 5LM7E 1FWKA 2R2RA 3E2EA 3VTIA 3MUTP 4ZJOA 2KHCA 2DGSA 2VA3A 1IJEB 2CNNB 2VHGA 4LQYA 2MLXA 3H20A 2W5WA 3I31A 5ADZA 4QIWD 3KK3A 5ETOA 3MMAA 2YKAA 1KONA 3GP9A 4CIOA 4DSEA 2Y9HA 4F8RA 4CTAA 3I9V9 2DEIA 1TTHB 2I5JA 5LL6d 1KNZA 4CXUA 3C3LA 2DJWA 2KFNA 2AJFE 2VPYB 3ZZPA 3D6TB 3BGUA 1T8EA 2VONA 4L6V3 3GYNA 1HD1A 3T02A 5E3QA 4FYYB 3PHTA 1UAWA 3G9CA 5GAHI 2ZZMA 4IR1A 4ZDNA 3Q24A 1X4HA 1AFJA 1LWCB 2CQCA 5ETRA 3MK2A 4WF9Q 4RO0A 1RWPB 4KH0B 1ACMB 4MKVA 2BKOA 2J0QD 2W1BA 2CQIA 3HSGA 3KMQA 4ZVEA 1U0HB 1T9WA 1CJKA 3PRDA 3VR1A 2AIRB 3FZ2A 3J7YI 2EWHA 3H59A 1ED8A 2YWGA 1URAA 3ZXWA 2LDYA 3R9LA 1RWMB 1RTIB 1UFKA 1IVZA 3TUJC 3MPDA 1HWUA 1RBLA 1O51A 4CNZA 4AE5A 1YJWS 3GCWP 3G6ES 2D7SA 1ZOTA 2IYGA 3M6WA 4MAKA 3BDGA 3MHYA 4ZP7A 2PA3A 4YOEA 4W90B 2XB2D 1UVLA 1CS4B 2F40A 5IV4A 2JJ4D 3JS9A 2EEYA 3ZZTA 3DLEB 3I4HX 3P96A 2H51B 2MQNA 2BQUA 3QAEA 3FZBA 4LRCA 2QX0A 2GW8A 2ZJPQ 3KNAA 1FCAA 1NDLA 1WOPA 4IRCA 5LMNJ 5KFKA 2PO4A 4UOHA 2PMWA 4KE5A 1U49A 1QUPA 4YB7A 3CJ2A 3GR1A 3LGMA 4MFBB 1XMOF 3FJ2A 2VPXB 3CF5Q 2VJVA 3N6NA 2YX7A 3I0SB 3J7A1 1TUGB 2OFHX 4DXLA 4DR1J 4DV3J 1W2IA 3I5CA 1ZZFA 3ILOA 4YFUA 2H5JB 1NK4A 3BGRB 3QZ7A 1WHYA 2E66A 3CJTA 5K8NA 3BBBA 2YNIA 1W25A 3R27A 1HBMB 3SCKE 3D67A 2LA6A 4NASA 4USJC 2WK4A 4M5IA 1VCTA 1M5VC 1H2UX 5HL7Q 4XPCA 3OVAA 4K2XA 4PAAA 5LSOA 4OZJA 1VQ9S 2U1AA 4C6AA 3NS7B 1FKPB 3D68A 4YB5A 4H4MB 4ZPDA 5MAOA 2A18A 1QSSA 2NPFA 4K4YA 5J2MA 2ADBA 3GJRB 1L3SA 1LWFA 5HQLA 1TMJA 2M88A 3KLGA 1RHJB 4ECXA 4DR3F 4YUDA 2EI5A 1NLKL 1JLCB 3C14A 4FF4A 1NDPA 3HD1A 3J80U 2JX2A 3EZUA 1J5EJ 2DR5A 3NKPA 4GO7X 4Q2MA 1CPZA 4A8YA 4C3MA 4TNOA 3NKRA 2W5VA 2KT3A 3HXMA 2ALZA 3PYEA 4JI8J 1VQYA 1F9EB 3DRRA 2JLEA 5DDRC 2IYIA 3R6GB 2QMXA 2KXFA 3SFGA 2ZOMA 2MGZA 4HTIA 1MMDA 1VDHA 4Z7YA 4JV0A 5EWFA 2QA4G 1WG1A 2RNEA 1REVA 3CCSS 4NLDA 4C11A 2FB0A 3J81U 1FHTA 2VFSA 4CLKA 3ILLA 3CW2C 1TELA 1VQ7S 1UMJA 1MWZA 3U1MA 1WUUA 5J1PA 4WXOA 5GAGU 3RBDA 3DLKB 5KFWA 1RP5A 3NBPB 2E5HA 4OX8A 5I3UA 1P6TA 4HT5A 2O5DA 2R7XA 4DU8A 1NCLA 3CMRA 5BJRA 1TKTA 3TO8A 1QAXA 1WDDA 1IR0A 4Y2AA 2RILA 1CBKA 3MM7B 5KTQA 2R8HA 5GOVA 1WF2A 1Q16B 3T1YF 4KFBB 3VCDA 5EX0A 3ITHA 2N82B 3MAAB 3DRPB 1ALIA 2B43A 5HJXA 4UY8T 1HNWJ 2MTLA 4J9OA 4NCGA 4C0OC 3F73A 2KG0A 5KFYA 5KFGA 3JTOA 4UF4A 2B3TB 2XLIA 4BLGA 4RNMA 1LQ9A 1NSKL 1HNXF 4EU0A 1ICEB 1PSDA 1RU1A 2VG7B 3OUYB 3LWMA 1JXVA 2CQDA 4DV1J 1S1WA 2M3DA 2R7OA 3SYZA 1Y00A 5H9EK 4LMZA 1SJ3P 1T0TV 3BQ1A 3WIVA 5KFUA 1U45A 1GXUA 4DZ6A 1C2PA 1VQPS 1P9YA 2LXFA 2HWHA 2FQQB 1HYSA 2DGOA 1I1GA 3MM5A 1Y0HA 1RZMA 2C2MB 2HHWA 5AE2A 2GHVC 4QR0A 4BCAA 1I51B 5F8GA 2MHNA 2JSXA 3FBBA 2NPIA 5J2PA 3N6MA 4FVMA 2K7JA 2YH0A 5ITHA 1RTHA 1O0PA 4G6VB 2GJFA 4R8UB 1S7IA 1IQTA 1KQGB 2AYEA 4PCQA 3CWJA 4NLRA 1JLFB 1FRHA 1QDUB 5LMUJ 2FVPA 1TZ0A 4DV2J 2Z2LA 3HKWA 4B3MJ 4ZVOB 3CIZA 4AT1B 2GCFA 3M6VA 1Q8LA 2G1HA 3PKYA 4UQGA 1KOOA 4FXVA 4ELUA 2K06A 1JLBB 3K5NA 5JUMA 4F3MA 5A8RB 1WKLA 1FVQA 4OYPA 2XWYA 5CA5A 2OEKA 1SQGA 1KDNA 1DARA 4W98A 1H2VZ 1HI8A 4LSLA 1YVFA 3PW5A 1NKCA 4UT4A 1X5TA 5B7WA 2JFKA 3FRYA 3Q89A 1HBNA 2WBRA 4J9SA 3LP0A 3IS9A 4AFFA 2HNDA 4NYPA 3U1NA 2PI5A 2HQCA 1NSQA 2JC0A 2BE2A 1K0VA 1GTHA 4UORA 4R5PA 4UOOA 2AMCB 1RBAA 2AJ0A 3PFOA 2ZH6A 2IM3A 2IM1A 4KV8B 2R7TA 1VC6A 4LRAA 1M90T 2K1RB 4LRFA 5EWEA 1YWXA 1FFWB 5SZTA 4NEZA 4CI0B 1ELXA 4CH1A 2DNZA 3GILA 3PYDA 2F4VJ 5C2CA 2VBXA 2NSCA 3JSRA 1YSJA 1NEEA 2DNPA 1S1VA 2HHQA 3Q22A 2W4DA 3TZZA 3K0JA 2IVFB 3IBFB 1UFWA 5LXYA 1X9SA 3I87A 3E3XA 4CP5A 3MPVA 3X3UA 3BSNA 1KKHA 2VUGA 2HGNA 3M8PA 2MQLA 1TK5A 4DPUA 2O67A 3AXKA 3D1HA 4X84A 2OP5A 2RRBA 1FNXH 3ENWA 3H4DA 1YJNS 2A2DA 2BRLA 1DJ0A 4QWDA 1C1BB 5CZVA 3WBZA 4MK9A 4L3KA 4DMZA 2H3EB 3MCOA 4CXKA 3I82A 1HWIA 2V67A 2EK1A 4KYZA 2J6SA 1SJ1A 2HNYA 4IR9A 2GAGC 2B5JA 2FLLA 3IFEA 3LTOA 4YB6A 1X5OA 5KFHA 1CULB 2GIFA 5RUBA 4WFNQ 5E7OB 2HQIA 1CQNA 2HBZB 3NKYA 5E41A 2NLWA 3HSZA 2FJWA 1NPPA 3WX4A 3PW4A 1IM6A 3D5MA 3WZ0A 1HQ2A 1Q8BA 2KH9A 4KTQA 2B9EA 4PG7A 2OELA 1LK7A 2J5AA 1KS2A 5GAGI 3FKBA 3ZTOA 1O8BA 1RAJA 2BEFA 3MECB 2D9PA 2YKMA 1PG5B 2LLZA 1WHWA 1LW2A 2ERRA 4IQMA 1TKXB 1SV5A 3DM2A 2HVHA 1F3FA 1WEXA 1N5YA 4JV5J 2PT0A 2NXNA 5F3TA 2UVUA 3VAMA 3ZZ0A 2GJ2A 3BZQA 2GSOA 3OTBA 4X4NA 2XNQA 1S48A 3VZHA 4O44A 4FKXA 3TA0A 3DMJB 2RQCA 3K5PA 2RT3A 4B3RF 4OYXA 3M8YA 2VG6B 4LF8J 3AA9A 1B8JA 1KLNA 1IQZA 2OAUA 5A0YB 4A4JA 3MMAB 1P27B 5IQ6A 2YKNA 2OLWA 2MZJA 1Y5IB 1KH9A 5B0AA 3HKZD 1X60A 3JSBA 1XQIA 2UUAJ 5ETSA 5DG7A 2C2OB 1SBRA 3W62A 1RBOB 4QYZK 4AL6A 3IG1B 1VOMA 1SQFA 1X5SA 2JWNA 3EGWB 1VK8A 4KBIA 4ZGAA 3HSDA 3ET6A 2ZOFA 2KB2A 1AT1B 2ZBIA 2MMYA 2HLUA 2QLJB 3CMAS 2CG4A 1MWYA 3O2IA 3EM1A 5IS2A 1TP7A 1NK9A 3W5YA 3HPOA 1LW0B 2UU9J 2ZD1A 2ZBQA 3HHDA 4RU9A 1DRZA 3CCUS 1VYAA 2K2PA 2I0XA 1NJIT 4CLTA 4QPXA 2BJEA 2CJXB 1NK7A 3W66A 3ENQA 4PR6A 1PYTA 1W26A 3WDOA 5KFBA 4UY85 2FVSA 3K17A 5IT0A 4K4UA 2EFPA 1VRUB 3BGLA 3PO4A 1DZ5A 4X4QA 3A4TA 3THTA 2KVQE 2BM0A 2OPPB 1HQAA 1DHMA 1HW8A 1T05A 3UN2A 1XERA 4DL4A 4ZLLA 3WC2A 4ZLNA 3LPYA 1RHKB 5BXIA 3SDEA 1RTZA 1N32F 2DRBA 1OMSA 4TY8A 1TKZB 3PR4A 3BDPA 4ANDA 3T5HA 1NMEB 4WYLA 2GV1A 3QIPA 2L9DA 2RUSA 1S4FA 1AYEA 4DSJA 3HHNB 1Y5LB 4ZVTB 2XO6A 1CQMA 4X4TA 5IOLA 1B7YB 3OL8A 1RT6B 4QAXA 5AXLA 3GIJA 3FSIA 4K4WA 3OTOJ 2ZJQQ 1ZAWA 1EQ0A 1KH4A 4WIQA 3IRXB 3KD8A 4O4GB 5L9NA 3DYCA 4XK8C 1V3RA 2VBWA 3HJVA 1N52B 1CC8A 5HQ8A 2VQEJ 4DI6A 4OHXA 4HI1A 4ANEA 4I2QA 2BRKA 3OTEA 1KVJA 1XR7A 3UVJA 1GXTA 2ASDA 4B3TJ 1S1XA 2KYZA 1AB8A 1LFPA 4CO1A 2LU1A 4UUXA 1U1NA 2Q79A 4DV4J 5AE3A 4HH0A 5B0BA 4WTYA 3B54A 1JJ4A 3CEDA 5LJ5Y 1IKYA 1K47A 2KKHA 5GVQA 3G71S 3RZAA 2W5TA 2DNMA 2IAJA 5FD1A 4L75A 5F0WA 1CVJA 2E1AA 4U7CA 2RVJA 3ISZA 2XR9A 3NS6A 4G1QA 1I94F 4DCPB 1XWLA 4ZPTR 4ECRA 1FERA 3OL7A 1P9QC 5IM0A 1GAOA 3PW7A 2B4PA 2DEJA 3VGUA 2BW2A 4K8RA 1BMQB 2X51A 2LMIA 2BDPA 3ZC4A 1VQ8S 2KZMA 2WW4A 1YG0A 2KJVA 4DR2J 1U02A 3TUPA 1X4CA 3QT6A 4K50A 2CQPA 4IQXA 3POTB 3GJSB 4F2RA 2E5GA 4JI7J 4FYDA 1H0HB 1S72S 2FJVA 4RW4B 3QO9B 4WKRA 4JI2J 3JYTB 2ZH2A 5SUHA 1RT4B 4LUBA 4WBFA 2KN4A 3IBCB 2IRUA 2Y8YA 1RJJA 4B9UA 1FEEA 5C42A 1FRLA 3OVSA 4LBHA 5KG0A 1Q4RA 4OHYA 2RJZA 4O3QA 1HD0A 4WU2A 1TR0A 4KSEB 2IDEA 1N2KA 2CFXA 3QJLA 2FVCA 2ZFHA 1TL4A 2WONB 2B4OA 1B64A 1N2LA 4ID5A 2DH7A 1LV5A 3V4IB 2VG5B 3GU0A 1SHQA 1Q53A 3KLHA 3HI9A 3K5LA 1T9YA 2D69A 4MHXA 3L7OA 2B6AB 3NRBA 1Q5YA 4F4XA 1Y3KA 4DUYJ 1VRTB 1IBCB 4URQU 1RT1B 3QQCD 2MKSA 2WVBA 5LMNF 2V9KA 5ETVA 1X4DA 2WVCA 2A6MA 5HJYA 2DY1A 1N0UA 2PMZD 2BZ2A 3CJSA 2Z4PA 5KG4A 4DR1F 4ZP8A 3GSIA 3M2UB 1ULRA 2CQ1A 3W9JA 5DDPC 4O3RA 1EARA 2QL7B 5C24A 3M30A 1CLFA 4GTWA 3N79A 2P9CA 1WC5A 5LT5A 2W2PP 4I1TA 1GH8A 1V3SA 1NHUA 2ZHOA 4DFMA 1AJAA 2OO4A 5HI7A 4BS2A 3BN4A 3FMWA 1MU2B 3HHLD 3HVWA 5HBMB 1S77D 2G4BA 2HFZA 4N5SA 2YNGA 3GZ7A 1QE1B 3H2UB 1R0AA 3TZXA 1T7PA 2HKEA 1HNIA 4ZLJA 2ZDOA 5CABA 2MZTA 2YWFA 4LSZB 3Q23A 3LO3A 3DYAA 5HVGA 4AL7A 1GTEA 1WC3A 2ALYB 2RE1A 3P45B 1WC4A 5CZXA 5A8KA 1V5VA 4OYOA 4LR8A 3GV7B 5EGHA 4ATNA 1E6YA 5CH7B 1J5EF 4I64A 5D0GA 5CYMA 3SV4A 1FRMA 2EG1A 3KJVA 3K5OA 2Y1IA 2G0IA 3D66A 4WCEQ 1DLOB 2GO8A 4ZG7A 4JI8F 3DOMB 2CJ9A 5JMNA 1JXLA 1EX8A 1FWPA 1SQEA 3CDEA 2QLBB 1RQ0A 4P7VA 2KFZA 2DNHA 1U2FA 2R7SA 3KG0A 3W8PA 1NO8A 2VC1A 1FVSA 2V8GA 3HFVA 2GQQA 3IS9B 3K8VA 1NK6A 4ECTA 2Z30B 4GVBB 4KGMA 5HROB 3OQ2A 2HVIA 2BOPA 2FZCB 3PFEA 2C3OA 2GIRA 2OPSB 2W2MP 2MJUA 4R5PB 4MY4A 1N5VA 5E2QA 1VJQA 4DR7J 3TRGA 2W8LA 4K5SA 1WACA 2OH2A 2VL1A 4F4ZA 6AT1B 3HF5A 4D3HA 3KTQA 1FNMA 1NB2A 3CD5A 4HI2A 2AYGA 4N8OA 4P7TA 1F5AA 3AOAA 2OTJS 4KRWA 3FBFA 1UA1A 1C0TB 4NRUA 5ETPA 2QG9B 3HZGA 4NLPA 1FJGJ 1KOHA 1N54B 3H40A 3CC7S 2ZH4A 4M5GA 2EKYA 2GMHA 4J91A 1HNWF 3MEKA 3K2YA 4ZMMA 3RAQA 2CG8A 2HIYA 5J1NA 2OMLA 4CM0A 1X5PA 1UTAA 3UD3P 4NZ7A 4PQUA 3MEDA 2M5YA 1FRXA 3OFFA 2PDAA 3I4PA 2XI2A 1XR6A 2AEJA 2VU5A 5DETA 3MFHA 1SC4B 2HHHJ 4F02A 5D0RA 2FY1A 4BC7A 1EZZB 4FN5A 1RB0A 4DV1F 3G87A 3M1VA 2EXUA 4N56A 1RT3A 4C8LA 1O5JA 4OHZA 1HARA 1HNVA 2F1FA 3QAUA 4B02A 1RWOB 1JLAB 2V2ZA 2B8PA 3C16B 1TMMA 1SI9A 2OMOA 4IFYA 3OXLA 1HNZF 1FRKA 4IG3A 3HHLB 1E6VA 2O66A 1RACB 2M9KA 1E1ZP 2XMAA 2CDQA 5FDLB 1JJ2R 3JSYA 3R2CJ 4A8QA 5DZ7A 5EX3A 5HP1A 5BR8J 3PVXA 1BY9A 2HAFA 4EYIB 1EB0A 4OYBA 1XIQA 5BYQA 4DFJA 2L9WA 3W2VA 1YKWA 5DQIA 4KHMA 4I67A 1E3CP 2WVDA 1RAFB 4OJHA 4OZ0A 2MKCA 4KR0B 4USWA 4ZPBA 3M4XA 4YDDB 2CNOB 3RR8A 2JOQA 1EKSA 3Q8PB 2KM8C 4CYUB 4JI0J 4F2SA 3UNGC 3Q8YA 1IBMF 1KH5A 4HR2A 2LEPA 3LUYA 4F7VA 1AUKA 5HMWA 2HZVA 1KHKA 3OR1A 1NXIA 2HK3A 1AXQA 1N36J 4DSFA 1VQ6S 1CC7A 3D6FB 5ETTA 3EGZA 1NKBA 3CJKA 2WHOA 3CJQA 4DUTA 4Z37A 2W9CA 3H5YA 3DLJA 4K5RA 4DPTA 1DTQB 2L08A 4MKAA 1UJ6A 2B9WA 2Q6CA 1ANJA 3MMJA 4LF5J 4KIAA 1Y7PA 1HHQA 2LQBA 1VQMS 4DV0F 4RLEA 2IA0A 5A8WA 4NI2A 4FF3A 3IR7B 5KFQA 4HACA 2COLA 4M1KA 1BQNB 5E3PA 1OQ3A 3NAIA 4NYZA 3BQ2A 2B8QA 4M5DB 3MK0A 3QIDA 3U02A 3THPA 4RW8A 4WWSA 2W24A 2A3JA 2GSUA 2CIMA 3QRQA 1HQUA 3HZEA 3PKMA 1RWKB 2CUYA 1JKHA 4H4KC 5J1EA 4B9LA 3M32B 3TANA 3DLHA 3R1LA 1PGZA 2YQ3A 1SKWA 3GLJA 2FIUA 1R8HA 2DNLA 4ICLA 1RAIB 1C0UB 1VIXA 3PR5B 3OJUA 4UZBA 4O4RA 1RK8A 2DRDA 3U1LA 1JLEA 1S9EA 1HW9A 4OFZA 1S6OA 2P8IA 1FKOB 2V8HA 1S1UA 2ZH1A 3OSPA 2FLNA 1QTNB 5IWAF 4DL7A 5LSRA 1NU4A 4ES2A 1ZBTA 3RB4A 4HEA9 2DD8S 4J90A 3IM8A 2H65B 2G9OA 2QA4S 4FPIA 1WTFA 1U25A 1UVKA 1ALHA 1WSVA 2N3OA 4L73A 4ZVFA 3TA2A 4XTTA 1X8DA 2CWXA 5A76A 1UW9A 3R1HA 2GGPA 1UWBB 5DLGA 1TFWA 3E2DA 4CLFA 2X1BA 4FPRA 2BQ3A 1FJEB 2E1MC 1D9AA 5DLVA 2ZH3A 3MZIA 2EFVA 2GQCA 1U6BA 4ZJQA 1SL0A 3GCXP 1XK8A 1PAUB 2G0JA 4CXSA 1X4GA 5ETNA 1L3UA 2Z2ZA 2VASA 4ZKAA 3JQJA 4ES1A 2J7KA 1RA7A 2DIVA 2CJAA 3NMAA 3JAMY 4PUOB 1K7HA 1UEUA 5D3GA 1WF0A 1Q86T 2XSFA 1FK9B 2ZWPA 1JXEA 4AQYJ 1TUWA 4ZCIA 1Q8IA 3VWSA 4ED0A 4LF8F 4Q5VA 3P49B 3W65A 1EW9A 5HMXA 2JRSA 4EGLA 3A8JA 3F41A 2BKPA 4NOHA 2ZBPA 3KXDA 4FNIA 1FJCA 4G1QB 1LWCA 2DXFA 8ATCB 3KLEB 2HNZB 