3MCG1

Three-dimensional structure of a light chain dimer crystallized in water. conformational flexibility of a molecule in two crystal forms
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
216
structure length
216
Chain Sequence
ESALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of a light chain dimer crystallized in water. Conformational flexibility of a molecule in two crystal forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN LAMBDA DIMER MCG (LIGHT CHAIN)
total genus 34
structure length 216
sequence length 216
chains with identical sequence 2
ec nomenclature
pdb deposition date 1989-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg101
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mcg102
3G6AB 5E2JA 3UAJC 2OJEA 4N8VB 3RZCC 2W0LA 3VU2A 1JHKH 3VFVB 1FFPA 3PG2A 1KLGB 4X8JA 1A4JB 1GGIH 2IGFL 4Y4KC 3MJ6A 4R4ND 5K9KB 4M9OA 1UQSA 1HDMA 1NEZG 3MJ7B 3FO2A 4NBXB 4LVOB 2X5PA 3L5JA 1SJEB 1KIQB 1VHPA 3N1QC 3VXSE 5LGKA 3NFSL 1QFOA 1QLFB 2VLLA 1OPGL 1G0XA 1GZPA 5C08A 3MV8E 4MQSB 3I9GL 3U4BL 1GZQA 3MLTA 4JFDA 3NIDF 4JPVH 4OZIF 5C8JA 3T0DA 4FFYH 3O81A 3NIGF 4MJ6B 5HGGS 5C09E 2ERJC 3U4EB 5I1GH 2BNQA 1W0WB 2Y1VA 4XP4H 2CRMA 4FQIH 1JGEA 1KEML 3TFKD 1HHHB 1UWXK 3V6FB 5GS1B 1J05B 2EEDA 1L4IA 1ZTXL 2X4PB 3ARFD 4YPJA 3A6OA 4ZUVA 3ILQD 3D2UD 5IWLC 2L0DA 3HE6A 3OG6B 4F9PA 4P2QE 4Y2OA 3DI3B 1AGDA 1S5HB 2W0KA 5HYEA 2FX8H 5I2IA 4LCIH 1OP9A 4D3CH 2AK4A 4M48H 1AY1L 4Q6YA 1CD9B 2V2WB 4YBLB 1TETL 4G5ZH 3WKML 1MCPL 3I6GB 2YK1L 5FUCC 3QUYA 4YC2C 3UYOD 1X4YA 2P5WD 4Q58C 3JV4A 4QHUB 2ATPA 2YD5A 5JOPE 2W38A 3GMPA 1G6RH 1LEGB 4QY8A 5H2BB 1KJ2L 3WNPA 4HUWA 1X5IA 1RURH 1YECH 4FA8A 5A43C 1X6NA 4F15B 3NVQA 2WP3O 4HC1L 4LSSL 1V7NL 2XWTA 2DF3A 5ELIA 4MXQD 3BMVA 1ZVHA 2NX5D 3G5ZA 4HS6B 4PRIB 2PF6A 1HNFA 2YD3A 1TCRA 2G5BB 5TQ2H 2FL5A 4BFGA 1NUGA 3ILPA 1BIIA 2YS4A 9CGTA 2F74A 