1VBZA 2W8DA 3JTNA 3K7RA 6FDRA 1TK0A 4IDKB 4FF2A 4M5JA 4USTA 2KJWA 4XAKA 2FC9A 4DOZA 4DBQA 1YZ7A 4C0HA 1X4EA 2XTJP 3R3TA 2PN6A 4DV6J 1U0HA 1PYOB 1APSA 4TU7A 3D9BA 3T6JA 3EXCX 3K89A 3MM6B 2X7IA 4Q2LA 3CCWA 4P72A 2CJQA 3HLUA 2UU9F 2LP4A 2NXEA 5FLXY 2M52A 4P9SA 1RTIA 2H4YB 3LP2B 1VHIA 2MSSA 1N0VC 1OIAA 3OBIA 3M8QB 1L3TA 4D3GA 5A6PA 3HFKA 2EBEA 5C42B 5B0FA 3PW2A 3IAS9 5KG5A 2AEFA 1ZM3A 2ZUGA 3B4MA 1CS4A 1SXLA 4B9VA 4FDFA 1B0VA 2QZUA 3DLEA 4KHPJ 2ZE2A 4DR6J 1DQ9A 1YI2S 2BJDA 4X66J 1VFJA 2IMWP 4PABA 4ZA1A 3M2VB 2CVIA 3BBFA 2ILZA 3U7JA 5FIIA 4QCLA 3CSKA 5ETQA 2RDJA 4LVNP 1FFSB 3ZZZA 3BO4A 1CJTB 3OTCA 3I0SA 1XMQJ 3CDUA 2QL9B 1GNKA 4KAIA 3RTVA 4DF4A 4C8YA 2WSFC 1N4LA 4WYWA 3UQSA 3BGRA 3VQTA 1SL2A 2J0XA 3BQ0A 1IKWB 2C3MA 3N0VA 2WBMA 2AZ3A 4JI3F 3PX6A 2GX8A 4M5HA 2XNRA 5B0EA 4EMDA 3OTOF 1OSDA 1GQEA 1YLXA 3PEJA 4QWCA 4DPWA 1IR1A 1PO6A 3S8SA 3H25A 3I9ZA 4ECYA 1VQNS 2CXEA 3NG8A 5C24B 2J8AA 1FKPA 3MPYA 4H4MA 5DG9A 2I2YA 2CJBA 1JLGB 4UOCA 4ZN1A 3JB9k 2VQEF 1U09A 1MW7A 1V3ZA 2QFJA 5JVHQ 3AB2B 5F8JA 1RABB 1KWMA 2QLFB 3AH6A 1YITS 1U1OA 4DPYA 2D41A 2FC8A 4B3TF 3CCZA 3PTWA 3VGSA 1WD6A 3PYGA 2E9ZA 2B7BB 1GT8A 4CLYA 3UDCA 4GC6A 2CDRB 3LF0A 1JLCA 4DV5J 2DK2A 2Y1JA 3DCAA 4EBDA 2G9YA 3R7NB 3QATA 4ECQA 2MKYA 3CO9A 3MFIA 3T6BA 2SXLA 5C7PA 1WSRA 2VOPA 1NHKL 4LF1A 4JUZA 4DCJB 3NGUA 3MR5A 1KP6A 1HQEA 2NREA 4A8XA 2R8KA 3J7AN 4ZPWR 2E9RX 5A6WA 3DRXA 2FD2A 2V4JA 3A8KA 5DZ6A 5KT5A 4AYBD 4YY3J 2UXDJ 3PV8A 2FLPA 2CPDA 1GMWD 5D4NA 5L1JA 2XM3A 2YY3A 4C9DA 4NLQA 2PFFB 3A8IA 2R7UA 1OPIA 5K20B 2HAIA 2HFOA 4OI2A 1RCOB 1Z4UA 2VH7A 3UR3C 4CLUA 2IJRA 3RBZA 4JI7F 3NBPA 5L1KA 2CWKA 5EGEA 1YJVA 2PD1A 3R5DA 3LH2S 3GV5B 4JB8B 1LWXA 4ERDA 2LA4A 3PW0A 2ADCA 1NHVA 3C66A 3TWZA 3MM7A 2OTLS 3W2WB 3PZPA 4CZCA 4ZJLA 2M2BA 3S7RA 4F4AA 4B3SJ 3UCGA 1SC1B 4KFBA 2GS8A 5CXTA 2B56A 1K73T 4LR9A 5D0EA 3ULHA 3BR9A 3MAAA 2HHUA 5IJSA 3DRPA 1W2BR 4Y3CA 3D4JA 2WOMB 2D1CA 4CO2A 2F9JA 3BJYA 1DY3A 3PDNA 3A3PB 2HRYA 2W2OP 2WSEC 4YEAA 4CDIA 2ZC4A 1OPZA 4YR2A 4P73A 2D3UA 3VQSA 2W5XA 3SQGB 3H0PA 2RH6A 3B8HA 1U24A 2NXUA 4P2XA 1U0SA 3NWRA 2VG7A 3HJFA 3OUYA 3FBCA 2CNKB 3UFCX 3EVOA 1SH0A 3LGHA 1Q0NA 2PC6A 3HFZB 1F9FA 4USMA 3NNHA 1BD6A 4V19J 3MEDB 5GRRA 3SBMA 5EUHA 3LAMA 5BYSA 3TAQA 1PILA 4URSA 2G13A 4AD6A 4KH1B 3GJQB 3GSDA 3DGPB 2X1GA 4N76A 3M1VB 1IBKF 4RWWA 4UPHA 2EFGA 1G1XA 3J7YU 1B0TA 4FYVB 4DG1A 3DHWC 1AUDA 4OYWA 3Q3QA 4Q43A 2V4QA 3UN3A 2YXLA 1E6VB 2BXJA 3CMQA 1ZH5A 4R8UA 4NXNF 2ZH7A 4ZVRB 2XG8A 2OEMA 5E3CA 1Q1KA 2EG2A 1A7GE 1JLFA 3V4MA 5IJQA 1SKRA 3H5XA 3K5MA 4RW7B 4LFAF 3LQVA 4YMEA 2R2UA 3KLFB 1QAIA 3GFZA 2JEJA 3NGTA 4ZS6A 1JLBA 1VBXA 2GNKA 5A8RA 4EYHB 1G7CB 1SKUB 5KOXA 4DR5F 1RGVA 1R89A 3V81B 1ZETA 3T9NA 4TY9A 1IKXB 4URGA 4EO6A 3M9MB 1YIJS 5EHHA 4ED5A 3G86A 2Z58B 4PG6A 5JJBA 2XYGB 4NWBA 2K7KA 3FCHA 4RUHA 2IBKA 4ELTA 1IXKA 1DBDA 1Q5VA 2BJ1A 4DR4J 4JI6J 4LF7F 3SI8A 1Y9OA 2L9NA 1HHTP 1OY9A 3DC2A 4NZ6A 1GX6A 4UOGA 3QRRA 5KFPA 4MK8A 1R3NA 1NZ8A 2J6TA 3NKOA 5B0GA 4C3KA 4KV8A 3G6VA 3VHQA 3EXYA 3JAMU 1KFDA 2K1RA 1LFWA 5CD4H 1H98A 5A8WB 2HHSA 2DNOA 3CDWA 4J5OA 4MMOA 4IOAQ 3UN5A 2HURA 8RUCA 3R97A 2FJEB 3J7ZT 2XY5A 3DLGB 3TX0A 2JC1A 1WC6A 2ACYA 3TAPA 2GMJA 3JTPA 3BYPA 2FYXA 5B08A 2LYVA 4DR7F 3KJNB 2M0GB 3T1HF 2XZDB 2LFVA 1OY6A 2DB1A 2GFFA 2HRUA 2LECA 2OD6A 2QJ3A 4U7UK 4R0JA 1Q78A 1WEZA 2CVEA 2DY9A 3BBCA 4FP9A 9ATCB 4I56A 1B0PA 2AZ1A 2J9DE 1C1BA 1BQXA 5ETKA 1MN9A 3KMSA 2R4FA 4HKQA 3U27A 5IV3A 4AUKA 4DLGA 1NM2A 3IAM9 2VKZG 3BB5A 1ALJA 2UP1A 2UUTA 2ZEJA 2G0CA 3I6PA 4YS2A 5FLXU 1IBLJ 3CJ3A 2DH9A 4B3OB 2J9DA 1CULA 1T9UA 4F25A 3RU0A 4NMLA 5D4OA 2K3IA 4DX7A 1D8YA 4WTOB 1AJDA 2YKQA 1G4CA 5KFDA 4A8MP 3Q8SB 2R9LA 9RUBA 3R5CA 3LPEA 1A9NB 4ZVHA 1ZEFA 3FEZA 1X4FA 3MECA 4LRBA 5ETLA 3DOLB 3IA0A 2ASJA 2MKIA 3KG4A 4DU7A 3WAVA 3DNCA 1TKXA 2AP6A 4GTYA 3IDDA 1WJ9A 2ZOGA 2AF6A 2LQ5A 2DTJA 4NLVA 1SKSA 4KKOB 2XYPB 3VAKA 1HJKA 5IXUA 3BGOP 2X3DA 2RU3A 1SJ4P 3SMZA 3Q8QB 3DMJA 5BR8F 4M95A 3OD2A 1PJ6A 3RW7A 1VRQC 2VG6A 5L0EA 2IBOA 5EN1A 3MOZA 4QIGA 3E8OA 3NNAA 5A0YA 3MM9A 3LANA 1M5OC 2BMBA 4HLBA 1EAYC 1GEHA 5D3GB 3G8TA 2AGOA 2RKIB 3GIIA 3HCXA 2YTCA 2NSBA 4LREA 4GKKF 4ZVQB 5J2NB 4O23A 3I0RB 2DITA 3MR3A 3FMBA 3W9IA 3RGIA 4KAYA 4F3OA 3PYFA 4CM2A 3IG1A 4CQ1A 2A6OA 3IN5A 2FVRA 1KLMB 1FDAA 1N33F 3QYYA 5HSPA 2MKHA 3RBXA 1LK5A 4P2SA 2JZ5A 3BH6B 2VFVA 1LW0A 4ZOSA 4JYAJ 3NKMA 4LR7A 2B0GA 4W4MA 1S99A 4IUFA 3R5BA 3I32A 3TA1A 4C3LA 4IH5A 3CDAA 1RAEB 2EFOA 1PJ5A 4QJVA 2RMLA 2HHXA 3KK2A 4LBIA 4CLZA 2Y1RI 3CT9A 5DG8A 3R5JB 2XCAA 3ZO7A 3SCJE 1MSWD 2DHGA 4TXSA 1F9HA 1TKDA 3BDEA 2KO1A 2QZ8A 3H2VE 2BA9A 1GXLA 2D1GA 2XMUA 2R8IA 2QIFA 4R25A 2MYFA 3DXBA 1LWEB 4EI2A 1VRUA 1X9MA 1WC1A 3W5XA 5E5NA 3SQOP 2OPPA 4DZDA 2RRAA 5K4PA 5LRNA 3CPWR 4DN9A 2W5QA 3AB4B 4IOCQ 3GYXB 4DDFA 3QT7A 4M5NA 2ZE2B 1XEZA 5IFMA 1XMOJ 3GJTB 2ZC3A 4QW9A 1AZSB 1TKZA 1S6PB 3TZWA 2GAHC 3SZZA 4Y6IA 2XC9A 2FZGB 3OXFA 1XNQJ 3JXOA 1KHLA 3L7PA 2AWZA 1ROFA 2YX4A 4Z2XA 4QIEA 1RT6A 3S01A 1RI7A 3D0HE 2DGQA 2AX1A 3T9ZA 5F8IA 2OPQA 5K14B 2PSZA 2YQ0A 3RB3A 3IRXA 1YGYA 4O4GA 4PPZA 4O0NA 3PJWA 1KQKA 3JQKA 2ROPA 2DH8A 3CJ0A 5IC6B 4DF8A 2Z2YB 3ZZUA 2XLJA 4O0IA 3MDFA 4FDIA 2FVQA 1UVNA 3IGNA 3K59A 3UWTA 2GMLA 2XY7A 1SJRA 4XDCA 4K2JA 3B5QA 2JL9A 3UE2A 2DYAA 2Q43A 3MAQA 1FSUA 4BHQA 3RRHA 3UCZP 2E1CA 2Z2MA 4ZIWA 1HHSA 4FBTA 1K0TA 4LSNB 2GVZA 4I2PB 2QN6B 4NLGA 2QSWA 1U48A 4OX9J 4GKJF 3KUHA 4AQYF 3CVKA 1X4AA 5M2RA 4G65A 3DRSB 3C15B 3EDQB 1VQKS 2XMWA 1YJ9S 4NXMJ 4O3OA 3KK1A 1U1MA 1NZAA 2GLQA 4TU9A 5L0KA 3ZTQA 3NKNA 1I6JA 3H2LA 1HQEB 3MWBA 4RNOA 2AHOB 2W8KA 4LF6J 4WK3A 2ZH9A 4USIA 4CLWA 2YX1A 4DLEA 2UVRA 2OGUA 2V4JB 4KGVB 2R2TA 2IJNA 3POTA 3TJAA 4IRKA 1RDRA 3KJFB 1ZM2A 1U6ZA 4RW4A 3QO9A 5HMZA 3KWMA 4RU2A 3MTJA 3TUIC 3JYTA 2C2NA 4J9QA 1RT4A 3J7Z5 2YPYA 1AJBA 3RR7A 4MJKA 3SEOA 3BKTA 4K4VA 2DT9A 1WORA 4WFBQ 1VLOA 3N6LA 5CYQB 4X4OA 1YRTA 3AD9C 4K4ZA 1SIZA 3TQ1A 5CD4A 3LOUA 3M2RB 3QSYB 2G1DA 2RF2B 2MZRA 3VV2B 4LT6A 5I42B 1C4CA 3Q86A 2WONA 3SZYA 5KAKA 1VBKA 2LU2A 3V4IA 2VG5A 2C22A 1UKUA 4RBVA 1Q8KA 1ZPWX 2G2OA 2OHDA 3NCQA 1UVIA 3W9HA 3FFIB 5G4DA 4OYIA 1SUQB 2P6TA 1NDCA 2B6AA 2UUCJ 5HQMA 3SCLE 4KHPF 4X4UA 3K8WA 3A52A 3OPKA 1VRTA 3GFHA 5KFFA 3CULA 1EETB 1RT1A 1R8BA 1HNXJ 2DNRA 2HMIB 3O1LA 2BYCA 4CH7A 5I3PA 4HDGA 4M5KA 3RB6A 2YH1A 3F44A 4NA2A 4ZVPB 5KFRA 1F5CA 2W8SA 1XMQF 5HLFB 1U4BA 3PACA 2RUGA 1ZAXA 3AOCA 3T5KA 3M2UA 2VA2A 2MZSA 3V6DA 2D3O1 3AQOA 2NZ4A 1O99A 2NUUG 2NUHA 3B78A 1XNRJ 3ED4A 1CSJA 5TJ3A 1NB7A 2CPXA 5DO2A 1K8AT 2GIQA 3CMES 4ENOA 2VJUA 1MU2A 1JB0C 5CYJA 4A8SA 1TAQA 5HBMA 3NGSA 4CLPA 2F65A 1D8ZA 1QE1A 3CTRA 5HVFA 2QRRA 4DG1B 3D28A 1D9FA 4DN0A 2GVDB 1WG4A 2RQMA 2HZAA 3T19A 1NAQA 4PXBA 3D1QA 5LXRA 1FDBA 3EGVA 3MXHP 1FD8A 3NCPA 3C6TB 4IG0B 1QVGR 3H42A 4DV5F 1RT5A 2DBBA 1AJCA 2PIIA 1R8PA 2XSJA 3EICA 4ER8A 4JV2A 3G8QA 2B7CB 4ZPCA 3ZZRA 4ID8A 2CQ2A 4C8MA 1QJHA 1T95A 4IYQA 1LXJA 2F7VA 1DLOA 4TU8A 1FJ7A 3DOMA 3G6XA 3A8EA 3BSAA 1SCJB 4JI1J 3R7BB 4WKYA 2H1YA 1KSPA 2UXDF 2V94A 3PO5A 2H9ZA 1Z1ZA 4F0MA 5F41A 1T02A 4DUZF 4OJ1A 3QGPA 1LKZA 1TUVA 4KPCA 1M0SA 3H8YA 2ZHBA 1JMTA 4ZCMA 1S9FA 2V0NA 2JDJA 2K8GA 3MK1A 4QQBA 2HK2A 4GVBA 5HROA 1RWXB 1Q95G 3EE3A 3MOJB 2LQ9A 2OPSA 4ZVGA 3O6QA 2XMVA 3ICLA 1HWJA 2MZQA 1T9VA 4KB7A 3X1LB 1RHRB 3A1YG 3SXLA 5K9FA 3ETOA 2W5RA 3CCQS 1EQMA 3G82B 5E3RA 1U8WA 3WBHA 1TVRB 4B3SF 2WB1D 1NKEA 1JJCB 2XWXA 1C0TA 3MD1A 1X9WA 1E2SP 2L3MA 5AJ9A 2RH3A 4JI4J 1GMUA 3EZOA 2WVEA 4P10A 3ZTRA 4A46A 2ZKTA 4CO5A 2C2RA 2R7VA 4L76A 2BM1A 1IM4A 3BH7B 2I1RA 4U7UD 4KC5A 3UR0A 4N8NA 3AHPA 3FK4A 3MPUB 2RD5C 1RISA 3CIMA 4Y2MA 2MY7A 3MCNA 3N4WA 4QU6A 3RG6A 2VBYA 2GO9A 4PRFA 3KLIA 4KQZA 1HKAA 4ZVUB 5KFXA 1OS5A 1JLAA 1SPBP 1XMBA 3C16A 5KT6A 3HHLA 2G2YA 1QAYA 3IXQA 2PI4A 3DOKB 4X4RA 2Z56B 3CNQP 3GWCA 4QWAA 4B9MA 3A3NB 3EZ5A 5FDLA 2CPEA 1T03A 4DFKA 3AT1B 4QYRA 2HHTA 4KPYA 3AOBA 2VKRA 2WAQD 4H4OB 1RYRA 5LJ3Y 1D09B 3GG0A 5F8HA 4B3RJ 4EBCA 1S6QB 1TV6B 1RA6A 2P5VA 1P49A 2XI3A 4C7QA 1HDHA 1L3KA 7AT1B 4ZHRA 2HBRB 2YVSA 2CYYA 4CT9A 4CYUA 3E01A 2Z57B 4CH0S 3KFWX 5U47A 1TFYA 1D0EA 3TOQA 1FDDA 2X98A 1WI6A 3WQPA 1C1CB 3MM9B 2CPJA 2D3ZA 3HT0A 1U2CA 2KL8A 2DISA 5K8MA 2AYBA 1DTQA 2XS7A 1RHUB 2E9TA 1NH7A 4J9VA 2GA3A 4CCHA 1Q82T 3IWNC 5M2UA 2C3UA 4GO5X 2J7UA 4Y2IA 1RAGB 2YNFA 1M5SA 4E98A 2QA2A 4WFYA 4AL5A 4ZPVR 1PYSB 4E8UA 4F04B 1BQNA 2XO7A 4QW8A 2UXCF 4M5DA 2DPJA 4OV1A 5INHA 4W92B 2IRYA 3V6JA 4IOBA 3TX8A 5DQHA 2IIHA 1REGX 3PXGa 5L1LA 3KK2B 2ZNZA 1YRXA 3PRBA 4Q44A 2ZDPA 3M32A 4XO0A 4NLUA 3TJ8A 3H7HB 3VAHA 2IJFA 4WP9A 5KFOA 1NRKA 5DM7Q 3Q0AA 1YDLA 3TYTA 2XYHB 4RX6A 1C0UA 4C8ZA 2XHWA 4RNNA 1N32J 4ED4A 4OZ5A 2W9BB 4OI3A 1SC6A 3AJ2A 1FKOA 4J9NA 2VDIA 1U1KA 3FCVA 1QUVA 1T9XA 1IKVA 2DR9A 3PRVA 1NJZA 3FCWA 3NY0A 4WFZA 5DLTA 3DLLQ 3UD5A 4U8VA 2V63A 1M1KT 4WFXA 3QFWA 1J5OA 1S59A 5L39A 4RUAA 4EEYA 3OR2B 3TAMB 5KOWA 3D1OA 1RKIA 4ZP6A 4DX5A 5LSLA 2KU7A 2NXJA 4KGKA 1IWAA 2W5SA 1W7WA 1IBLF 1S6UA 2MLZA 4NLTA 4WJBA 2OPQB 4CO0A 4Q0BA 2FHOB 3CGIA 1UWBA 4ETXA 1U6FA 4IRDA 5L0BA 1S1TB 3CO0P 1RTJB 1Y5NB 1UEKA 2UUBF 1N5SA 2V34A 4P2MA 1KQSR 1B4SA 3UW1A 4ED2A 3MMBB 1H6KX 4WU3A 3PY8A 4LBPA 2FUG9 2XMJA 4GTXA 2RDIA 5CCLA 3C8YA 5D78A 3KHHA 3IR6B 1PIEA 1PKUA 4PUOA 1R6YA 5HO4A 4WIIA 4Y2CA 2N7CA 1FK9A 2V4RA 4YR0A 1M5PC 2YBVA 2LKZA 2MQ8A 3M8SA 2LQJA 2GVZB 1I94J 2MLYA 3BSOA 4ALZA 4KJDA 4KGZB 2X1AA 2HQFA 3MUVP 5CQGA 1N8RT 2D74B 5BYRA 2HZCA 1YX2A 3IR5B 3DI6B 4H4KA 1AFIA 3OL6A 2UV8A 3KLEA 2HNZA 3V5RA 2CZVC 4IDKA 1S12A 3KK1B 1PBAA 3NWGA 1PC4A 3KHLA 3ELHA 2DHAA 4PKDB 1VC0A 3PM9A 1D3WA 1NBEB 5KFNA 2CQ4A 4XDDA 1L5UA 2IUCB 3MM6A 4NA3A 2FHJA 3CXCR 3AXMA 4JYAF 1N6QB 3GG1A 1PC5A 1VMBA 2Z0GA 1FRIA 3LP2A 4P74A 3TARA 3GTYX 1JWWA 2XCPA 2QMWA 2GJIA 3M8QA 2D9OA 3D6HB 2WTFA 1TL3B 3OJSA 3C2PA 1WHVA 4DX6A 2V68A 3EX7B 1NK0A 3MEGB 3GB0A 1ZM9A 4PEOA 5AJ3J 2HGLA 1SL1A 2KTQA 1IR2A 3CD0A 4Y00A 3EVWA 2VBZA 5AXKA 2OPRB 1G6BA 3T1AA 2HRTA 1JLQB 4DX8H 2N4DA 2FJBB 1YHQS 2AT1B 3M2VA 1YRUA 3IM9A 5F8LA 2KVIA 3KG1A 2ASLA 2I6WA 2HPUA 3LALA 4X64J 1CJTA 4NLXA 4PYDA 1RAOA 4C8OA 4YR3A 3BKFA 4FKYA 2QA1A 2QO3A 1F5BA 3TUZC 4IFVB 1RXOB 3BREA 3G8SA 4Q8FA 1XNQF 2B4VA 3I5BA 4OYAA 3B4DA 1IKWA 4Q45A 3VGVA 2IM0A 1KN6A 2DNQA 2RHSB 4NX9A 3W5ZA 4WPAA 3FBEA 2MEWA 4DV3F 1S5ZA 1S9GB 4OZLA 3EYZA 2QC3A 1OYDA 5T7LB 1R7IA 3MD3A 3BF4A 2AJ1A 3V6DB 5T14A 3HVTB 3W7BA 8AT1B 1OWXA 1WKJA 1JLGA 5C25B 2MKKA 2VFUA 3N9UC 1VGYA 2XZTB 4J9UE 2UVVA 5GADU 1KC8T 2KRBA 5H9FK 3PHEA 2KG1A 3HVAA 5B0CA 3HD2A 1B99A 1BUXA 1RHMB 4P71A 2KFYA 3QNWB 2NCKL 4QOTA 1IN0A 1YZ6A 4IKAA 1KHNA 2AX0A 1F0XA 2L48A 2C2ZB 3LP1B 1ZYQA 1KHJA 2CNLB 1FO1A 5GMKa 3HHEA 1LNQA 4RW9A 3N5BA 2GA7A 2YNHB 3PJXA 4OI4A 4QIFA 2O3DA 5AXNA 4ED8A 4NLYA 3D0GE 2HFNA 1RT7B 2JLGA 3ENAA 2X3GA 3QZ8A 5KFEA 4OX9F 4DFPA 4J7CA 4EZ9A 4NE9C 1HPZB 5IT4A 4N7TA 1QLNA 3GONA 2BW7A 1RAAB 4I6WA 1RT5B 3OHBA 4UUWA 3G96A 3THVA 1Q79A 2XSJB 4QR2A 2DGTA 2QT7A 1WTBA 2LDIA 1QY7A 2DR8A 4NXMF 4RNHA 3SZ2A 1BHNA 3EDRB 3T41A 2J8SA 4B08A 4ILRA 2PEHA 4X2BA 2CA9A 3CB4A 5IZHA 4C2MA 2ILYA 4LF6F 1UZDA 2W7AA 2VFRA 2FHKA 3FQLA 3QJPA 4BDPA 2C3YA 2BJ9A 4MIBA 4DPXA 1XC9A 2JVOA 5C66A 2P2CB 1HI1A 4DQIA 1U1PA 3F56A 5CCMA 3D7SB 3NCRA 1H7XA 2HBQB 2BANB 1FX2A 2GHWA 2IVMA 3RRKA 3W2WA 2VQRA 4ECSA 1RTDA 4IH7A 4OHVA 3OFEA 2OUGA 2MKJA 3AJ1A 1GMVA 1V5IB 3L3CA 3SCIE 2A1BA 4ZP9A 3UDVA 5L1IA 3PG9A 2R7WA 2ZITA 2WOMA 4ZCKA 1WHXA 4OZNA 4P52A 3FSXA 4RW6B 4MIAA 1K1SA 4J9RA 1CJUB 3C6UB 4GVLA 1NH8A 3WAWA 2F63A 2JNJA 1ZA2B 4O3NA 1F2GA 1XN9A 4WE1B 1MWQA 2UUCF 3SQGA 4OZ1A 3GIMA 1ELZA 4X62J 2RHQB 3QGHA 4RKUC 3FGVA 4MH8A 1EHWA 3TR5A 3L95X 4ECUA 4JI5J 2WB4A 3RBEA 3VAIA 5THWA 4PWWA 4PG5A 2W7PA 4ANCA 3M8ZA 2FJXA 1N34J 3V6HA 4C8NA 2DGWA 2YKPA 2CPZA 2MQPA 4WP8A 4F50A 2XLKA 5G0RA 5KG2A 5D15A 3HDSA 4B17A 2CQHA 3S1TA 4UPIA 3M9OB 1T9TA 3PX4A 3DGPA 1LXNA 1MROB 1TL1A 1AW0A 3ETMA 2F4FA 1HNZJ 4LRDA 2RRNA 3H4BA 2V9WA 2PE8A 3KLIB 2HVDA 4QR1A 2DHXA 2XQCA 2XZWA 3SV3A 4DCOB 1XNRF 4OX7A 4IO9Q 2EW9A 5EWGA 2DNKA 3TEHB 3MF5A 2NS1B 2VB6A 4AXIA 1VHFA 2HVEA 2C3PA 1T03B 4OJGA 3IBWA 4TLRA 3LXQA 3MR7A 2AJ2A 1Y6VA 2CQ3A 4F4WA 3PX0A 3FVYA 2V8VA 2GZOA 2XS5A 2QL5B 4RW7A 1IBMJ 1V9OA 4PWUA 5B09A 3VAJA 3NMRA 2AYMA 3KLFA 1FD2A 1F2HA 1UJ4A 3QGGA 3PIPQ 5F0UA 1NPRA 4ED6A 4X65J 3W63A 1I5OB 7FD1A 4ZHRB 1SH3A 5GMEA 4JV1A 5LMUF 3V81A 3E01B 2R8JA 4K59A 4DV2F 2VOOA 1IKXA 2HHVA 4B3MF 4FVCA 3M6XA 3MM8B 1NDKA 2F8HA 3WHIA 2CJYB 4HYKA 1X0PA 4YP3A 1TL7B 1GMWA 1R31A 4A48A 1WKKA 4KJIA 1RSCA 1J2VA 3L09A 3CCVS 2GHPA 1HBOB 1O98A 2EPIA 4HVZA 3CCMS 4EO8A 4JI1F 1UPMB 4MYTA 2LQ8A 4DV0J 1H2TZ 3H90A 1RU2A 4LF4J 1MLAA 4YN3B 3FDSA 2KZZA 4MIVA 2WRMA 2DPIA 3MMCA 2BKNA 1K1QA 4I7FB 1DFDA 3TNVA 1UETA 2YNFB 1UW4A 1FT8A 3VVTA 1NUEA 4NPOA 5J2QB 3JSMB 3M6UA 2E7XA 2QLWA 1FXLA 2VIHA 1HI0P 2Y1LB 2CZ4A 3TW0A 3CCES 2EC0A 5GADI 2Q1LA 4FNHA 1BC6A 2FHJD 3DLGA 3LWLA 1EP4B 1BLUA 3FEYB 2HG4A 3FUYA 1SVDA 1TK8A 2HQDA 1Y7AA 2W9AA 5HK4A 2DCLA 1HBUB 2J9CA 1SC3B 3QT8A 1X7VA 2F4VF 3R8YA 1UVJA 2R7RA 2OKQA 1RAHB 2XMKA 4OV6A 4X4VA 3RB0A 1KTQA 2HS0A 5DDOC 3P4UB 4LVOP 2BUNA 1Q81T 5IWAJ 3QLHA 4DWIA 2DXEA 4JI4F 4OMFG 3DFEA 3MTKA 2R42A 1F6TA 3DU5A 5DQGA 2AU0A 1IKVB 4RUBA 2G2ZA 1YBAA 3MUMP 4B3OA 2NR0A 2YQ1A 1J5OB 4UOFA 4P75A 1Z2LA 2BQRA 2DRAA 4L3NA 4ECZA 4K0KJ 4C48A 4LIRA 2XBPA 3DKDA 3I96A 1RUSA 4DS5A 3IO1A 5HRTA 4CLLA 4MK7A 2E1RA 4RJVA 1SJQA 3DOLA 4ZG9A 2KM8B 2OJ3A 1FE4A 3BSCA 4Q0BB 5H9FJ 1FE0A 1FDNA 4LF2A 2AV5A 1WOSA 1KEKA 5A2QY 2MQQA 4B9TA 4KKOA 1Y10A 2I38A 5KFIA 3DHXA 2CJKA 5IC4B 5KXAA 5DM6Q 2ATLA 1WDTA 3UI3A 2OSQA 3NOCA 3OLBA 4OZ3A 2F8MA 4WZMA 5DDQC 3HHKA 1DTTA 3QRPA 1S4EA 1AROP 1M1GA 2BV3A 4RNFA 4JV5F 1X31C 2H48B 1CEZA 1UFLA 1M5HA 3BDFA 3US5A 2VV5A 3IMQJ 4OLOA 1X4BA 3KK3B 2QTWA 3D3BJ 2KYXA 2RKIA 4DSLA 3AAWB 4ELVA 2V2KA 4NCAA 2VD3A 1GK8A 1UP1A 4Y2KA 2ZBCA 2C2EA 5J2NA 4CTAB 3I0RA 2I5JB 2GSNA 1S10A 2JHEA 1U1LA 2JEFA 1KLMA 5F9LA 4OLPA 4DQQA 5E3AA 2ZHAA 3Q2TC 2CKWA 3W64A 5T41A 2UUAF 4RR5A 5EDWA 1DAXA 5HAOA 1AUSL 2IVYA 3OTDA 2F8EX 5K8OA 3EPIA 2CPFA 4J9LA 2HBYB 2E7VA 5DRKA 3AFGA 2UXBJ 3T5JA 2BE9B 1VQSA 1WELA 1S0OA 3O5TB 3NNCA 1ZS6A 4DSKA 1CJKB 4NCBA 3RUBL 1FRJA 1OJ4A 1R0CB 3CCJS 1CG2A 2OEJA 4USHA 1HL6A 3MCSA 1U26A 2U2FA 2IHR1 3ZNJ1 3L4BC 1LWEA 2BABA 4RBUA 3OL9A 2CPIA 1NSAA 2MQMA 5KFMA 2RQKA 2VDHA 3KDOA 2DNYA 1NNDA 4A8OA
chains in the Genus database with same CATH topology
1Y6VA 3T01A 4KAVA 3UNYA 3MK2A 1ANJA 2IUCA 5EGHA 5INHA 1P49A 3M8WA 2W5SA 4UOPA 1K7HA 5L0EA 4LR9A 1HDHA 5IJSA 1E1ZP 2GSNA 3Q3QA 3BDGB 3M8ZA 2GLQA 3WAXA 3UN3A 5L0KA 3NKNA 5DLWA 3T00A 2W5TA 3BDHA 3CMRA 4LR2A 3WAYA 5HRTA 1ALJA 1URBA 3MK1A 4GTWA 5C66A 3A52A 2D1GA 1EJJA 1EI6A 1N2KA 1KHNA 4GTZA 3DPCA 2X98A 4ZG6A 3NKOA 4ZG7A 4ZG9A 1Y7AA 5L0BA 3IGZB 2XRGA 2GSOA 3NKPA 1E33P 1ED8A 5LRMA 4QAXA 5GOVA 1EW9A 2W5XA 1KH7A 1N2LA 4LQYA 1ED9A 1URAA 1E3CP 4UPIA 4LREA 4B56A 1AJAA 1KHJA 2RH6A 1SHNA 2W5WA 2XR9A 4FDIA 2QZUA 5IJQA 5K4PA 1SHQA 4CYSA 5LRNA 1ALKA 3OT9A 3NKRA 3MK0A 2IUCB 1KH4A 2W5QA 4FDJA 3M8YA 2W5VA 4KAYA 1ELYA 3KD8A 3UN5A 4LRDA 2VQRA 1AJDA 1ALHA 2W8SA 3B5QA 4KM4A 4MHXA 5KXAA 4GTXA 3DYCA 1B8JA 1ALIA 2GSUA 4TN0A 1AJBA 3TX0A 1AJCA 2GA3A 1ANIA 3M7VA 4UPLA 1FSUA 2ANHA 2W5RA 1ZEBA 1KH5A 4CXKA 1ZEFA 1O98A 4UORA 1AUKA 2W8DA 4UOOA 4N7TA 1KHKA 4CXUA 5GRRA 3NVLA 3E2DA 4LRBA 3BDGA 1EW8A 4NWXA 5EGEA 4ZGAA 3NKQA 3WBHA 3SZZA 1KH9A 3WAVA 4LRAA 1KHLA 3IGYB 3T02A 4MIVA 3NKMA 3BDFA 4KJGA 4CYRA 4GTYA 5DLVA 3IDDA 4LRFA 2IFYA 4LR7A 5LIAA 1O99A 4MY4A 3WAWA 1EW2A 1HQAA 5DLTA 2G9YA 1ELXA 4LRCA 1E2SP 1ZEDA 5AJ9A 1EQJA 3TWZA 3UN2A 3SZYA 3UO0A 3ED4A 5TJ3A 5LQQA 1HJKA 3TG0A 4YR1A 4CXSA 4UPKA 1ELZA 2ZKTA 4UPHA 4NWJA 3LXQA 4LR8A 4KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6V A;  3T01 A;  4KAV A;  3UNY A;  3MK2 A;  1ANJ A;  2IUC A;  5EGH A;  5INH A;  1P49 A;  3M8W A;  2W5S A;  4UOP A;  1K7H A;  5L0E A;  4LR9 A;  1HDH A;  5IJS A;  1E1Z P;  2GSN A;  3Q3Q A;  3BDG B;  3M8Z A;  2GLQ A;  3WAX A;  3UN3 A;  5L0K A;  3NKN A;  5DLW A;  3T00 A;  2W5T A;  3BDH A;  3CMR A;  4LR2 A;  3WAY A;  5HRT A;  1ALJ A;  1URB A;  3MK1 A;  4GTW A;  5C66 A;  3A52 A;  2D1G A;  1EJJ A;  1EI6 A;  1N2K A;  1KHN A;  4GTZ A;  3DPC A;  2X98 A;  4ZG6 A;  3NKO A;  4ZG7 A;  4ZG9 A;  1Y7A A;  5L0B A;  3IGZ B;  2XRG A;  2GSO A;  3NKP A;  1E33 P;  1ED8 A;  5LRM A;  4QAX A;  5GOV A;  1EW9 A;  2W5X A;  1KH7 A;  1N2L A;  4LQY A;  1ED9 A;  1URA A;  1E3C P;  4UPI A;  4LRE A;  4B56 A;  1AJA A;  1KHJ A;  2RH6 A;  1SHN A;  2W5W A;  2XR9 A;  4FDI A;  2QZU A;  5IJQ A;  5K4P A;  1SHQ A;  4CYS A;  5LRN A;  1ALK A;  3OT9 A;  3NKR A;  3MK0 A;  2IUC B;  1KH4 A;  2W5Q A;  4FDJ A;  3M8Y A;  2W5V A;  4KAY A;  1ELY A;  3KD8 A;  3UN5 A;  4LRD A;  2VQR A;  1AJD A;  1ALH A;  2W8S A;  3B5Q A;  4KM4 A;  4MHX A;  5KXA A;  4GTX A;  3DYC A;  1B8J A;  1ALI A;  2GSU A;  4TN0 A;  1AJB A;  3TX0 A;  1AJC A;  2GA3 A;  1ANI A;  3M7V A;  4UPL A;  1FSU A;  2ANH A;  2W5R A;  1ZEB A;  1KH5 A;  4CXK A;  1ZEF A;  1O98 A;  4UOR A;  1AUK A;  2W8D A;  4UOO A;  4N7T A;  1KHK A;  4CXU A;  5GRR A;  3NVL A;  3E2D A;  4LRB A;  3BDG A;  1EW8 A;  4NWX A;  5EGE A;  4ZGA A;  3NKQ A;  3WBH A;  3SZZ A;  1KH9 A;  3WAV A;  4LRA A;  1KHL A;  3IGY B;  3T02 A;  4MIV A;  3NKM A;  3BDF A;  4KJG A;  4CYR A;  4GTY A;  5DLV A;  3IDD A;  4LRF A;  2IFY A;  4LR7 A;  5LIA A;  1O99 A;  4MY4 A;  3WAW A;  1EW2 A;  1HQA A;  5DLT A;  2G9Y A;  1ELX A;  4LRC A;  1E2S P;  1ZED A;  5AJ9 A;  1EQJ A;  3TWZ A;  3UN2 A;  3SZY A;  3UO0 A;  3ED4 A;  5TJ3 A;  5LQQ A;  1HJK A;  3TG0 A;  4YR1 A;  4CXS A;  4UPK A;  1ELZ A;  2ZKT A;  4UPH A;  4NWJ A;  3LXQ A;  4LR8 A;  4KJD A; 
#chains in the Genus database with same CATH topology
 3I55 S;  3KDN A;  3PCO B;  4YHH J;  5KFV A;  4CWB A;  2C2K B;  4WXW A;  4F0H A;  1H74 A;  4YDX A;  4A8W A;  2XGP A;  2BOA A;  3BDG B;  3D6M B;  4F3Q A;  2KT5 A;  4ZN3 A;  3VF0 B;  3BN7 A;  4QWB A;  1AZS A;  2HWI A;  4CNY A;  4GTZ A;  1S6P A;  5GMD A;  3HO1 A;  4X4P A;  2BX6 A;  3FRZ A;  4U6P A;  1WOO A;  3T5L A;  3BYR A;  1CJV A;  1ZZN A;  4FDJ A;  3L9Z A;  1UJ5 A;  2ASY A;  3BV8 A;  3W61 A;  5H9E J;  4JI3 J;  1YJR A;  3BR8 A;  5K14 A;  5KT3 A;  4UPL A;  3CDB A;  4K7Q A;  3SIP B;  3CJR A;  4F4Y A;  1URR A;  2OIH A;  3Q8U A;  2HLT A;  4LF9 J;  4CRJ A;  3NKQ A;  4U96 A;  2HS3 A;  3TJ9 A;  1S49 A;  4PXC A;  4CO4 A;  2BVZ A;  5DGB A;  2N7Y A;  2WCX A;  1B7F A;  4U9R A;  2YNI B;  1UWA A;  2H5I B;  3K58 A;  1A6L A;  4YR1 A;  2EFN A;  3BM7 A;  2RIJ A;  4Y0F A;  3M8W A;  2M8D B;  4DEZ A;  2ZVI A;  4A47 A;  1YJU A;  2HHP A;  2J0S D;  4EZ6 A;  3SSQ A;  2J76 E;  4HTJ A;  2O1P A;  2W4C A;  4IO1 A;  5J2M B;  1E33 P;  1KBR A;  4LSN A;  4I2P A;  3BO3 A;  5F8M A;  2HEK A;  1LWF B;  3ZTP A;  3KLG B;  2AW0 A;  4DV4 F;  1LEO A;  4DV7 J;  5HVH A;  3MI7 X;  4RW9 B;  3DRS A;  3C14 B;  4UZC A;  5CHC B;  3C15 A;  4KY3 A;  1FEH A;  3KUG A;  2DR7 A;  4RUC A;  3A13 A;  3MAH A;  3ZZO A;  3EMT A;  2YWE A;  4CO3 A;  4L74 A;  2RDD A;  3G4S S;  3A3O B;  2Q3P A;  1UVM A;  3DGV A;  2R8G A;  2HVZ A;  2HS4 A;  3RRG A;  5H1S V;  1GFW B;  2E5J A;  2DVI A;  3DRR B;  1R0B G;  4DJB A;  3BPS P;  2MGZ B;  5ETM A;  1REV B;  4EK2 A;  4C11 B;  4QBU A;  2WVF A;  2IRX A;  4DR2 F;  5CYQ A;  3KKF A;  3DPC A;  4ZG6 A;  4DSI A;  5LRM A;  2EKN A;  2MDA A;  4NRT A;  3M2R A;  2RF2 A;  4LQ3 A;  4NEY A;  4JI2 F;  3BKU A;  5I42 A;  3OHA A;  3W1Y C;  1JNR B;  1PAE X;  1JX4 A;  3QT5 A;  1RWU A;  4HT7 A;  5I3U B;  2ZNY A;  4ZPA A;  1JK9 B;  5KT4 A;  2H5E A;  4XPE A;  5AJ3 F;  1VIO A;  2N4C A;  4LFC J;  3FFI A;  3P5B P;  3NGK A;  1TKT B;  1U1Q A;  2MZ1 A;  4U95 A;  4U67 Q;  1S0M A;  1RTD B;  1SUQ A;  5AT1 B;  2EC2 A;  4LFB J;  4NWX A;  4DQS A;  4TYA A;  4HHJ A;  1TL5 A;  2ZJR Q;  2IFY A;  4FS1 A;  3TVK A;  4S0M A;  1QAJ A;  4XIU A;  1KQF B;  1EET A;  1EKR A;  2HMI A;  3QPI A;  1BE4 A;  3ITH B;  2YWW A;  4HH1 A;  1HR0 J;  1X0F A;  2E29 A;  1ZAV A;  3WC0 A;  4NLO A;  5KFJ A;  1VQO S;  4KAV A;  1U7L A;  3TEG A;  3PEH A;  4NCG B;  4PQA A;  4X64 F;  5HLF A;  1RWW B;  4DUY F;  2HIQ A;  1HLW A;  1JJH A;  1NK5 A;  4LR2 A;  2W01 A;  5KG3 A;  2AJ4 A;  2IC3 A;  2E5L J;  1WC0 A;  1S1W B;  4FS2 A;  2ZWO A;  3MGJ A;  5G0R B;  1IBK J;  3H5S A;  1BQM A;  4OI1 A;  1QM9 A;  2R2S A;  2BE7 D;  1TL1 B;  2V6A A;  1HYS B;  3MM5 B;  2W7O A;  2M70 A;  4NXN J;  4KJG A;  3OVB A;  1H73 A;  2GVD A;  4F67 A;  4UPK A;  2YPZ A;  1RT2 A;  2VQF J;  5J2P B;  1ITP A;  1YBU A;  2CQ0 A;  3UNY A;  2HSE B;  4LFA J;  2NQP A;  4G3I A;  5E33 A;  2RB7 A;  3C6T A;  4IG0 A;  5IQQ A;  1RTH B;  2I9S A;  1FKA F;  1G2E A;  4EFA C;  3GE9 A;  3WAX A;  1T3O A;  3M05 A;  3WIU A;  4ED1 A;  1WWH A;  4DR5 J;  1YQH A;  3MPW A;  4CT8 A;  1YTY A;  4I4B A;  2PEB A;  1URN A;  3M8R A;  4MIW A;  3HHL C;  2J0W A;  1KH7 A;  2OSR A;  1UZH A;  3PIO Q;  2Y0B B;  4WZQ A;  4QYZ J;  2LXU A;  3GFX A;  3EJM A;  3LAK A;  4USK A;  3HP6 A;  4LF7 J;  5D8H B;  2AEM A;  5AXM A;  4UTG A;  2QSF A;  2CAJ A;  3P8B B;  2EK6 A;  4HDH A;  1VQ5 S;  3QBC A;  2EVZ A;  4QIV A;  1R27 B;  3VAF A;  1NJY A;  3CJ5 A;  4LSL B;  4K4S A;  3RYL A;  1WEY A;  4RWX A;  1SB6 A;  5A2Q U;  4QPT A;  1MMN A;  2HQ3 A;  1HBN B;  2A2C A;  3LP0 B;  3V6K A;  5LQQ A;  2HND B;  4LJM A;  4FBU A;  1D9D A;  3MMC B;  5F8N A;  2BE2 B;  1OYE A;  3MEE A;  3T01 A;  1FXR A;  3PNI A;  2QV6 A;  4O3P A;  2FJA B;  2ZH5 A;  1UA0 A;  4BWJ A;  1K44 A;  1EJ7 L;  2HQG A;  2FPH X;  3NGD A;  3OFH A;  1SH2 A;  4LIW A;  3T1H J;  5GAE U;  4EBE A;  3G82 A;  3NGR A;  2N3L A;  3UCU P;  4DL0 C;  2DNN A;  3IGZ B;  5K5M A;  1TVR A;  1MN7 A;  2NYH A;  3OLA A;  2IMO A;  1S1V B;  4GC7 A;  4DHV A;  3GFY A;  3DLB A;  3BPD A;  3PJ9 A;  1FFG B;  3OV7 A;  3S6E A;  4HHU A;  1GX5 A;  3M8P B;  3ILJ A;  2JFD A;  4X62 F;  3BS9 A;  1Y11 A;  3VGT A;  3IGY B;  3L7U A;  3HUL A;  4CLS A;  2V2Q A;  1FJG F;  4M5M A;  1DQA A;  2RU9 A;  2M4M A;  2ZM6 J;  3QLH B;  1R6V A;  4JI5 F;  1H72 C;  1C4A A;  3CD6 S;  4PZV A;  3N28 A;  3KLV A;  3P3D A;  1N34 F;  1BWV A;  4PG4 A;  3GQC A;  3TP2 A;  5D4P A;  4L72 B;  1N48 A;  4OIX A;  2KHD A;  5IT9 Y;  2HHH F;  4M63 A;  2HNY B;  2B5J B;  3SFU A;  1ZA1 B;  3DU6 A;  1N5T A;  4RZR A;  3DOK A;  2ROE A;  1U1R A;  1T11 A;  4EUV A;  2DCU B;  4C0B A;  1MNE A;  1HA1 A;  1ALK A;  4H4O A;  2W4P A;  3DN9 A;  5L9X A;  4EWT A;  1KFS A;  1B70 B;  2VPW B;  2OFG X;  4MT1 A;  4DPO A;  1R43 A;  2YKM B;  1S6Q A;  1IJF B;  1LW2 B;  3KHG A;  1TV6 A;  5I4M A;  4J37 A;  1LOU A;  1SV5 B;  3IGV A;  3DM2 B;  3UD4 P;  1N5Y B;  1FNO A;  4OJ3 A;  4FZV A;  2PA8 D;  1L3V A;  1EW8 A;  2MPU A;  2JEG A;  2FZK B;  1Q7Y T;  4KO0 A;  1UEV A;  3NOG A;  4ED3 A;  4DL3 A;  3NAH A;  4O44 B;  2CZ9 A;  1EW2 A;  1DTT B;  2CRL A;  2DGX A;  2WZ1 A;  4GKK J;  2EFQ A;  2IY5 B;  1C1C A;  1S0V A;  3J81 j;  1ZPV A;  2EBG A;  4X65 F;  4USV A;  5L8R C;  2VZ9 A;  2WSC C;  2YKN B;  3NP5 A;  2XHC A;  4JI0 F;  2O01 C;  3Q8R B;  1N33 J;  1M5K C;  4GRS A;  4V1A k;  1PBU A;  3BDH A;  1URB A;  1N36 F;  4ZIT A;  2FLO A;  2DO4 A;  4J9K A;  3R5A A;  4FF1 A;  1NJX A;  2BJ3 A;  5KG6 A;  2QYG A;  3ET6 B;  3Q2S C;  2UZA A;  4C8K A;  1NJW A;  4K4T A;  1PCA A;  4RBT A;  4LF4 F;  2DNG A;  4LF5 F;  1S79 A;  3UDE A;  2ZD1 B;  3QJJ A;  1MML A;  2B9X A;  2QYC A;  2QMU B;  3O3L A;  2DHS A;  1WNE A;  4KGX B;  1DQ8 A;  3ADA C;  2CQB A;  2ZKU A;  4OI6 A;  1FF2 A;  2WW8 A;  1P1L A;  1OY8 A;  2Z8Q A;  4CYR A;  4DL5 A;  1O6X A;  1QD1 A;  4QU7 A;  1XTZ A;  3ILI A;  1FWL A;  3KYL A;  3DXS X;  4AXJ A;  4C4W A;  3RAX A;  1SIW B;  1KR4 A;  3MUR P;  3NXZ A;  3D2W A;  3DRY A;  2AKW B;  4N47 A;  2BAC A;  2BBE A;  2W9B A;  4BBY A;  1HMV A;  2K3K A;  2OD4 A;  5KFS A;  2DKO B;  3O8W A;  7FDR A;  2E5I A;  3LA0 A;  5CAA A;  1RWN B;  4A8K A;  1T05 B;  2JEI A;  5HMY A;  2RS2 A;  4K4X A;  3SDE B;  4DL6 A;  4PWD A;  3OT9 A;  4F26 A;  4WFA Q;  3ISN D;  4TY8 B;  4NLS A;  3OR2 A;  3TAM A;  1UL3 A;  1HWL A;  3QIP B;  2KXH A;  1CJV B;  4JP8 A;  2APO A;  1ZEB A;  5HAN A;  1BGX T;  2FDN A;  4FYX B;  2PFD A;  2MHE A;  3BEG B;  1XR5 A;  1VLY A;  1Q7L B;  2C28 A;  4I6Y A;  3OSN A;  5D4L A;  3GPA A;  5KFL A;  5KT7 A;  4K0K F;  5DS7 A;  1YJT A;  1EQJ A;  3R2D J;  1S57 A;  3UO0 A;  4ZIV A;  1S1T A;  1RTJ A;  4OL8 A;  5KFT A;  2B4U A;  5F3Z A;  2FTR A;  2HGM A;  1IUJ A;  3FNN A;  3UPF A;  3MMB A;  4I68 A;  3ISN C;  4Q8E A;  1WF1 A;  2XEX A;  2KDO A;  1U2R A;  4NMX A;  4I2Q B;  3SSR A;  3UVJ B;  3WAY A;  5GAE I;  1EJJ A;  1S1X B;  4C97 A;  1FA0 A;  4HHH A;  4KT0 C;  1P8G A;  3QSI A;  4GKJ J;  4DR3 J;  4BC9 A;  3AD8 C;  4Y28 C;  2C2D A;  1VK3 A;  3D0I E;  1WI8 A;  3ZFV A;  4ILM A;  4ZCL A;  1IKY B;  4M8L A;  2FGO A;  1ZM4 A;  3R6L B;  2VPZ B;  2PMH A;  2IAJ B;  2UV8 G;  2YWK A;  1B3T A;  4I69 A;  4N41 A;  3DI6 A;  2CPH A;  1S0N A;  4HL9 A;  1VBY A;  1OSC A;  2MJN A;  3A12 A;  4OYZ A;  2VOD A;  5EGY A;  1IWG A;  2QLX A;  1OO0 B;  3AA8 A;  3R7S B;  2UVW A;  5E0O A;  3IP0 A;  3N5F A;  3CCR S;  5L46 A;  5IM0 B;  4QWE A;  1JIH A;  3EVM A;  2IUC A;  1FX4 A;  1N6Q A;  3QWP A;  2M7S A;  3C19 A;  4P6Q A;  1KVI A;  4DV6 F;  5B0D A;  1TL3 A;  2UXB F;  3Q83 A;  1ED9 A;  2ABY A;  3R5G A;  1RHQ B;  2ZUA A;  3MEG A;  1H3D A;  4Q7A A;  2V2V A;  3HK2 A;  4TN0 A;  2OPR A;  1ANI A;  5I3Q A;  3T1Y J;  3IWX A;  3AOD A;  3SSS A;  1JLQ A;  2C1E B;  2IM2 A;  1F60 B;  2NZC A;  2XMT A;  3IWL A;  1TU0 B;  4ID5 B;  2P9G A;  4YHH F;  1FES A;  4NZ0 A;  3EUN A;  5JVG Q;  5DLF A;  2A0F B;  1ZED A;  4OQJ A;  5AE1 A;  3KLH B;  2KT2 A;  3EWG A;  1WG5 A;  3KJQ B;  4DR6 F;  2RSQ A;  3QMQ A;  4MFB A;  2F3J A;  2BR0 A;  4X66 F;  5FJ4 A;  3P6Y C;  4MTP A;  4IFV A;  4U8Y A;  4TQR A;  2MST A;  3DDK A;  2V8D A;  3F0N A;  4OZ2 A;  1N56 A;  4OI0 A;  4FXD A;  4Y34 A;  1YK9 A;  3T3F A;  2XMM A;  1VJW A;  1D1U A;  2IPO B;  2V69 A;  4V19 X;  3GIR A;  4ITS A;  4OYM A;  4IH6 A;  2LEB A;  1XBW A;  1S76 D;  4PXE A;  1HBM A;  1S9G A;  2FY8 A;  1I3O B;  2QEX S;  2KXN B;  2IC3 B;  5T7L A;  2DXD A;  4LF9 F;  3CJ4 A;  3JQM A;  1ELY A;  4MKB A;  3Q8V A;  3HVT A;  5C25 A;  2MXY A;  1ZTT A;  5KT2 A;  1BXN A;  3M7V A;  1BQM B;  1FTR A;  3M30 B;  4G1P A;  2Y0S D;  3EGN A;  4DQR A;  4MYU A;  2H54 B;  2Q66 A;  3FEX B;  3LGN A;  2FHM A;  1T94 A;  4MKY A;  4BWM A;  5KG1 A;  1EIY B;  4R0E A;  3W3S A;  1N5Q A;  4RL1 A;  5LIA A;  4O3S A;  2FGC A;  2V5H G;  1VQL S;  3D3C J;  4Y65 A;  5C5J A;  3TG0 A;  2E7W A;  3LP1 A;  3HM9 A;  2YNG B;  4P2F A;  5D77 A;  2LCW A;  1BWE A;  1R0A B;  2DGV A;  3HVR A;  1HNI B;  2ATC B;  3EPG A;  3UDL A;  3RW6 A;  1R8A A;  2YNH A;  2B9Y A;  1RT2 B;  4DQP A;  1KTV A;  2W2Q P;  3DYA B;  2DO0 A;  3OW2 R;  4UQT A;  1SJF A;  4PYA A;  3W60 A;  1RT7 A;  3M9N B;  3G2X A;  4X4S A;  2P9E A;  1MG7 A;  1AA1 B;  1HPZ A;  3QFH A;  2POK A;  2RAQ A;  3ENV A;  2AJQ A;  1YBT A;  3V2U C;  4DV7 F;  3H5U A;  1RYS A;  4TKT A;  3MCM A;  5A8K B;  2E1P A;  1SHN A;  5JXS A;  2H4W B;  5D6G A;  5IT9 U;  2V8P A;  2BJ8 A;  1TAU A;  1E6Y B;  2RQ4 A;  5KG7 A;  4ZK7 M;  2MQO A;  1M1H A;  4DUZ J;  5CYM B;  5HN0 A;  1J27 A;  3KJV B;  3NS5 A;  2AQ4 A;  2HFV A;  3KOA A;  2JVR A;  1NPK A;  3ZNU A;  3HSJ A;  3KNG A;  1H38 A;  3P5T L;  4YY3 F;  2W25 A;  2XY6 A;  4UW2 A;  3DDN A;  3VZI A;  2ROG A;  2HYI B;  5KFA A;  2Y3Y A;  3DLK A;  1K9M T;  1KHV A;  1RLD A;  3KHR A;  2HWT A;  2LEA A;  5D0H A;  3VVU A;  3MR6 A;  2HW3 A;  4ILL A;  4F4K A;  2BAN A;  3B82 A;  3QGI A;  4UOP A;  4WP3 A;  3AQP A;  3FSY A;  4JBC A;  3MEE B;  4YB1 P;  1Y3J A;  1NSP A;  4M94 A;  3NL0 A;  3HX9 A;  3O44 A;  4PXD A;  3I56 S;  4TYB A;  1S7H A;  3NLC A;  2GC8 A;  2OI2 A;  1HFE L;  2ZH8 A;  3OXG A;  4RW6 A;  2P6S A;  3HT3 A;  1CJU A;  3C6U A;  1QSY A;  1JNZ B;  4LFC F;  4ECV A;  4GMK A;  5DGA A;  1XJW B;  3CUN A;  2DGU A;  4LFB F;  4WE1 A;  1FI4 A;  6FD1 A;  2R3V A;  1U47 A;  1YJ7 A;  1RAD B;  1H7W A;  3GIK A;  4B9S A;  4RPF A;  1FTC A;  2RS8 A;  1HR0 F;  3TI0 A;  2VC0 A;  1S97 A;  3C46 A;  1V6H A;  2NXC A;  3TQE A;  2IFX A;  1DUR A;  1PJ7 A;  2KI2 A;  1KRP A;  3TVY A;  4ECW A;  5GAH U;  4PQU B;  2VF3 A;  3CD7 A;  1A0O B;  2IDL A;  4ED7 A;  3J80 Y;  2AD9 A;  2M8H A;  2GQ2 A;  5KFC A;  3I5A A;  1RE1 B;  2AGQ A;  2DIU A;  1MRO A;  1RLC L;  2E5L F;  4OX6 A;  2J9E A;  3CC2 S;  4NL5 A;  4ETZ A;  4NLW A;  2E44 A;  1RT3 B;  5F9N A;  1HNV B;  2KRR A;  2HFU A;  4J9P A;  2XRG A;  1T3N A;  4PG8 A;  3ZTS A;  1RWV B;  2VIC A;  4B56 A;  3NEK A;  2QFI A;  3N01 A;  4IFY B;  4ES3 A;  2FJD B;  1Z2Z A;  4A8F A;  5MLC V;  2CPY A;  4IG3 B;  2AGP A;  3CCL S;  3FQK A;  3J81 Y;  5M2P A;  2F5G A;  1FXD A;  2ZZT A;  4F36 A;  5HP1 B;  2YKO A;  4M5L A;  2VFT A;  3D54 A;  2XGQ A;  1TQL A;  1VQ4 S;  1UPP A;  3GYG A;  2VQF F;  4OHW A;  3W2V B;  2R7Q A;  3CJ8 A;  3BGF A;  3KUE A;  3CC4 S;  4J9M A;  4TLQ A;  4Z7C A;  4FXW A;  2Y8W A;  3WX8 A;  4KO0 B;  2A10 A;  4QZV B;  3IC1 A;  3GR0 A;  2LVW A;  3QWU A;  3ZZY A;  3MM8 A;  2UUW A;  4TN2 A;  4KHR A;  5K8P A;  1TL7 A;  3DDI A;  3OR1 B;  3MR2 A;  5KFZ A;  1RCX B;  3G6Y A;  2ACM A;  4JOU A;  1HBO A;  3CJK B;  3FC9 A;  2F9D A;  1HWK A;  4C98 A;  2W9C B;  3TZY A;  2LXI A;  4ZVS B;  2W2N P;  2L41 A;  3ONQ A;  4TQS A;  4I7F A;  4FYW B;  2MY8 A;  4DS4 A;  4YQW A;  2ZVS A;  2UXC J;  2ZBR A;  3GMG A;  3VAL A;  5C2G A;  4DR4 F;  4JI6 F;  3HMJ G;  3W8G A;  1QVF R;  5J2Q A;  3JSM A;  1G3O A;  5L38 A;  1VIS