3MTRA 1BZ7B 1U95A 2OK0H 4M1DH 4LGRB 1MAJA 1KV3A 3IDIB 1EBPA 4JLRA 4EDXB 1WBZB 3OJDA 3RBSA 4YXKL 3KLHC 4HV8B 2YN3A 3H3KA 3OGCB 3VGEA 4LIQE 3OZ9L 3T3PE 2IQ9L 1K8DB 3HZVB 4RBPK 1P1ZB 1XGPA 3DETC 2AVGA 5HHXH 3B9KA 1RZFH 4I3RH 1VEPA 1ZHBA 3QIUC 1N2RB 4GXVL 3TA3A 4RMSA 3W0WE 2ZJSL 5IHZA 1J9CT 1TIUA 4HX1B 3MROB 1AC6A 4KVCL 3SDXF 3WN5B 1YMME 4QRQA 2P45B 5FDWA 2FLRT 3PV6A 1IKNC 4NSKA 1SBSH 1AQDB 3AAZB 1I1AD 1NAKL 3P30L 4NGHH 5JNYB 2OK0L 3ARGD 5SWZA 3D39D 1BM3H 3ZYOA 3MV9D 1D5XB 3KYNA 3U46A 1IFHH 4M8QB 3PWPE 4PLOB 4JFED 4GRMA 1U8MB 3GSQA 1BIIB 4GLRH 4RFOH 4OJFH 1DQJB 4JANB 5J1TC 4HK0A 1YN7A 3F6LA 2Z35A 2R23A 4EI5A 4HJ0D 4ZFOL 4R2GD 3O6FA 1VFBB 3FFDB 3OWEA 4G6AD 2UVEA 2DQDL 1IC1A 3GIVB 5I1DB 3TBYA 2O5YL 4ZUSB 1CF8H 2EO9A 2F58H 1XZ0A 5HHPA 2W65B 1RZ8B 5JA8B 1HHIA 4OD2B 4TQEL 4I4WA 1JGUH 2DBLL 4KGJA 3MMEA 3N1MC 4PJ8D 4RGNE 1JK8B 1NUNB 2QR0B 3DVFA 5GRYA 2QSCL 5E6YA 3LS4L 4PJ7E 4GW1B 1DLFL 5D7JA 4KJQC 4RFOL 5EOTB 2WBJA 4YFDB 2Z8RA 5KVGH 4GQ9L 2FWOB 4NM8H 3G9VA 1IGCH 4BJLA 1NGYB 4G8GA 2H9GB 3EOAA 4BA8A 5CHNB 4CVUA 4XAKD 2A73B 1V3JA 4U6VL 4UDUA 1B6UA 4MXVE 2VSCA 4UQ3B 5EBMA 1C08B 3GSRB 4LCWE 3RWFA 3GRWH 5KZCD 2F58L 4DZBA 3VE0A 4RAVB 1SJVA 1ITCA 1L6XA 4S1QL 5CJQL 2XZAL 3S9DB 3MGOA 1AGFB 3C5ZD 4MB3A 1EPFA 3HG1E 1I7ZA 2B0SL 4OZHB 4ZSOA 4BUGA 2Q6WA 1S9WA 1EK3A 4MMXC 3D85D 5EIIA 4AEFA 1MCWW 1IAIL 3KGRA 1P7QD 1TVDA 3BJLA 4P5TC 4WI3A 4JFXB 1NCCH 2Q7YB 1ZLVK 1IGFH 5FHBH 4L29A 4P57B 1PG7X 1OWWA 3I6LD 5ANME 3UP1A 1DBML 3DROB 1CS6A 1KF9B 3ULVL 2J88L 3IVKA 3J8F7 2G75A 3V6BR 1AGEA 4GAJL 1DBKL 4L8BA 1OD9A 1IARB 1H5BB 5I30L 4BKLB 3FRUB 4WWKC 5SWSE 2IAND 5D6DC 4R4FH 4TULL 4WTXA 3W0WA 4HULB 1NJ9A 2NY6D 1FO0A 5CSGA 1E4XL 3X3GL 2IALA 1HH6B 4MDIA 3BZFA 3LIZL 3MLRL 4MAUL 3VWJB 4HEME 2BOBB 4XNYL 4JZOB 1BOGB 1KTLB 3G5VB 1L9NA 3RAJH 1NDMB 3MRPA 5F7MC 3TPKA 4CVZA 4KROB 2HTLC 4M5ZL 4PJEE 3WKNA 3UTZA 2HWZL 3S8WA 