A;  5DJB A;  1F1B B;  2BJ7 A;  1U8S A;  4USU A;  1KHW A;  3NVL A;  4N77 A;  4NI2 B;  4E2F B;  2YWH A;  3CCT A;  1N88 A;  1EP4 A;  4HAC B;  3K57 A;  2QGF B;  4PPD A;  4ZLP A;  5HAT A;  2XUL A;  2B51 A;  2D3O R;  1HIY A;  2DHH A;  3BO2 A;  1HBU A;  4RW8 B;  1HQU B;  2J6U A;  4TVA B;  4B9N A;  1JKH B;  5J1E B;  3IRW P;  3E51 A;  1VI7 A;  2Q6B A;  1F3V A;  1KVK A;  4DL2 A;  3T00 A;  4G1I A;  3GV8 B;  1EI6 A;  2NYI A;  2C42 A;  1KD1 T;  1VR6 A;  1HMV B;  4ICL B;  2CQG A;  4F0K A;  2QE5 A;  1VC5 A;  4WK1 A;  3VAG A;  1ELO A;  3AD7 C;  4CYS A;  1JLE B;  1S9E B;  4NYO A;  2CAD A;  4H54 A;  2PGC A;  1S1U B;  5LOQ A;  2ZZN A;  4KM4 A;  1QSL A;  3OFG A;  2IA6 A;  4PWD B;  2ZM6 F;  2ANH A;  2JH3 A;  1JQG A;  1ZTW A;  1QTM A;  3RJM B;  4I0W A;  2J7W A;  1NK8 A;  1P1T A;  1VS3 A;  1R8C A;  2I8E A;  4LQ9 A;  1Y4Z B;  3CE8 A;  4NA1 A;  2JLF A;  1UCN A;  2UUB J;  2DR6 A;  3B6B A;  4E0D A;  4NWJ A;  3LW5 C;  3TVZ A;  4I6A A;  1OQ6 A;  3H98 A;  2MB0 B;  2GGP B;  3AJD A;  3AY0 A;  2V50 A;  1RKJ A;  2XS2 A;  2HFS A;  2X1F A;  3RAM A;  5DLW A;  5LM7 E;  1FWK A;  2R2R A;  3E2E A;  3VTI A;  3MUT P;  4ZJO A;  2KHC A;  2DGS A;  2VA3 A;  1IJE B;  2CNN B;  2VHG A;  4LQY A;  2MLX A;  3H20 A;  2W5W A;  3I31 A;  5ADZ A;  4QIW D;  3KK3 A;  5ETO A;  3MMA A;  2YKA A;  1KON A;  3GP9 A;  4CIO A;  4DSE A;  2Y9H A;  4F8R A;  4CTA A;  3I9V 9;  2DEI A;  1TTH B;  2I5J A;  5LL6 d;  1KNZ A;  4CXU A;  3C3L A;  2DJW A;  2KFN A;  2AJF E;  2VPY B;  3ZZP A;  3D6T B;  3BGU A;  1T8E A;  2VON A;  4L6V 3;  3GYN A;  1HD1 A;  3T02 A;  5E3Q A;  4FYY B;  3PHT A;  1UAW A;  3G9C A;  5GAH I;  2ZZM A;  4IR1 A;  4ZDN A;  3Q24 A;  1X4H A;  1AFJ A;  1LWC B;  2CQC A;  5ETR A;  3MK2 A;  4WF9 Q;  4RO0 A;  1RWP B;  4KH0 B;  1ACM B;  4MKV A;  2BKO A;  2J0Q D;  2W1B A;  2CQI A;  3HSG A;  3KMQ A;  4ZVE A;  1U0H B;  1T9W A;  1CJK A;  3PRD A;  3VR1 A;  2AIR B;  3FZ2 A;  3J7Y I;  2EWH A;  3H59 A;  1ED8 A;  2YWG A;  1URA A;  3ZXW A;  2LDY A;  3R9L A;  1RWM B;  1RTI B;  1UFK A;  1IVZ A;  3TUJ C;  3MPD A;  1HWU A;  1RBL A;  1O51 A;  4CNZ A;  4AE5 A;  1YJW S;  3GCW P;  3G6E S;  2D7S A;  1ZOT A;  2IYG A;  3M6W A;  4MAK A;  3BDG A;  3MHY A;  4ZP7 A;  2PA3 A;  4YOE A;  4W90 B;  2XB2 D;  1UVL A;  1CS4 B;  2F40 A;  5IV4 A;  2JJ4 D;  3JS9 A;  2EEY A;  3ZZT A;  3DLE B;  3I4H X;  3P96 A;  2H51 B;  2MQN A;  2BQU A;  3QAE A;  3FZB A;  4LRC A;  2QX0 A;  2GW8 A;  2ZJP Q;  3KNA A;  1FCA A;  1NDL A;  1WOP A;  4IRC A;  5LMN J;  5KFK A;  2PO4 A;  4UOH A;  2PMW A;  4KE5 A;  1U49 A;  1QUP A;  4YB7 A;  3CJ2 A;  3GR1 A;  3LGM A;  4MFB B;  1XMO F;  3FJ2 A;  2VPX B;  3CF5 Q;  2VJV A;  3N6N A;  2YX7 A;  3I0S B;  3J7A 1;  1TUG B;  2OFH X;  4DXL A;  4DR1 J;  4DV3 J;  1W2I A;  3I5C A;  1ZZF A;  3ILO A;  4YFU A;  2H5J B;  1NK4 A;  3BGR B;  3QZ7 A;  1WHY A;  2E66 A;  3CJT A;  5K8N A;  3BBB A;  2YNI A;  1W25 A;  3R27 A;  1HBM B;  3SCK E;  3D67 A;  2LA6 A;  4NAS A;  4USJ C;  2WK4 A;  4M5I A;  1VCT A;  1M5V C;  1H2U X;  5HL7 Q;  4XPC A;  3OVA A;  4K2X A;  4PAA A;  5LSO A;  4OZJ A;  1VQ9 S;  2U1A A;  4C6A A;  3NS7 B;  1FKP B;  3D68 A;  4YB5 A;  4H4M B;  4ZPD A;  5MAO A;  2A18 A;  1QSS A;  2NPF A;  4K4Y A;  5J2M A;  2ADB A;  3GJR B;  1L3S A;  1LWF A;  5HQL A;  1TMJ A;  2M88 A;  3KLG A;  1RHJ B;  4ECX A;  4DR3 F;  4YUD A;  2EI5 A;  1NLK L;  1JLC B;  3C14 A;  4FF4 A;  1NDP A;  3HD1 A;  3J80 U;  2JX2 A;  3EZU A;  1J5E J;  2DR5 A;  3NKP A;  4GO7 X;  4Q2M A;  1CPZ A;  4A8Y A;  4C3M A;  4TNO A;  3NKR A;  2W5V A;  2KT3 A;  3HXM A;  2ALZ A;  3PYE A;  4JI8 J;  1VQY A;  1F9E B;  3DRR A;  2JLE A;  5DDR C;  2IYI A;  3R6G B;  2QMX A;  2KXF A;  3SFG A;  2ZOM A;  2MGZ A;  4HTI A;  1MMD A;  1VDH A;  4Z7Y A;  4JV0 A;  5EWF A;  2QA4 G;  1WG1 A;  2RNE A;  1REV A;  3CCS S;  4NLD A;  4C11 A;  2FB0 A;  3J81 U;  1FHT A;  2VFS A;  4CLK A;  3ILL A;  3CW2 C;  1TEL A;  1VQ7 S;  1UMJ A;  1MWZ A;  3U1M A;  1WUU A;  5J1P A;  4WXO A;  5GAG U;  3RBD A;  3DLK B;  5KFW A;  1RP5 A;  3NBP B;  2E5H A;  4OX8 A;  5I3U A;  1P6T A;  4HT5 A;  2O5D A;  2R7X A;  4DU8 A;  1NCL A;  3CMR A;  5BJR A;  1TKT A;  3TO8 A;  1QAX A;  1WDD A;  1IR0 A;  4Y2A A;  2RIL A;  1CBK A;  3MM7 B;  5KTQ A;  2R8H A;  5GOV A;  1WF2 A;  1Q16 B;  3T1Y F;  4KFB B;  3VCD A;  5EX0 A;  3ITH A;  2N82 B;  3MAA B;  3DRP B;  1ALI A;  2B43 A;  5HJX A;  4UY8 T;  1HNW J;  2MTL A;  4J9O A;  4NCG A;  4C0O C;  3F73 A;  2KG0 A;  5KFY A;  5KFG A;  3JTO A;  4UF4 A;  2B3T B;  2XLI A;  4BLG A;  4RNM A;  1LQ9 A;  1NSK L;  1HNX F;  4EU0 A;  1ICE B;  1PSD A;  1RU1 A;  2VG7 B;  3OUY B;  3LWM A;  1JXV A;  2CQD A;  4DV1 J;  1S1W A;  2M3D A;  2R7O A;  3SYZ A;  1Y00 A;  5H9E K;  4LMZ A;  1SJ3 P;  1T0T V;  3BQ1 A;  3WIV A;  5KFU A;  1U45 A;  1GXU A;  4DZ6 A;  1C2P A;  1VQP S;  1P9Y A;  2LXF A;  2HWH A;  2FQQ B;  1HYS A;  2DGO A;  1I1G A;  3MM5 A;  1Y0H A;  1RZM A;  2C2M B;  2HHW A;  5AE2 A;  2GHV C;  4QR0 A;  4BCA A;  1I51 B;  5F8G A;  2MHN A;  2JSX A;  3FBB A;  2NPI A;  5J2P A;  3N6M A;  4FVM A;  2K7J A;  2YH0 A;  5ITH A;  1RTH A;  1O0P A;  4G6V B;  2GJF A;  4R8U B;  1S7I A;  1IQT A;  1KQG B;  2AYE A;  4PCQ A;  3CWJ A;  4NLR A;  1JLF B;  1FRH A;  1QDU B;  5LMU J;  2FVP A;  1TZ0 A;  4DV2 J;  2Z2L A;  3HKW A;  4B3M J;  4ZVO B;  3CIZ A;  4AT1 B;  2GCF A;  3M6V A;  1Q8L A;  2G1H A;  3PKY A;  4UQG A;  1KOO A;  4FXV A;  4ELU A;  2K06 A;  1JLB B;  3K5N A;  5JUM A;  4F3M A;  5A8R B;  1WKL A;  1FVQ A;  4OYP A;  2XWY A;  5CA5 A;  2OEK A;  1SQG A;  1KDN A;  1DAR A;  4W98 A;  1H2V Z;  1HI8 A;  4LSL A;  1YVF A;  3PW5 A;  1NKC A;  4UT4 A;  1X5T A;  5B7W A;  2JFK A;  3FRY A;  3Q89 A;  1HBN A;  2WBR A;  4J9S A;  3LP0 A;  3IS9 A;  4AFF A;  2HND A;  4NYP A;  3U1N A;  2PI5 A;  2HQC A;  1NSQ A;  2JC0 A;  2BE2 A;  1K0V A;  1GTH A;  4UOR A;  4R5P A;  4UOO A;  2AMC B;  1RBA A;  2AJ0 A;  3PFO A;  2ZH6 A;  2IM3 A;  2IM1 A;  4KV8 B;  2R7T A;  1VC6 A;  4LRA A;  1M90 T;  2K1R B;  4LRF A;  5EWE A;  1YWX A;  1FFW B;  5SZT A;  4NEZ A;  4CI0 B;  1ELX A;  4CH1 A;  2DNZ A;  3GIL A;  3PYD A;  2F4V J;  5C2C A;  2VBX A;  2NSC A;  3JSR A;  1YSJ A;  1NEE A;  2DNP A;  1S1V A;  2HHQ A;  3Q22 A;  2W4D A;  3TZZ A;  3K0J A;  2IVF B;  3IBF B;  1UFW A;  5LXY A;  1X9S A;  3I87 A;  3E3X A;  4CP5 A;  3MPV A;  3X3U A;  3BSN A;  1KKH A;  2VUG A;  2HGN A;  3M8P A;  2MQL A;  1TK5 A;  4DPU A;  2O67 A;  3AXK A;  3D1H A;  4X84 A;  2OP5 A;  2RRB A;  1FNX H;  3ENW A;  3H4D A;  1YJN S;  2A2D A;  2BRL A;  1DJ0 A;  4QWD A;  1C1B B;  5CZV A;  3WBZ A;  4MK9 A;  4L3K A;  4DMZ A;  2H3E B;  3MCO A;  4CXK A;  3I82 A;  1HWI A;  2V67 A;  2EK1 A;  4KYZ A;  2J6S A;  1SJ1 A;  2HNY A;  4IR9 A;  2GAG C;  2B5J A;  2FLL A;  3IFE A;  3LTO A;  4YB6 A;  1X5O A;  5KFH A;  1CUL B;  2GIF A;  5RUB A;  4WFN Q;  5E7O B;  2HQI A;  1CQN A;  2HBZ B;  3NKY A;  5E41 A;  2NLW A;  3HSZ A;  2FJW A;  1NPP A;  3WX4 A;  3PW4 A;  1IM6 A;  3D5M A;  3WZ0 A;  1HQ2 A;  1Q8B A;  2KH9 A;  4KTQ A;  2B9E A;  4PG7 A;  2OEL A;  1LK7 A;  2J5A A;  1KS2 A;  5GAG I;  3FKB A;  3ZTO A;  1O8B A;  1RAJ A;  2BEF A;  3MEC B;  2D9P A;  2YKM A;  1PG5 B;  2LLZ A;  1WHW A;  1LW2 A;  2ERR A;  4IQM A;  1TKX B;  1SV5 A;  3DM2 A;  2HVH A;  1F3F A;  1WEX A;  1N5Y A;  4JV5 J;  2PT0 A;  2NXN A;  5F3T A;  2UVU A;  3VAM A;  3ZZ0 A;  2GJ2 A;  3BZQ A;  2GSO A;  3OTB A;  4X4N A;  2XNQ A;  1S48 A;  3VZH A;  4O44 A;  4FKX A;  3TA0 A;  3DMJ B;  2RQC A;  3K5P A;  2RT3 A;  4B3R F;  4OYX A;  3M8Y A;  2VG6 B;  4LF8 J;  3AA9 A;  1B8J A;  1KLN A;  1IQZ A;  2OAU A;  5A0Y B;  4A4J A;  3MMA B;  1P27 B;  5IQ6 A;  2YKN A;  2OLW A;  2MZJ A;  1Y5I B;  1KH9 A;  5B0A A;  3HKZ D;  1X60 A;  3JSB A;  1XQI A;  2UUA J;  5ETS A;  5DG7 A;  2C2O B;  1SBR A;  3W62 A;  1RBO B;  4QYZ K;  4AL6 A;  3IG1 B;  1VOM A;  1SQF A;  1X5S A;  2JWN A;  3EGW B;  1VK8 A;  4KBI A;  4ZGA A;  3HSD A;  3ET6 A;  2ZOF A;  2KB2 A;  1AT1 B;  2ZBI A;  2MMY A;  2HLU A;  2QLJ B;  3CMA S;  2CG4 A;  1MWY A;  3O2I A;  3EM1 A;  5IS2 A;  1TP7 A;  1NK9 A;  3W5Y A;  3HPO A;  1LW0 B;  2UU9 J;  2ZD1 A;  2ZBQ A;  3HHD A;  4RU9 A;  1DRZ A;  3CCU S;  1VYA A;  2K2P A;  2I0X A;  1NJI T;  4CLT A;  4QPX A;  2BJE A;  2CJX B;  1NK7 A;  3W66 A;  3ENQ A;  4PR6 A;  1PYT A;  1W26 A;  3WDO A;  5KFB A;  4UY8 5;  2FVS A;  3K17 A;  5IT0 A;  4K4U A;  2EFP A;  1VRU B;  3BGL A;  3PO4 A;  1DZ5 A;  4X4Q A;  3A4T A;  3THT A;  2KVQ E;  2BM0 A;  2OPP B;  1HQA A;  1DHM A;  1HW8 A;  1T05 A;  3UN2 A;  1XER A;  4DL4 A;  4ZLL A;  3WC2 A;  4ZLN A;  3LPY A;  1RHK B;  5BXI A;  3SDE A;  1RTZ A;  1N32 F;  2DRB A;  1OMS A;  4TY8 A;  1TKZ B;  3PR4 A;  3BDP A;  4AND A;  3T5H A;  1NME B;  4WYL A;  2GV1 A;  3QIP A;  2L9D A;  2RUS A;  1S4F A;  1AYE A;  4DSJ A;  3HHN B;  1Y5L B;  4ZVT B;  2XO6 A;  1CQM A;  4X4T A;  5IOL A;  1B7Y B;  3OL8 A;  1RT6 B;  4QAX A;  5AXL A;  3GIJ A;  3FSI A;  4K4W A;  3OTO J;  2ZJQ Q;  1ZAW A;  1EQ0 A;  1KH4 A;  4WIQ A;  3IRX B;  3KD8 A;  4O4G B;  5L9N A;  3DYC A;  4XK8 C;  1V3R A;  2VBW A;  3HJV A;  1N52 B;  1CC8 A;  5HQ8 A;  2VQE J;  4DI6 A;  4OHX A;  4HI1 A;  4ANE A;  4I2Q A;  2BRK A;  3OTE A;  1KVJ A;  1XR7 A;  3UVJ A;  1GXT A;  2ASD A;  4B3T J;  1S1X A;  2KYZ A;  1AB8 A;  1LFP A;  4CO1 A;  2LU1 A;  4UUX A;  1U1N A;  2Q79 A;  4DV4 J;  5AE3 A;  4HH0 A;  5B0B A;  4WTY A;  3B54 A;  1JJ4 A;  3CED A;  5LJ5 Y;  1IKY A;  1K47 A;  2KKH A;  5GVQ A;  3G71 S;  3RZA A;  2W5T A;  2DNM A;  2IAJ A;  5FD1 A;  4L75 A;  5F0W A;  1CVJ A;  2E1A A;  4U7C A;  2RVJ A;  3ISZ A;  2XR9 A;  3NS6 A;  4G1Q A;  1I94 F;  4DCP B;  1XWL A;  4ZPT R;  4ECR A;  1FER A;  3OL7 A;  1P9Q C;  5IM0 A;  1GAO A;  3PW7 A;  2B4P A;  2DEJ A;  3VGU A;  2BW2 A;  4K8R A;  1BMQ B;  2X51 A;  2LMI A;  2BDP A;  3ZC4 A;  1VQ8 