2WBKA 2PTVA 1NC2D 4LHJB 5AEAA 4ZFGH 2VC2L 2BOCA 3ARGB 4P0DA 3TH4T 4M48L 3QUKA 3KLHD 4PP2A 4M7ZC 5HY9A 1OLZA 3VMOA 1T2QL 3QHZH 5LQBL 4PRAB 1AI1L 4FQCL 5L7XL 5E8DL 1YJDL 1OAQH 3SDAB 2PYFB 4LSPH 3SHSA 4YHIB 2OL3B 1JPFB 3ROLA 4UI2A 1NC2B 1AXIB 4CUCA 4ZQKB 1A6UL 5HHOB 5C0AA 1Q9WB 3LKOA 2D31B 3TIEB 4F2MB 3BP7B 4KUZH 5DURD 5HI3C 3P9LA 4FOMA 5E56A 1I7TA 2LTQC 3HC0A 2V2TB 3WIHL 4ENED 3UBXG 2MPAL 1KB9K 5D7SH 4Y88A 1XGTA 4HGWA 2J8UF 4AK1A 1C16A 1QQDA 4TUOB 4HWBL 3MV7A 3C87A 4JR9H 3BKMH 4ZYKA 5TPWH 4CJ0A 3TPUA 4QRRD 2QQKL 3C8HA 3BP5A 4PGEB 2VLJD 5J6HB 4QRPB 5L88L 3ZTJG 3HC3H 2YPVL 1GGCH 3HB3C 5BV7B 5FHAL 3VXUD 2IQ9H 1RJCA 2WM0A 3FQTA 1BGXH 2FX9L 1QSFE 2DIAA 3O3DA 1GZPB 5MEOA 3QZWA 3O3AB 2HN7A 3CD4A 4LCYA 3LMJL 2Q7NA 4G43B 1CGXA 1A1NA 3CSYB 3O6LL 4XNXL 3ZE2F 2WV3A 2H6PA 2IC2A 2IG2H 2VISA 2V17H 1MCWM 4UT6L 4FQJL 3O9WB 4Y8DC 3WEXB 1YUHB 4NRXA 2AK1L 4M1GH 2VXTL 3VRJA 2HJLA 2NQCA 3M17A 5C6WH 2YHGA 1RAMA 1YEEH 1OSPH 4C54A 2F54B 2V5SA 3O3UN 4TTDD 3TZVB 1J1XL 3L9RB 1JGVL 1JWMB 2D0FA 3HE6B 5DD3H 5E8NA 1T0MA 3G6DL 1H3XA 3SE9H 5HVFB 2NY7H 3MLUH 3S3PA 1WICA 1HI6A 3TIDB 1MRDL 5B4MC 4XP1L 2IH3B 4GG8B 4HZAA 2E5EA 4LLVA 4HHAB 2GJZA 4Y4KD 5E03A 4BSVA 5KSVB 3VGGA 3KJ6L 3NIDE 3O6ML 5IESL 4CMMA 4N0UA 5IMMA 3NCYP 4IMKC 4UT6H 3CFEA 4LNRB 3GMRA 2PUQT 4UIMA 3S35L 1N8ZB 5IMOA 4XXDB 1U2HA 1A0QH 5C0CD 2FIRT 2X4QB 1F3RB 1U8KA 2EDJA 4Y2DD 3P0YH 3HRPA 4OD3L 1GSMA 1LP9B 5CIPB 4AIZB 4K7PX 4BZ1L 2O5XH 1MI5A 4X6DF 4RFEB 5DD3L 1JUFB 4LL9A 2ZUTA 2MQ0A 1O0VA 3WEXA 3MLUL 1D5MA 2EYSB 3ALXA 2EIZA 4MD5A 1FAIH 2DJSA 1WC7A 3GMOA 1CR9L 1K2DA 4D94A 4N0CD 3LKPA 5F88B 4GS7B 3CMGA 5ACLA 4K23H 2VDRH 3H9ZA 2EDFA 1BFOB 1CFTA 4PTTA 5E8NB 5JOPD 1RZKH 2C7UA 5A2IH 4PJBF 3JV0A 3OKEB 1REIA 2BVQA 1KIUA 1Q9OB 5DMKA 4Q0XH 3O3BB 2LABA 2ADGA 4XPAH 5CD5D 1CGSL 3SJVA 1WAAA 4K3GA 3SDAD 4FABH 2F5AL 5T5FH 4M62H 4YHLH 2AP2A 3W11C 3FQNB 2EDHA 2YBRB 4WW2F 4PIRF 1H8NA 1EEYA 3PF2A 1BJ1J 1ZXQA 1D9KD 2PKDA 1IEAA 4AQ1B 4WIQA 2H8PA 5DFVD 3WJJC 5I6XB 3HRZA 2BNUA 3BJ91 2F8VA 2FLBT 2NW2A 3IDGA 2EH8H 3C6SA 3LKQB 3OKYA 1XGPB 5C0FA 2BJMH 1OGAD 1FGVH 5DQDL 3GSXB 2HRPH 4ETQB 1D5MB 5EBLA 1J11A 2YSSA 4HEPG 4WTWA 2GJJA 4Q0XL 5BW7C 3MJ9A 4DTGH 1S7VB 3T3PF 4X6EA 3U0PB 4J1UB 2IH3A 3N1PC 1AQDA 2DJ4A 4JPWL 2I25N 4LAJH 2E7LC 1VADA 2WINB 3WIFA 4TVSa 1UZ8B 3DO3A 4QT5A 5TDOB 5C86A 4IHOB 4QHNA 3S34L 2AEPL 3DVGA 3BN3B 3D5OF 5TE6H 3U46B 1V7MH 1TPXC 1QLEL 4I0PB 1QBAA 3P73A 4XTRD 3T3MF 1L7IH 5MP6L 2CUHA 4DFIA 3NA9L 4JO4L 3IFPB 3C8KB 3SKUD 5KVEH 1FGVL 2H8PB 3QUMA 4OQTA 5F97E 3AS1A 2CLZA 3MBEB 3MRQA 3VXMD 1MCCA 1DLHA 3MFFB 1MCIA 1A7OL 1WC7B 4ONFH 4OUUA 2EYTA 2FDBP 1NBQA 1V7NH 4X4ME 5D7IB 2FWOA 3EYQD 4JFQA 1OAQL 5BV7L 1OT2A 2APTA 2C1OB 4ODTH 1VGKA 1RY7B 1T3FA 1Y0LB 2UUDH 1J1XH 4NPYB 2ZUXA 4MAYC 4YHZH 5IVXF 3OJVC 5C7XL 2MPAH 2Q6WB 1GOFA 4TVPL 3NA9H 4LIQL 2ILLA 1B3JA 2SEBB 2R56H 1U92A 1NAMH 4P9HC 3EFFB 3GSWA 4MQXC 2YOCA 2B5IB 4M3KB 3ULUL 4UB0L 1MVUB 2Y4SA 4NUGH 4HS8H 4ORGB 4GMSH 4L29B 3FO0H 2NXZD 4QWWC 4Y1AD 4Y4HB 5KSBF 3IF1A 4XGZB 3LEYL 5J1SC 2HT3C 4X7TB 5J6GB 5GXBB 1NBZB 4XMPL 3VW3L 4BQCA 4IRJD 1MHCA 4NQDA 4CL7A 4YO0A 5ESVB 1CTOA 1EJOL 4X6CA 5HI3D 5GRUH 1WAAE 5KANI 2UUDK 2Y5TB 3BOVA 1EA9C 4J3XA 3IKKA 5FKPA 3RVXC 4FTVB 3DBXB 4APQA 1SEQH 1BFSA 1HOCA 1KXVC 4M6NH 4WW1B 3U1SH 4KRNA 1NGZA 4MDIB 1FAIL 3MNVA 5DHXB 4EI6B 3J7HA 5IR1A 5K59F 5IMLA 4OD1L 1A6TA 3NFNB 4J7RA 1BLNA 2YUWA 3QEUA 2BSSA 4KH2A 4QNPF 4F7EA 5C0IA 5JXAH 4IHOA 4QHNB 5D71L 4F37F 2NY1C 4UB0H 3SKOA 4I0KA 1NLDH 3RNQB 3SE9L 4MS8D 4G6ML 5B8CA 3NBNA 3C5ZC 2GTWA 2NR6C 3LY6A 4BKLA 2ZPKL 3RGVD 3N9GL 4BSWB 5GGTH 2X1XR 3ZKMD 1ADQA 4MZ3A 1NFDE 5FM8A 2A1WH 4JRYE 4KVNL 4B50A 1L7TH 1TJIH 3C2AH 5D1XD 3MRGA 5DRWB 3IU3A 1I9IL 4JY4A 4C4KT 4QRRB 1QRNE 2VLKE 3BXNA 1JRHI 4YHIA 4J23A 1NQBA 1RIVL 4DJMA 1S5IL 