S;  2KZM A;  2WW4 A;  1YG0 A;  2KJV A;  4DR2 J;  1U02 A;  3TUP A;  1X4C A;  3QT6 A;  4K50 A;  2CQP A;  4IQX A;  3POT B;  3GJS B;  4F2R A;  2E5G A;  4JI7 J;  4FYD A;  1H0H B;  1S72 S;  2FJV A;  4RW4 B;  3QO9 B;  4WKR A;  4JI2 J;  3JYT B;  2ZH2 A;  5SUH A;  1RT4 B;  4LUB A;  4WBF A;  2KN4 A;  3IBC B;  2IRU A;  2Y8Y A;  1RJJ A;  4B9U A;  1FEE A;  5C42 A;  1FRL A;  3OVS A;  4LBH A;  5KG0 A;  1Q4R A;  4OHY A;  2RJZ A;  4O3Q A;  1HD0 A;  4WU2 A;  1TR0 A;  4KSE B;  2IDE A;  1N2K A;  2CFX A;  3QJL A;  2FVC A;  2ZFH A;  1TL4 A;  2WON B;  2B4O A;  1B64 A;  1N2L A;  4ID5 A;  2DH7 A;  1LV5 A;  3V4I B;  2VG5 B;  3GU0 A;  1SHQ A;  1Q53 A;  3KLH A;  3HI9 A;  3K5L A;  1T9Y A;  2D69 A;  4MHX A;  3L7O A;  2B6A B;  3NRB A;  1Q5Y A;  4F4X A;  1Y3K A;  4DUY J;  1VRT B;  1IBC B;  4URQ U;  1RT1 B;  3QQC D;  2MKS A;  2WVB A;  5LMN F;  2V9K A;  5ETV A;  1X4D A;  2WVC A;  2A6M A;  5HJY A;  2DY1 A;  1N0U A;  2PMZ D;  2BZ2 A;  3CJS A;  2Z4P A;  5KG4 A;  4DR1 F;  4ZP8 A;  3GSI A;  3M2U B;  1ULR A;  2CQ1 A;  3W9J A;  5DDP C;  4O3R A;  1EAR A;  2QL7 B;  5C24 A;  3M30 A;  1CLF A;  4GTW A;  3N79 A;  2P9C A;  1WC5 A;  5LT5 A;  2W2P P;  4I1T A;  1GH8 A;  1V3S A;  1NHU A;  2ZHO A;  4DFM A;  1AJA A;  2OO4 A;  5HI7 A;  4BS2 A;  3BN4 A;  3FMW A;  1MU2 B;  3HHL D;  3HVW A;  5HBM B;  1S77 D;  2G4B A;  2HFZ A;  4N5S A;  2YNG A;  3GZ7 A;  1QE1 B;  3H2U B;  1R0A A;  3TZX A;  1T7P A;  2HKE A;  1HNI A;  4ZLJ A;  2ZDO A;  5CAB A;  2MZT A;  2YWF A;  4LSZ B;  3Q23 A;  3LO3 A;  3DYA A;  5HVG A;  4AL7 A;  1GTE A;  1WC3 A;  2ALY B;  2RE1 A;  3P45 B;  1WC4 A;  5CZX A;  5A8K A;  1V5V A;  4OYO A;  4LR8 A;  3GV7 B;  5EGH A;  4ATN A;  1E6Y A;  5CH7 B;  1J5E F;  4I64 A;  5D0G A;  5CYM A;  3SV4 A;  1FRM A;  2EG1 A;  3KJV A;  3K5O A;  2Y1I A;  2G0I A;  3D66 A;  4WCE Q;  1DLO B;  2GO8 A;  4ZG7 A;  4JI8 F;  3DOM B;  2CJ9 A;  5JMN A;  1JXL A;  1EX8 A;  1FWP A;  1SQE A;  3CDE A;  2QLB B;  1RQ0 A;  4P7V A;  2KFZ A;  2DNH A;  1U2F A;  2R7S A;  3KG0 A;  3W8P A;  1NO8 A;  2VC1 A;  1FVS A;  2V8G A;  3HFV A;  2GQQ A;  3IS9 B;  3K8V A;  1NK6 A;  4ECT A;  2Z30 B;  4GVB B;  4KGM A;  5HRO B;  3OQ2 A;  2HVI A;  2BOP A;  2FZC B;  3PFE A;  2C3O A;  2GIR A;  2OPS B;  2W2M P;  2MJU A;  4R5P B;  4MY4 A;  1N5V A;  5E2Q A;  1VJQ A;  4DR7 J;  3TRG A;  2W8L A;  4K5S A;  1WAC A;  2OH2 A;  2VL1 A;  4F4Z A;  6AT1 B;  3HF5 A;  4D3H A;  3KTQ A;  1FNM A;  1NB2 A;  3CD5 A;  4HI2 A;  2AYG A;  4N8O A;  4P7T A;  1F5A A;  3AOA A;  2OTJ S;  4KRW A;  3FBF A;  1UA1 A;  1C0T B;  4NRU A;  5ETP A;  2QG9 B;  3HZG A;  4NLP A;  1FJG J;  1KOH A;  1N54 B;  3H40 A;  3CC7 S;  2ZH4 A;  4M5G A;  2EKY A;  2GMH A;  4J91 A;  1HNW F;  3MEK A;  3K2Y A;  4ZMM A;  3RAQ A;  2CG8 A;  2HIY A;  5J1N A;  2OML A;  4CM0 A;  1X5P A;  1UTA A;  3UD3 P;  4NZ7 A;  4PQU A;  3MED A;  2M5Y A;  1FRX A;  3OFF A;  2PDA A;  3I4P A;  2XI2 A;  1XR6 A;  2AEJ A;  2VU5 A;  5DET A;  3MFH A;  1SC4 B;  2HHH J;  4F02 A;  5D0R A;  2FY1 A;  4BC7 A;  1EZZ B;  4FN5 A;  1RB0 A;  4DV1 F;  3G87 A;  3M1V A;  2EXU A;  4N56 A;  1RT3 A;  4C8L A;  1O5J A;  4OHZ A;  1HAR A;  1HNV A;  2F1F A;  3QAU A;  4B02 A;  1RWO B;  1JLA B;  2V2Z A;  2B8P A;  3C16 B;  1TMM A;  1SI9 A;  2OMO A;  4IFY A;  3OXL A;  1HNZ F;  1FRK A;  4IG3 A;  3HHL B;  1E6V A;  2O66 A;  1RAC B;  2M9K A;  1E1Z P;  2XMA A;  2CDQ A;  5FDL B;  1JJ2 R;  3JSY A;  3R2C J;  4A8Q A;  5DZ7 A;  5EX3 A;  5HP1 A;  5BR8 J;  3PVX A;  1BY9 A;  2HAF A;  4EYI B;  1EB0 A;  4OYB A;  1XIQ A;  5BYQ A;  4DFJ A;  2L9W A;  3W2V A;  1YKW A;  5DQI A;  4KHM A;  4I67 A;  1E3C P;  2WVD A;  1RAF B;  4OJH A;  4OZ0 A;  2MKC A;  4KR0 B;  4USW A;  4ZPB A;  3M4X A;  4YDD B;  2CNO B;  3RR8 A;  2JOQ A;  1EKS A;  3Q8P B;  2KM8 C;  4CYU B;  4JI0 J;  4F2S A;  3UNG C;  3Q8Y A;  1IBM F;  1KH5 A;  4HR2 A;  2LEP A;  3LUY A;  4F7V A;  1AUK A;  5HMW A;  2HZV A;  1KHK A;  3OR1 A;  1NXI A;  2HK3 A;  1AXQ A;  1N36 J;  4DSF A;  1VQ6 S;  1CC7 A;  3D6F B;  5ETT A;  3EGZ A;  1NKB A;  3CJK A;  2WHO A;  3CJQ A;  4DUT A;  4Z37 A;  2W9C A;  3H5Y A;  3DLJ A;  4K5R A;  4DPT A;  1DTQ B;  2L08 A;  4MKA A;  1UJ6 A;  2B9W A;  2Q6C A;  1ANJ A;  3MMJ A;  4LF5 J;  4KIA A;  1Y7P A;  1HHQ A;  2LQB A;  1VQM S;  4DV0 F;  4RLE A;  2IA0 A;  5A8W A;  4NI2 A;  4FF3 A;  3IR7 B;  5KFQ A;  4HAC A;  2COL A;  4M1K A;  1BQN B;  5E3P A;  1OQ3 A;  3NAI A;  4NYZ A;  3BQ2 A;  2B8Q A;  4M5D B;  3MK0 A;  3QID A;  3U02 A;  3THP A;  4RW8 A;  4WWS A;  2W24 A;  2A3J A;  2GSU A;  2CIM A;  3QRQ A;  1HQU A;  3HZE A;  3PKM A;  1RWK B;  2CUY A;  1JKH A;  4H4K C;  5J1E A;  4B9L A;  3M32 B;  3TAN A;  3DLH A;  3R1L A;  1PGZ A;  2YQ3 A;  1SKW A;  3GLJ A;  2FIU A;  1R8H A;  2DNL A;  4ICL A;  1RAI B;  1C0U B;  1VIX A;  3PR5 B;  3OJU A;  4UZB A;  4O4R A;  1RK8 A;  2DRD A;  3U1L A;  1JLE A;  1S9E A;  1HW9 A;  4OFZ A;  1S6O A;  2P8I A;  1FKO B;  2V8H A;  1S1U A;  2ZH1 A;  3OSP A;  2FLN A;  1QTN B;  5IWA F;  4DL7 A;  5LSR A;  1NU4 A;  4ES2 A;  1ZBT A;  3RB4 A;  4HEA 9;  2DD8 S;  4J90 A;  3IM8 A;  2H65 B;  2G9O A;  2QA4 S;  4FPI A;  1WTF A;  1U25 A;  1UVK A;  1ALH A;  1WSV A;  2N3O A;  4L73 A;  4ZVF A;  3TA2 A;  4XTT A;  1X8D A;  2CWX A;  5A76 A;  1UW9 A;  3R1H A;  2GGP A;  1UWB B;  5DLG A;  1TFW A;  3E2D A;  4CLF A;  2X1B A;  4FPR A;  2BQ3 A;  1FJE B;  2E1M C;  1D9A A;  5DLV A;  2ZH3 A;  3MZI A;  2EFV A;  2GQC A;  1U6B A;  4ZJQ A;  1SL0 A;  3GCX P;  1XK8 A;  1PAU B;  2G0J A;  4CXS A;  1X4G A;  5ETN A;  1L3U A;  2Z2Z A;  2VAS A;  4ZKA A;  3JQJ A;  4ES1 A;  2J7K A;  1RA7 A;  2DIV A;  2CJA A;  3NMA A;  3JAM Y;  4PUO B;  1K7H A;  1UEU A;  5D3G A;  1WF0 A;  1Q86 T;  2XSF A;  1FK9 B;  2ZWP A;  1JXE A;  4AQY J;  1TUW A;  4ZCI A;  1Q8I A;  3VWS A;  4ED0 A;  4LF8 F;  4Q5V A;  3P49 B;  3W65 A;  1EW9 A;  5HMX A;  2JRS A;  4EGL A;  3A8J A;  3F41 A;  2BKP A;  4NOH A;  2ZBP A;  3KXD A;  4FNI A;  1FJC A;  4G1Q B;  1LWC A;  2DXF A;  8ATC B;  3KLE B;  2HNZ B;  1VBZ A;  2W8D A;  3JTN A;  3K7R A;  6FDR A;  1TK0 A;  4IDK B;  4FF2 A;  4M5J A;  4UST A;  2KJW A;  4XAK A;  2FC9 A;  4DOZ A;  4DBQ A;  1YZ7 A;  4C0H A;  1X4E A;  2XTJ P;  3R3T A;  2PN6 A;  4DV6 J;  1U0H A;  1PYO B;  1APS A;  4TU7 A;  3D9B A;  3T6J A;  3EXC X;  3K89 A;  3MM6 B;  2X7I A;  4Q2L A;  3CCW A;  4P72 A;  2CJQ A;  3HLU A;  2UU9 F;  2LP4 A;  2NXE A;  5FLX Y;  2M52 A;  4P9S A;  1RTI A;  2H4Y B;  3LP2 B;  1VHI A;  2MSS A;  1N0V C;  1OIA A;  3OBI A;  3M8Q B;  1L3T A;  4D3G A;  5A6P A;  3HFK A;  2EBE A;  5C42 B;  5B0F A;  3PW2 A;  3IAS 9;  5KG5 A;  2AEF A;  1ZM3 A;  2ZUG A;  3B4M A;  1CS4 A;  1SXL A;  4B9V A;  4FDF A;  1B0V A;  2QZU A;  3DLE A;  4KHP J;  2ZE2 A;  4DR6 J;  1DQ9 A;  1YI2 S;  2BJD A;  4X66 J;  1VFJ A;  2IMW P;  4PAB A;  4ZA1 A;  3M2V B;  2CVI A;  3BBF A;  2ILZ A;  3U7J A;  5FII A;  4QCL A;  3CSK A;  5ETQ A;  2RDJ A;  4LVN P;  1FFS B;  3ZZZ A;  3BO4 A;  1CJT B;  3OTC A;  3I0S A;  1XMQ J;  3CDU A;  2QL9 B;  1GNK A;  4KAI A;  3RTV A;  4DF4 A;  4C8Y A;  2WSF C;  1N4L A;  4WYW A;  3UQS A;  3BGR A;  3VQT A;  1SL2 A;  2J0X A;  3BQ0 A;  1IKW B;  2C3M A;  3N0V A;  2WBM A;  2AZ3 A;  4JI3 F;  3PX6 A;  2GX8 A;  4M5H A;  2XNR A;  5B0E A;  4EMD A;  3OTO F;  1OSD A;  1GQE A;  1YLX A;  3PEJ A;  4QWC A;  4DPW A;  1IR1 A;  1PO6 A;  3S8S A;  3H25 A;  3I9Z A;  4ECY A;  1VQN S;  2CXE A;  3NG8 A;  5C24 B;  2J8A A;  1FKP A;  3MPY A;  4H4M A;  5DG9 A;  2I2Y A;  2CJB A;  1JLG B;  4UOC A;  4ZN1 A;  3JB9 k;  2VQE F;  1U09 A;  1MW7 A;  1V3Z A;  2QFJ A;  5JVH Q;  3AB2 B;  5F8J A;  1RAB B;  1KWM A;  2QLF B;  3AH6 A;  1YIT S;  1U1O A;  4DPY A;  2D41 A;  2FC8 A;  4B3T F;  3CCZ A;  3PTW A;  3VGS A;  1WD6 A;  3PYG A;  2E9Z A;  2B7B B;  1GT8 A;  4CLY A;  3UDC A;  4GC6 A;  2CDR B;  3LF0 A;  1JLC A;  4DV5 J;  2DK2 A;  2Y1J A;  3DCA A;  4EBD A;  2G9Y A;  3R7N B;  3QAT A;  4ECQ A;  2MKY A;  3CO9 A;  3MFI A;  3T6B A;  2SXL A;  5C7P A;  1WSR A;  2VOP A;  1NHK L;  4LF1 A;  4JUZ A;  4DCJ B;  3NGU A;  3MR5 A;  1KP6 A;  1HQE A;  2NRE A;  4A8X A;  2R8K A;  3J7A N;  4ZPW R;  2E9R X;  5A6W A;  3DRX A;  2FD2 A;  2V4J A;  3A8K A;  5DZ6 A;  5KT5 A;  4AYB D;  4YY3 J;  2UXD J;  3PV8 A;  2FLP A;  2CPD A;  1GMW D;  5D4N A;  5L1J A;  2XM3 A;  2YY3 A;  4C9D A;  4NLQ A;  2PFF B;  3A8I A;  2R7U A;  1OPI A;  5K20 B;  2HAI A;  2HFO A;  4OI2 A;  1RCO B;  1Z4U A;  2VH7 A;  3UR3 C;  4CLU A;  2IJR A;  3RBZ A;  4JI7 F;  3NBP A;  5L1K A;  2CWK A;  5EGE A;  1YJV A;  2PD1 A;  3R5D A;  3LH2 S;  3GV5 B;  4JB8 B;  1LWX A;  4ERD A;  2LA4 A;  3PW0 A;  2ADC A;  1NHV A;  3C66 A;  3TWZ A;  3MM7 A;  2OTL S;  3W2W B;  3PZP A;  4CZC A;  4ZJL A;  2M2B A;  3S7R A;  4F4A A;  4B3S J;  3UCG A;  1SC1 B;  4KFB A;  2GS8 A;  5CXT A;  2B56 A;  1K73 T;  4LR9 A;  5D0E A;  3ULH A;  3BR9 A;  3MAA A;  2HHU A;  5IJS A;  3DRP A;  1W2B R;  4Y3C A;  3D4J A;  2WOM B;  2D1C A;  4CO2 A;  2F9J A;  3BJY A;  1DY3 A;  3PDN A;  3A3P B;  2HRY A;  2W2O P;  2WSE C;  4YEA A;  4CDI A;  2ZC4 A;  1OPZ A;  4YR2 A;  4P73 A;  2D3U A;  3VQS A;  2W5X A;  3SQG B;  3H0P A;  2RH6 A;  3B8H A;  1U24 A;  2NXU A;  4P2X A;  1U0S A;  3NWR A;  2VG7 A;  3HJF A;  3OUY A;  3FBC A;  2CNK B;  3UFC X;  3EVO A;  1SH0 A;  3LGH A;  1Q0N A;  2PC6 A;  3HFZ B;  1F9F A;  4USM A;  3NNH A;  1BD6 A;  4V19 J;  3MED B;  5GRR A;  3SBM A;  5EUH A;  3LAM A;  5BYS A;  3TAQ A;  1PIL A;  4URS A;  2G13 A;  4AD6 A;  4KH1 B;  3GJQ B;  3GSD A;  3DGP B;  2X1G A;  4N76 A;  3M1V B;  1IBK F;  4RWW A;  4UPH A;  2EFG A;  1G1X A;  3J7Y U;  1B0T A;  4FYV B;  4DG1 A;  3DHW C;  1AUD A;  4OYW A;  3Q3Q A;  4Q43 A;  2V4Q A;  3UN3 A;  2YXL A;  1E6V B;  2BXJ A;  3CMQ A;  1ZH5 A;  4R8U A;  4NXN F;  2ZH7 A;  4ZVR B;  2XG8 A;  2OEM A;  5E3C A;  1Q1K A;  2EG2 A;  1A7G E;  1JLF