3QFDA 5B3JF 4D0CB 1EJ6A 4L1HA 5CEZE 5FOBA 1NCTA 5F1NA 4LHQB 4MJIE 4OD1H 2XRAH 1NFDF 3REVB 1KT2A 3DBXA 5L9DL 1KPVA 1Y0LA 4QXGL 3MUHL 4XNMB 3LEVL 1HILA 3OBAA 1RZFL 4RZCA 3DHJA 4H26A 4TNVF 4RDQF 4OGZA 4MA3A 3D85A 4PY8J 1OD7A 4EUPG 4GAGL 1LP9F 1RZ7L 5SWSD 2BDNH 4DVBB 5EU6B 3VG0L 3TYFA 3CGTA 4L9LC 5GISL 3MRHA 4WFGE 3CPLB 2D31A 1HXMA 5L6YH 5MEND 5CZKA 5GGSA 4FXLA 3RVUC 4KQ4H 3T4YB 3GFUA 3WNLA 1I8KA 1SBSL 2XZAH 3O4LD 3TJEL 4O2CB 2ATKB 3P77B 4FQ2H 4FP8H 3FAWA 4NGHL 3T8XA 6FABL 3FQTB 1YQVH 3TV3L 1RUQL 3NABL 5HVHC 5MEOB 3MYJA 3QIWA 3V5HB 4XMKL 1IAKB 3KYOB 4TRPL 4Z7WF 2VDQH 3QUML 1NH6A 3O4OC 4W6XB 3QFJA 3MCG1 3EYVB 4OZGB 3SKJL 1P84J 3PWVB 3GRWA 4OZ4B 3MRCB 1IGFL 2VXQH 5EIVA 1CXLA 5LXGL 1PG7L 4LRNH 1ZVSA 5JW3L 3O2DH 1RZ8A 4PTUA 4PYGA 4X9FA 4O2FA 1WSST 1OAUL 4V1DD 1NGPL 1QFHA 3FQXB 5JIHA 4QF1B 1VEMA 2E9IA 5C0EB 1I8MA 4OCSH 4K8RL 1I1CA 5FYKE 5DR5H 2BSSB 4GW1A 1EFXB 2HJKA 4L8CA 3QIUD 1WCBA 3VXSD 5C07E 3L3GB 4G7VH 3EJJX 2D0GA 4NZTH 1UCTA 3MOQA 3D3VA 3FB6B 4FN0A 4HKJB 4PJ8C 3ARDB 4M5YH 4X9HA 1FNSL 2CGRL 4HQQL 2X41A 4NNPH 3EYOB 3VXRD 2EE6A 4HK3J 5T3ZE 3QB7C 3VXRA 4LAQH 3ALPA 2OJEB 4N8VA 1JTOA 2C4FU 3MRRA 5F3BB 4M03A 2WWMD 4KI5E 3RVWC 4MDJB 3QFDB 4JFYA 3VD4A 1RUML 4R2GB 4EVNB 2N1KA 2DDQH 2I9LB 1R5WA 1U8OA 3EO9L 2C4XA 3OJMB 3GBNH 5B38B 4L4VD 43CAA 2OP4H 4I48B 4P9HH 3CSGA 5T5NG 4AEEA 2WBJC 2CUMA 3QXDA 4U1IB 3BAEH 4Y19D 2OI9C 5I66A 4IRSA 3L3KB 2ZUYA 4LF3B 3Q48A 5EO1A 2AS5M 3TO4D 1H5BA 3VH8G 1RVFH 3CFJA 3MRHB 4IIQA 1JFQH 3FFCB 4AY0A 4X0KA 5MEQA 3K8LA 4HBCH 1MJ7L 4P3DA 5D7SL 4UDTB 5EU6D 1M6OA 1DBMH 4HKXA 1IZJA 5BS0E 4GQPH 4WDIB 1EHNA 1Y6NR 5DVLA 1CLZH 3BDYH 4OFYA 1KJ2A 1F45A 3MRDA 3K1DA 2XYCA 4P2OB 3NA4A 3FN0L 4DOHB 5BW7A 3SDCB 1BX2B 3A67L 3KPRA 4J2XA 4NQEA 3RX5A 4UV7H 3CVHH 4ZS7L 4XNYH 4FXGA 1XCTA 3F7PC 1CG9B 3TNNB 2L4OA 2WIIB 1HSBA 3PL6C 1PAMA 5I1CH 2GITB 3TESA 5JR1H 2MTPA 3KLSA 4FQJH 3VFVA 