A;  3V4M A;  5IJQ A;  1SKR A;  3H5X A;  3K5M A;  4RW7 B;  4LFA F;  3LQV A;  4YME A;  2R2U A;  3KLF B;  1QAI A;  3GFZ A;  2JEJ A;  3NGT A;  4ZS6 A;  1JLB A;  1VBX A;  2GNK A;  5A8R A;  4EYH B;  1G7C B;  1SKU B;  5KOX A;  4DR5 F;  1RGV A;  1R89 A;  3V81 B;  1ZET A;  3T9N A;  4TY9 A;  1IKX B;  4URG A;  4EO6 A;  3M9M B;  1YIJ S;  5EHH A;  4ED5 A;  3G86 A;  2Z58 B;  4PG6 A;  5JJB A;  2XYG B;  4NWB A;  2K7K A;  3FCH A;  4RUH A;  2IBK A;  4ELT A;  1IXK A;  1DBD A;  1Q5V A;  2BJ1 A;  4DR4 J;  4JI6 J;  4LF7 F;  3SI8 A;  1Y9O A;  2L9N A;  1HHT P;  1OY9 A;  3DC2 A;  4NZ6 A;  1GX6 A;  4UOG A;  3QRR A;  5KFP A;  4MK8 A;  1R3N A;  1NZ8 A;  2J6T A;  3NKO A;  5B0G A;  4C3K A;  4KV8 A;  3G6V A;  3VHQ A;  3EXY A;  3JAM U;  1KFD A;  2K1R A;  1LFW A;  5CD4 H;  1H98 A;  5A8W B;  2HHS A;  2DNO A;  3CDW A;  4J5O A;  4MMO A;  4IOA Q;  3UN5 A;  2HUR A;  8RUC A;  3R97 A;  2FJE B;  3J7Z T;  2XY5 A;  3DLG B;  3TX0 A;  2JC1 A;  1WC6 A;  2ACY A;  3TAP A;  2GMJ A;  3JTP A;  3BYP A;  2FYX A;  5B08 A;  2LYV A;  4DR7 F;  3KJN B;  2M0G B;  3T1H F;  2XZD B;  2LFV A;  1OY6 A;  2DB1 A;  2GFF A;  2HRU A;  2LEC A;  2OD6 A;  2QJ3 A;  4U7U K;  4R0J A;  1Q78 A;  1WEZ A;  2CVE A;  2DY9 A;  3BBC A;  4FP9 A;  9ATC B;  4I56 A;  1B0P A;  2AZ1 A;  2J9D E;  1C1B A;  1BQX A;  5ETK A;  1MN9 A;  3KMS A;  2R4F A;  4HKQ A;  3U27 A;  5IV3 A;  4AUK A;  4DLG A;  1NM2 A;  3IAM 9;  2VKZ G;  3BB5 A;  1ALJ A;  2UP1 A;  2UUT A;  2ZEJ A;  2G0C A;  3I6P A;  4YS2 A;  5FLX U;  1IBL J;  3CJ3 A;  2DH9 A;  4B3O B;  2J9D A;  1CUL A;  1T9U A;  4F25 A;  3RU0 A;  4NML A;  5D4O A;  2K3I A;  4DX7 A;  1D8Y A;  4WTO B;  1AJD A;  2YKQ A;  1G4C A;  5KFD A;  4A8M P;  3Q8S B;  2R9L A;  9RUB A;  3R5C A;  3LPE A;  1A9N B;  4ZVH A;  1ZEF A;  3FEZ A;  1X4F A;  3MEC A;  4LRB A;  5ETL A;  3DOL B;  3IA0 A;  2ASJ A;  2MKI A;  3KG4 A;  4DU7 A;  3WAV A;  3DNC A;  1TKX A;  2AP6 A;  4GTY A;  3IDD A;  1WJ9 A;  2ZOG A;  2AF6 A;  2LQ5 A;  2DTJ A;  4NLV A;  1SKS A;  4KKO B;  2XYP B;  3VAK A;  1HJK A;  5IXU A;  3BGO P;  2X3D A;  2RU3 A;  1SJ4 P;  3SMZ A;  3Q8Q B;  3DMJ A;  5BR8 F;  4M95 A;  3OD2 A;  1PJ6 A;  3RW7 A;  1VRQ C;  2VG6 A;  5L0E A;  2IBO A;  5EN1 A;  3MOZ A;  4QIG A;  3E8O A;  3NNA A;  5A0Y A;  3MM9 A;  3LAN A;  1M5O C;  2BMB A;  4HLB A;  1EAY C;  1GEH A;  5D3G B;  3G8T A;  2AGO A;  2RKI B;  3GII A;  3HCX A;  2YTC A;  2NSB A;  4LRE A;  4GKK F;  4ZVQ B;  5J2N B;  4O23 A;  3I0R B;  2DIT A;  3MR3 A;  3FMB A;  3W9I A;  3RGI A;  4KAY A;  4F3O A;  3PYF A;  4CM2 A;  3IG1 A;  4CQ1 A;  2A6O A;  3IN5 A;  2FVR A;  1KLM B;  1FDA A;  1N33 F;  3QYY A;  5HSP A;  2MKH A;  3RBX A;  1LK5 A;  4P2S A;  2JZ5 A;  3BH6 B;  2VFV A;  1LW0 A;  4ZOS A;  4JYA J;  3NKM A;  4LR7 A;  2B0G A;  4W4M A;  1S99 A;  4IUF A;  3R5B A;  3I32 A;  3TA1 A;  4C3L A;  4IH5 A;  3CDA A;  1RAE B;  2EFO A;  1PJ5 A;  4QJV A;  2RML A;  2HHX A;  3KK2 A;  4LBI A;  4CLZ A;  2Y1R I;  3CT9 A;  5DG8 A;  3R5J B;  2XCA A;  3ZO7 A;  3SCJ E;  1MSW D;  2DHG A;  4TXS A;  1F9H A;  1TKD A;  3BDE A;  2KO1 A;  2QZ8 A;  3H2V E;  2BA9 A;  1GXL A;  2D1G A;  2XMU A;  2R8I A;  2QIF A;  4R25 A;  2MYF A;  3DXB A;  1LWE B;  4EI2 A;  1VRU A;  1X9M A;  1WC1 A;  3W5X A;  5E5N A;  3SQO P;  2OPP A;  4DZD A;  2RRA A;  5K4P A;  5LRN A;  3CPW R;  4DN9 A;  2W5Q A;  3AB4 B;  4IOC Q;  3GYX B;  4DDF A;  3QT7 A;  4M5N A;  2ZE2 B;  1XEZ A;  5IFM A;  1XMO J;  3GJT B;  2ZC3 A;  4QW9 A;  1AZS B;  1TKZ A;  1S6P B;  3TZW A;  2GAH C;  3SZZ A;  4Y6I A;  2XC9 A;  2FZG B;  3OXF A;  1XNQ J;  3JXO A;  1KHL A;  3L7P A;  2AWZ A;  1ROF A;  2YX4 A;  4Z2X A;  4QIE A;  1RT6 A;  3S01 A;  1RI7 A;  3D0H E;  2DGQ A;  2AX1 A;  3T9Z A;  5F8I A;  2OPQ A;  5K14 B;  2PSZ A;  2YQ0 A;  3RB3 A;  3IRX A;  1YGY A;  4O4G A;  4PPZ A;  4O0N A;  3PJW A;  1KQK A;  3JQK A;  2ROP A;  2DH8 A;  3CJ0 A;  5IC6 B;  4DF8 A;  2Z2Y B;  3ZZU A;  2XLJ A;  4O0I A;  3MDF A;  4FDI A;  2FVQ A;  1UVN A;  3IGN A;  3K59 A;  3UWT A;  2GML A;  2XY7 A;  1SJR A;  4XDC A;  4K2J A;  3B5Q A;  2JL9 A;  3UE2 A;  2DYA A;  2Q43 A;  3MAQ A;  1FSU A;  4BHQ A;  3RRH A;  3UCZ P;  2E1C A;  2Z2M A;  4ZIW A;  1HHS A;  4FBT A;  1K0T A;  4LSN B;  2GVZ A;  4I2P B;  2QN6 B;  4NLG A;  2QSW A;  1U48 A;  4OX9 J;  4GKJ F;  3KUH A;  4AQY F;  3CVK A;  1X4A A;  5M2R A;  4G65 A;  3DRS B;  3C15 B;  3EDQ B;  1VQK S;  2XMW A;  1YJ9 S;  4NXM J;  4O3O A;  3KK1 A;  1U1M A;  1NZA A;  2GLQ A;  4TU9 A;  5L0K A;  3ZTQ A;  3NKN A;  1I6J A;  3H2L A;  1HQE B;  3MWB A;  4RNO A;  2AHO B;  2W8K A;  4LF6 J;  4WK3 A;  2ZH9 A;  4USI A;  4CLW A;  2YX1 A;  4DLE A;  2UVR A;  2OGU A;  2V4J B;  4KGV B;  2R2T A;  2IJN A;  3POT A;  3TJA A;  4IRK A;  1RDR A;  3KJF B;  1ZM2 A;  1U6Z A;  4RW4 A;  3QO9 A;  5HMZ A;  3KWM A;  4RU2 A;  3MTJ A;  3TUI C;  3JYT A;  2C2N A;  4J9Q A;  1RT4 A;  3J7Z 5;  2YPY A;  1AJB A;  3RR7 A;  4MJK A;  3SEO A;  3BKT A;  4K4V A;  2DT9 A;  1WOR A;  4WFB Q;  1VLO A;  3N6L A;  5CYQ B;  4X4O A;  1YRT A;  3AD9 C;  4K4Z A;  1SIZ A;  3TQ1 A;  5CD4 A;  3LOU A;  3M2R B;  3QSY B;  2G1D A;  2RF2 B;  2MZR A;  3VV2 B;  4LT6 A;  5I42 B;  1C4C A;  3Q86 A;  2WON A;  3SZY A;  5KAK A;  1VBK A;  2LU2 A;  3V4I A;  2VG5 A;  2C22 A;  1UKU A;  4RBV A;  1Q8K A;  1ZPW X;  2G2O A;  2OHD A;  3NCQ A;  1UVI A;  3W9H A;  3FFI B;  5G4D A;  4OYI A;  1SUQ B;  2P6T A;  1NDC A;  2B6A A;  2UUC J;  5HQM A;  3SCL E;  4KHP F;  4X4U A;  3K8W A;  3A52 A;  3OPK A;  1VRT A;  3GFH A;  5KFF A;  3CUL A;  1EET B;  1RT1 A;  1R8B A;  1HNX J;  2DNR A;  2HMI B;  3O1L A;  2BYC A;  4CH7 A;  5I3P A;  4HDG A;  4M5K A;  3RB6 A;  2YH1 A;  3F44 A;  4NA2 A;  4ZVP B;  5KFR A;  1F5C A;  2W8S A;  1XMQ F;  5HLF B;  1U4B A;  3PAC A;  2RUG A;  1ZAX A;  3AOC A;  3T5K A;  3M2U A;  2VA2 A;  2MZS A;  3V6D A;  2D3O 1;  3AQO A;  2NZ4 A;  1O99 A;  2NUU G;  2NUH A;  3B78 A;  1XNR J;  3ED4 A;  1CSJ A;  5TJ3 A;  1NB7 A;  2CPX A;  5DO2 A;  1K8A T;  2GIQ A;  3CME S;  4ENO A;  2VJU A;  1MU2 A;  1JB0 C;  5CYJ A;  4A8S A;  1TAQ A;  5HBM A;  3NGS A;  4CLP A;  2F65 A;  1D8Z A;  1QE1 A;  3CTR A;  5HVF A;  2QRR A;  4DG1 B;  3D28 A;  1D9F A;  4DN0 A;  2GVD B;  1WG4 A;  2RQM A;  2HZA A;  3T19 A;  1NAQ A;  4PXB A;  3D1Q A;  5LXR A;  1FDB A;  3EGV A;  3MXH P;  1FD8 A;  3NCP A;  3C6T B;  4IG0 B;  1QVG R;  3H42 A;  4DV5 F;  1RT5 A;  2DBB A;  1AJC A;  2PII A;  1R8P A;  2XSJ A;  3EIC A;  4ER8 A;  4JV2 A;  3G8Q A;  2B7C B;  4ZPC A;  3ZZR A;  4ID8 A;  2CQ2 A;  4C8M A;  1QJH A;  1T95 A;  4IYQ A;  1LXJ A;  2F7V A;  1DLO A;  4TU8 A;  1FJ7 A;  3DOM A;  3G6X A;  3A8E A;  3BSA A;  1SCJ B;  4JI1 J;  3R7B B;  4WKY A;  2H1Y A;  1KSP A;  2UXD F;  2V94 A;  3PO5 A;  2H9Z A;  1Z1Z A;  4F0M A;  5F41 A;  1T02 A;  4DUZ F;  4OJ1 A;  3QGP A;  1LKZ A;  1TUV A;  4KPC A;  1M0S A;  3H8Y A;  2ZHB A;  1JMT A;  4ZCM A;  1S9F A;  2V0N A;  2JDJ A;  2K8G A;  3MK1 A;  4QQB A;  2HK2 A;  4GVB A;  5HRO A;  1RWX B;  1Q95 G;  3EE3 A;  3MOJ B;  2LQ9 A;  2OPS A;  4ZVG A;  3O6Q A;  2XMV A;  3ICL A;  1HWJ A;  2MZQ A;  1T9V A;  4KB7 A;  3X1L B;  1RHR B;  3A1Y G;  3SXL A;  5K9F A;  3ETO A;  2W5R A;  3CCQ S;  1EQM A;  3G82 B;  5E3R A;  1U8W A;  3WBH A;  1TVR B;  4B3S F;  2WB1 D;  1NKE A;  1JJC B;  2XWX A;  1C0T A;  3MD1 A;  1X9W A;  1E2S P;  2L3M A;  5AJ9 A;  2RH3 A;  4JI4 J;  1GMU A;  3EZO A;  2WVE A;  4P10 A;  3ZTR A;  4A46 A;  2ZKT A;  4CO5 A;  2C2R A;  2R7V A;  4L76 A;  2BM1 A;  1IM4 A;  3BH7 B;  2I1R A;  4U7U D;  4KC5 A;  3UR0 A;  4N8N A;  3AHP A;  3FK4 A;  3MPU B;  2RD5 C;  1RIS A;  3CIM A;  4Y2M A;  2MY7 A;  3MCN A;  3N4W A;  4QU6 A;  3RG6 A;  2VBY A;  2GO9 A;  4PRF A;  3KLI A;  4KQZ A;  1HKA A;  4ZVU B;  5KFX A;  1OS5 A;  1JLA A;  1SPB P;  1XMB A;  3C16 A;  5KT6 A;  3HHL A;  2G2Y A;  1QAY A;  3IXQ A;  2PI4 A;  3DOK B;  4X4R A;  2Z56 B;  3CNQ P;  3GWC A;  4QWA A;  4B9M A;  3A3N B;  3EZ5 A;  5FDL A;  2CPE A;  1T03 A;  4DFK A;  3AT1 B;  4QYR A;  2HHT A;  4KPY A;  3AOB A;  2VKR A;  2WAQ D;  4H4O B;  1RYR A;  5LJ3 Y;  1D09 B;  3GG0 A;  5F8H A;  4B3R J;  4EBC A;  1S6Q B;  1TV6 B;  1RA6 A;  2P5V A;  1P49 A;  2XI3 A;  4C7Q A;  1HDH A;  1L3K A;  7AT1 B;  4ZHR A;  2HBR B;  2YVS A;  2CYY A;  4CT9 A;  4CYU A;  3E01 A;  2Z57 B;  4CH0 S;  3KFW X;  5U47 A;  1TFY A;  1D0E A;  3TOQ A;  1FDD A;  2X98 A;  1WI6 A;  3WQP A;  1C1C B;  3MM9 B;  2CPJ A;  2D3Z A;  3HT0 A;  1U2C A;  2KL8 A;  2DIS A;  5K8M A;  2AYB A;  1DTQ A;  2XS7 A;  1RHU B;  2E9T A;  1NH7 A;  4J9V A;  2GA3 A;  4CCH A;  1Q82 T;  3IWN C;  5M2U A;  2C3U A;  4GO5 X;  2J7U A;  4Y2I A;  1RAG B;  2YNF A;  1M5S A;  4E98 A;  2QA2 A;  4WFY A;  4AL5 A;  4ZPV R;  1PYS B;  4E8U A;  4F04 B;  1BQN A;  2XO7 A;  4QW8 A;  2UXC F;  4M5D A;  2DPJ A;  4OV1 A;  5INH A;  4W92 B;  2IRY A;  3V6J A;  4IOB A;  3TX8 A;  5DQH A;  2IIH A;  1REG X;  3PXG a;  5L1L A;  3KK2 B;  2ZNZ A;  1YRX A;  3PRB A;  4Q44 A;  2ZDP A;  3M32 A;  4XO0 A;  4NLU A;  3TJ8 A;  3H7H B;  3VAH A;  2IJF A;  4WP9 A;  5KFO A;  1NRK A;  5DM7 Q;  3Q0A A;  1YDL A;  3TYT A;  2XYH B;  4RX6 A;  1C0U A;  4C8Z A;  2XHW A;  4RNN A;  1N32 J;  4ED4 A;  4OZ5 A;  2W9B B;  4OI3 A;  1SC6 A;  3AJ2 A;  1FKO A;  4J9N A;  2VDI A;  1U1K A;  3FCV A;  1QUV A;  1T9X A;  1IKV A;  2DR9 A;  3PRV A;  1NJZ A;  3FCW A;  3NY0 A;  4WFZ A;  5DLT A;  3DLL Q;  3UD5 A;  4U8V A;  2V63 A;  1M1K T;  4WFX A;  3QFW A;  1J5O A;  1S59 A;  5L39 A;  4RUA A;  4EEY A;  3OR2 B;  3TAM B;  5KOW A;  3D1O A;  1RKI A;  4ZP6 A;  4DX5 A;  5LSL A;  2KU7 A;  2NXJ A;  4KGK A;  1IWA A;  2W5S A;  1W7W A;  1IBL F;  1S6U A;  2MLZ A;  4NLT A;  4WJB A;  2OPQ B;  4CO0 A;  4Q0B A;  2FHO B;  3CGI A;  1UWB A;  4ETX A;  1U6F A;  4IRD A;  5L0B A;  1S1T B;  3CO0 P;  1RTJ B;  1Y5N B;  1UEK A;  2UUB F;  1N5S A;  2V34 A;  4P2M A;  1KQS R;  1B4S A;  3UW1 A;  4ED2 A;  3MMB B;  1H6K X;  4WU3 A;  3PY8 A;  4LBP A;  2FUG 9;  2XMJ A;  4GTX A;  2RDI A;  5CCL A;  3C8Y A;  5D78 A;  3KHH A;  3IR6 B;  1PIE A;  1PKU A;  4PUO A;  1R6Y A;  5HO4 A;  4WII A;  4Y2C A;  2N7C A;  1FK9 A;  2V4R A;  4YR0 A;  1M5P C;  2YBV A;  2LKZ A;  2MQ8 A;  3M8S A;  2LQJ A;  2GVZ B;  1I94 J;  2MLY A;  3BSO A;  4ALZ A;  4KJD A;  4KGZ B;  2X1A A;  2HQF A;  3MUV P;  5CQG A;  1N8R T;  2D74 B;  5BYR A;  2HZC A;  1YX2 A;  3IR5 B;  3DI6 B;  4H4K A;  1AFI A;  3OL6 A;  2UV8 A;  3KLE A;  2HNZ A;  3V5R A;  2CZV C;  4IDK A;  1S12 A;  3KK1 B;  1PBA A;  3NWG A;  1PC4 A;  3KHL A;  3ELH A;  2DHA A;  4PKD B;  1VC0 A;  3PM9 A;  1D3W A;  1NBE B;  5KFN A;  2CQ4 A;  4XDD A;  1L5U A;  2IUC B;  3MM6 A;  4NA3 A;  2FHJ A;  3CXC R;  3AXM A;  4JYA F;  1N6Q B;  3GG1 A;  1PC5 A;  1VMB A;  2Z0G A;  1FRI A;  3LP2 A;  4P74 A;  3TAR A;  3GTY X;  1JWW A;  2XCP A;  2QMW A;  2GJI A;  3M8Q A;  2D9O A;  3D6H B;  2WTF A;  1TL3 B;  3OJS A;  3C2P A;  1WHV A;  4DX6 A;  2V68 A;  3EX7 B;  1NK0 A;  3MEG B;  3GB0 A;  1ZM9 A;  4PEO A;  5AJ3 J;  2HGL A;  1SL1 A;  2KTQ A;  1IR2 A;  3CD0 A;  4Y00 A;  3EVW A;  2VBZ A;  5AXK A;  2OPR B;  1G6B A;  3T1A A;  2HRT A;  1JLQ B;  4DX8 H;  2N4D A;  2FJB B;  1YHQ S;  2AT1 B;  3M2V A;  1YRU A;  3IM9 A;  5F8L A;  2KVI A;  3KG1 A;  2ASL A;  2I6W A;  2HPU A;  3LAL A;  4X64 J;  1CJT A;  4NLX A;  4PYD A;  1RAO A;  4C8O A;  4YR3 A;  3BKF A;  4FKY A;  2QA1 A;  2QO3 A;  1F5B A;  3TUZ C;  4IFV B;  1RXO B;  3BRE A;  3G8S A;  4Q8F A;  1XNQ F;  2B4V A;  3I5B A;  4OYA A;  3B4D A;  1IKW A;  4Q45 A;  3VGV A;  2IM0 A;  1KN6 A;  2DNQ A;  2RHS B;  4NX9 A;  3W5Z A;  4WPA A;  3FBE A;  2MEW A;  4DV3 F;  1S5Z A;  1S9G B;  4OZL A;  3EYZ A;  2QC3 A;  1OYD A;  5T7L B;  1R7I A;  3MD3 A;  3BF4 A;  2AJ1 A;  3V6D B;  5T14 A;  3HVT B;  3W7B A;  8AT1 B;  1OWX A;  1WKJ A;  1JLG A;  5C25 B;  2MKK A;  2VFU A;  3N9U C;  1VGY A;  2XZT B;  4J9U E;  2UVV A;  5GAD U;  1KC8 T;  2KRB A;  5H9F K;  3PHE A;  2KG1 A;  3HVA A;  5B0C A;  3HD2 A;  1B99 A;  1BUX A;  1RHM B;  4P71 A;  2KFY A;  3QNW B;  2NCK L;  4QOT A;  1IN0 A;  1YZ6 A;  4IKA A;  1KHN A;  2AX0 A;  1F0X A;  2L48 A;  2C2Z B;  3LP1 B;  1ZYQ A;  1KHJ A;  2CNL B;  1FO1 A;  5GMK a;  3HHE A;  1LNQ A;  4RW9 A;  3N5B A;  2GA7 A;  2YNH B;  3PJX A;  4OI4 A;  4QIF A;  2O3D A;  5AXN A;  4ED8 A;  4NLY A;  3D0G E;  2HFN A;  1RT7 B;  2JLG A;  3ENA A;  2X3G A;  3QZ8 A;  5KFE A;  4OX9 F;  4DFP A;  4J7C A;  4EZ9 A;  4NE9 C;  1HPZ B;  5IT4 A;  4N7T A;  1QLN A;  3GON A;  2BW7 A;  1RAA B;  4I6W A;  1RT5 B;  3OHB A;  4UUW A;  3G96 A;  3THV A;  1Q79 A;  2XSJ B;  4QR2 A;  2DGT A;  2QT7 A;  1WTB A;  2LDI A;  1QY7 A;  2DR8 A;  4NXM F;  4RNH A;  3SZ2 A;  1BHN A;  3EDR B;  3T41 A;  2J8S A;  4B08 A;  4ILR A;  2PEH A;  4X2B A;  2CA9 A;  3CB4 A;  5IZH A;  4C2M A;  2ILY A;  4LF6 F;  1UZD A;  2W7A A;  2VFR A;  2FHK A;  3FQL A;  3QJP A;  4BDP A;  2C3Y A;  2BJ9 A;  4MIB A;  4DPX A;  1XC9 A;  2JVO A;  5C66 A;  2P2C B;  1HI1 A;  4DQI A;  1U1P A;  3F56 A;  5CCM A;  3D7S B;  3NCR A;  1H7X A;  2HBQ B;  2BAN B;  1FX2 A;  2GHW A;  2IVM A;  3RRK A;  3W2W A;  2VQR A;  4ECS A;  1RTD A;  4IH7 A;  4OHV A;  3OFE A;  2OUG A;  2MKJ A;  3AJ1 A;  1GMV A;  1V5I B;  3L3C A;  3SCI E;  2A1B A;  4ZP9 A;  3UDV A;  5L1I A;  3PG9 A;  2R7W A;  2ZIT A;  2WOM A;  4ZCK A;  1WHX A;  4OZN A;  4P52 A;  3FSX A;  4RW6 B;  4MIA A;  1K1S A;  4J9R A;  1CJU B;  3C6U B;  4GVL A;  1NH8 A;  3WAW A;  2F63 A;  2JNJ A;  1ZA2 B;  4O3N A;  1F2G A;  1XN9 A;  4WE1 B;  1MWQ A;  2UUC F;  3SQG A;  4OZ1 A;  3GIM A;  1ELZ A;  4X62 J;  2RHQ B;  3QGH A;  4RKU C;  3FGV A;  4MH8 A;  1EHW A;  3TR5 A;  3L95 X;  4ECU A;  4JI5 J;  2WB4 A;  3RBE A;  3VAI A;  5THW A;  4PWW A;  4PG5 A;  2W7P A;  4ANC A;  3M8Z A;  2FJX A;  1N34 J;  3V6H A;  4C8N A;  2DGW A;  2YKP A;  2CPZ A;  2MQP A;  4WP8 A;  4F50 A;  2XLK A;  5G0R A;  5KG2 A;  5D15 A;  3HDS A;  4B17 A;  2CQH A;  3S1T A;  4UPI A;  3M9O B;  1T9T A;  3PX4 A;  3DGP A;  1LXN A;  1MRO B;  1TL1 A;  1AW0 A;  3ETM A;  2F4F A;  1HNZ J;  4LRD A;  2RRN A;  3H4B A;  2V9W A;  2PE8 A;  3KLI B;  2HVD A;  4QR1 A;  2DHX A;  2XQC A;  2XZW A;  3SV3 A;  4DCO B;  1XNR F;  4OX7 A;  4IO9 Q;  2EW9 A;  5EWG A;  2DNK A;  3TEH B;  3MF5 A;  2NS1 B;  2VB6 A;  4AXI A;  1VHF A;  2HVE A;  2C3P A;  1T03 B;  4OJG A;  3IBW A;  4TLR A;  3LXQ A;  3MR7 A;  2AJ2 A;  1Y6V A;  2CQ3 A;  4F4W A;  3PX0 A;  3FVY A;  2V8V A;  2GZO A;  2XS5 A;  2QL5 B;  4RW7 A;  1IBM J;  1V9O A;  4PWU A;  5B09 A;  3VAJ A;  3NMR A;  2AYM A;  3KLF A;  1FD2 A;  1F2H A;  1UJ4 A;  3QGG A;  3PIP Q;  5F0U A;  1NPR A;  4ED6 A;  4X65 J;  3W63 A;  1I5O B;  7FD1 A;  4ZHR B;  1SH3 A;  5GME A;  4JV1 A;  5LMU F;  3V81 A;  3E01 B;  2R8J A;  4K59 A;  4DV2 F;  2VOO A;  1IKX A;  2HHV A;  4B3M F;  4FVC A;  3M6X A;  3MM8 B;  1NDK A;  2F8H A;  3WHI A;  2CJY B;  4HYK A;  1X0P A;  4YP3 A;  1TL7 B;  1GMW A;  1R31 A;  4A48 A;  1WKK A;  4KJI A;  1RSC A;  1J2V A;  3L09 A;  3CCV S;  2GHP A;  1HBO B;  1O98 A;  2EPI A;  4HVZ A;  3CCM S;  4EO8 A;  4JI1 F;  1UPM B;  4MYT A;  2LQ8 A;  4DV0 J;  1H2T Z;  3H90 A;  1RU2 A;  4LF4 J;  1MLA A;  4YN3 B;  3FDS A;  2KZZ A;  4MIV A;  2WRM A;  2DPI A;  3MMC A;  2BKN A;  1K1Q A;  4I7F B;  1DFD A;  3TNV A;  1UET A;  2YNF B;  1UW4 A;  1FT8 A;  3VVT A;  1NUE A;  4NPO A;  5J2Q B;  3JSM B;  3M6U A;  2E7X A;  2QLW A;  1FXL A;  2VIH A;  1HI0 P;  2Y1L B;  2CZ4 A;  3TW0 A;  3CCE S;  2EC0 A;  5GAD I;  2Q1L A;  4FNH A;  1BC6 A;  2FHJ D;  3DLG A;  3LWL A;  1EP4 B;  1BLU A;  3FEY B;  2HG4 A;  3FUY A;  1SVD A;  1TK8 A;  2HQD A;  1Y7A A;  2W9A A;  5HK4 A;  2DCL A;  1HBU B;  2J9C A;  1SC3 B;  3QT8 A;  1X7V A;  2F4V F;  3R8Y A;  1UVJ A;  2R7R A;  2OKQ A;  1RAH B;  2XMK A;  4OV6 A;  4X4V A;  3RB0 A;  1KTQ A;  2HS0 A;  5DDO C;  3P4U B;  4LVO P;  2BUN A;  1Q81 T;  5IWA J;  3QLH A;  4DWI A;  2DXE A;  4JI4 F;  4OMF G;  3DFE A;  3MTK A;  2R42 A;  1F6T A;  3DU5 A;  5DQG A;  2AU0 A;  1IKV B;  4RUB A;  2G2Z A;  1YBA A;  3MUM P;  4B3O A;  2NR0 A;  2YQ1 A;  1J5O B;  4UOF A;  4P75 A;  1Z2L A;  2BQR A;  2DRA A;  4L3N A;  4ECZ A;  4K0K J;  4C48 A;  4LIR A;  2XBP A;  3DKD A;  3I96 A;  1RUS A;  4DS5 A;  3IO1 A;  5HRT A;  4CLL A;  4MK7 A;  2E1R A;  4RJV A;  1SJQ A;  3DOL A;  4ZG9 A;  2KM8 B;  2OJ3 A;  1FE4 A;  3BSC A;  4Q0B B;  5H9F J;  1FE0 A;  1FDN A;  4LF2 A;  2AV5 A;  1WOS A;  1KEK A;  5A2Q Y;  2MQQ A;  4B9T A;  4KKO A;  1Y10 A;  2I38 A;  5KFI A;  3DHX A;  2CJK A;  5IC4 B;  5KXA A;  5DM6 Q;  2ATL A;  1WDT A;  3UI3 A;  2OSQ A;  3NOC A;  3OLB A;  4OZ3 A;  2F8M A;  4WZM A;  5DDQ C;  3HHK A;  1DTT A;  3QRP A;  1S4E A;  1ARO P;  1M1G A;  2BV3 A;  4RNF A;  4JV5 F;  1X31 C;  2H48 B;  1CEZ A;  1UFL A;  1M5H A;  3BDF A;  3US5 A;  2VV5 A;  3IMQ J;  4OLO A;  1X4B A;  3KK3 B;  2QTW A;  3D3B J;  2KYX A;  2RKI A;  4DSL A;  3AAW B;  4ELV A;  2V2K A;  4NCA A;  2VD3 A;  1GK8 A;  1UP1 A;  4Y2K A;  2ZBC A;  2C2E A;  5J2N A;  4CTA B;  3I0R A;  2I5J B;  2GSN A;  1S10 A;  2JHE A;  1U1L A;  2JEF A;  1KLM A;  5F9L A;  4OLP A;  4DQQ A;  5E3A A;  2ZHA A;  3Q2T C;  2CKW A;  3W64 A;  5T41 A;  2UUA F;  4RR5 A;  5EDW A;  1DAX A;  5HAO A;  1AUS L;  2IVY A;  3OTD A;  2F8E X;  5K8O A;  3EPI A;  2CPF A;  4J9L A;  2HBY B;  2E7V A;  5DRK A;  3AFG A;  2UXB J;  3T5J A;  2BE9 B;  1VQS A;  1WEL A;  1S0O A;  3O5T B;  3NNC A;  1ZS6 A;  4DSK A;  1CJK B;  4NCB A;  3RUB L;  1FRJ A;  1OJ4 A;  1R0C B;  3CCJ S;  1CG2 A;  2OEJ A;  4USH A;  1HL6 A;  3MCS A;  1U26 A;  2U2F A;  2IHR 1;  3ZNJ 1;  3L4B C;  1LWE A;  2BAB A;  4RBU A;  3OL9 A;  2CPI A;  1NSA A;  2MQM A;  5KFM A;  2RQK A;  2VDH A;  3KDO A;  2DNY A;  1NND A;  4A8O A; 
#chains in the Genus database with same CATH homology
 1Y6V A;  3T01 A;  4KAV A;  3UNY A;  3MK2 A;  1ANJ A;  2IUC A;  5EGH A;  5INH A;  1P49 A;  3M8W A;  2W5S A;  4UOP A;  1K7H A;  5L0E A;  4LR9 A;  1HDH A;  5IJS A;  1E1Z P;  2GSN A;  3Q3Q A;  3BDG B;  3M8Z A;  2GLQ A;  3WAX A;  3UN3 A;  5L0K A;  3NKN A;  5DLW A;  3T00 A;  2W5T A;  3BDH A;  3CMR A;  4LR2 A;  3WAY A;  5HRT A;  1ALJ A;  1URB A;  3MK1 A;  4GTW A;  5C66 A;  3A52 A;  2D1G A;  1EJJ A;  1EI6 A;  1N2K A;  1KHN A;  4GTZ A;  3DPC A;  2X98 A;  4ZG6 A;  3NKO A;  4ZG7 A;  4ZG9 A;  1Y7A A;  5L0B A;  3IGZ B;  2XRG A;  2GSO A;  3NKP A;  1E33 P;  1ED8 A;  5LRM A;  4QAX A;  5GOV A;  1EW9 A;  2W5X A;  1KH7 A;  1N2L A;  4LQY A;  1ED9 A;  1URA A;  1E3C P;  4UPI A;  4LRE A;  4B56 A;  1AJA A;  1KHJ A;  2RH6 A;  1SHN A;  2W5W A;  2XR9 A;  4FDI A;  2QZU A;  5IJQ A;  5K4P A;  1SHQ A;  4CYS A;  5LRN A;  1ALK A;  3OT9 A;  3NKR A;  3MK0 A;  2IUC B;  1KH4 A;  2W5Q A;  4FDJ A;  3M8Y A;  2W5V A;  4KAY A;  1ELY A;  3KD8 A;  3UN5 A;  4LRD A;  2VQR A;  1AJD A;  1ALH A;  2W8S A;  3B5Q A;  4KM4 A;  4MHX A;  5KXA A;  4GTX A;  3DYC A;  1B8J A;  1ALI A;  2GSU A;  4TN0 A;  1AJB A;  3TX0 A;  1AJC A;  2GA3 A;  1ANI A;  3M7V A;  4UPL A;  1FSU A;  2ANH A;  2W5R A;  1ZEB A;  1KH5 A;  4CXK A;  1ZEF A;  1O98 A;  4UOR A;  1AUK A;  2W8D A;  4UOO A;  4N7T A;  1KHK A;  4CXU A;  5GRR A;  3NVL A;  3E2D A;  4LRB A;  3BDG A;  1EW8 A;  4NWX A;  5EGE A;  4ZGA A;  3NKQ A;  3WBH A;  3SZZ A;  1KH9 A;  3WAV A;  4LRA A;  1KHL A;  3IGY B;  3T02 A;  4MIV A;  3NKM A;  3BDF A;  4KJG A;  4CYR A;  4GTY A;  5DLV A;  3IDD A;  4LRF A;  2IFY A;  4LR7 A;  5LIA A;  1O99 A;  4MY4 A;  3WAW A;  1EW2 A;  1HQA A;  5DLT A;  2G9Y A;  1ELX A;  4LRC A;  1E2S P;  1ZED A;  5AJ9 A;  1EQJ A;  3TWZ A;  3UN2 A;  3SZY A;  3UO0 A;  3ED4 A;  5TJ3 A;  5LQQ A;  1HJK A;  3TG0 A;  4YR1 A;  4CXS A;  4UPK A;  1ELZ A;  2ZKT A;  4UPH A;  4NWJ A;  3LXQ A;  4LR8 A;  4KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...