5EU3A 1J12A 2VDMH 4PRAA 2PXYD 3BKYH 4NN6C 1J18A 4DZ8A 5KAQG 3F58H 1G7PB 4WNQA 2F53D 2HJFB 4QOKD 1FQ9C 1MFAL 3HC4L 3LRHA 3WNOA 1GHFH 1IKFH 1A6VL 2JB6A 4QRTB 4YGVA 2B39A 4XNQB 4OBRA 5JHDE 1ZT1B 1A64A 1AFVL 3BIKB 4OB5H 4QKXB 5C08B 3UJJH 5JXEA 1MRDH 5CFHA 4Z8FL 1RZ7H 2BVPB 4UINH 2A77H 2ZUUA 3ZDXF 4WGVB 4LEXL 1ND0B 1YNKH 4N5EC 2GSIB 4HV8A 4UNTA 4OLXL 4PGEA 4HKBA 1JZ7A 5DJCB 1CGUA 4K94L 5ICZA 1MJ8H 4AL8L 3FOLA 2A1WL 3WNKA 3TM6A 1XR9B 5F7DB 5DC4B 3KAAA 4PJ7A 4GH7B 2YPLA 1I9IH 3IFOB 5BCAA 3LD8C 2VR4A 1TQBC 1CFSB 1QRNA 2VLKA 3LEXB 1HIML 2ZG2A 4ZOCA 4NC2B 3VJ6A 1ZEAH 3BQUD 4TPRL 4A2LA 4O58L 1GGCL 3P3YA 5F7EH 4O51A 3JVGA 1LO3H 5GGUA 5I19H 4PBXA 4Y1AE 3SE4C 3GMMA 1DLHB 3GMPB 1WFTA 1TMCB 3K4DA 1N59B 4M43H 4X6CE 4XC1L 5DR5L 2IBZX 2EDBA 2J2ZA 5DLML 5EOCL 3ZT7A 1CIUA 2ED7A 3GJFB 1N4XH 2C1OA 4GW5A 4NNYA 1WISA 3KPTA 4ONHA 2EECA 4YZFF 1G9NC 1A1OA 4Z6AT 1J8KA 3K46A 4PGCA 1H15A 1UH3A 1YPZA 3HLAA 2RIKA 1QBLL 4LPYA 4OM1L 3RA7H 5IVXA 2DYPD 4JKKA 5IEKB 2VXUH 1O5DT 4H88L 3ARDC 3GSNH 5E2VH 3DX8A 5D1ZD 4OZHE 3CVIL 1XR8A 3PDOA 5KN5A 3EOTH 3TCLA 5GSRB 4KK5D 3E6FB 3ARED 4JQXA 2AV1B 5F7EL 5HSFA 5TDPA 4K3EL 5FGSA 3HMWH 4LMQI 2Y72A 3ETBF 2OR9H 1U91B 1S7TA 5DLMH 5EOCH 2W9LA 3W39A 5AZ2L 5ESAB 2OP4L 4TNVK 3PHOB 4WUUA 5K9KA 3S35H 3HPLA 4XHJD 2IF7A 2AJVH 3FO2B 3VXSA 4WUUD 5D7KE 3KPSD 1MJJA 4FTVD 5C07D 1KXQE 1F00I 1XEDA 1JNLH 5KG9A 4NKIL 2R2EB 2CPCA 1L0XA 1MCKA 3BKCL 4NZTL 1X4XA 2GSGA 4O9HH 5IR1B 1G1CA 5HI5C 5EORL 5GRVL 2FEEL 5FF6B 1U3HB 2YD6A 2C1PA 4XMLH 5CBEA 2V9RA 4XBGB 2WLZA 3ULUC 1S7RB 3CU7A 2NXZB 3JUYA 4HGMA 4M7JL 2DRUA 1CLCA 1P4BL 2VDPH 2DLFH 1I7RB 3TN0D 3L1OL 3MNZA 5AYUH 1RZKL 2CKNA 1FO0L 1EFQA 2W59A 5GSRA 4Y5VB 5DZLA 3JZ7A 3VJ6B 3V5DB 4IRSC 1DQMH 5FGBA 5AYQA 5D4QA 2HTKD 3NTCH 1C5DA 5JXED 3WHXA 5IMKB 1JNLL 3HI5L 4KTDH 4Z78B 4PJ5A 1CDJA 2JK5B 1WFNA 3L3OA 5ADPH 3QBTB 5T3ZD 1UXSA 1TJHH 4I0CC 2AV7B 3GSXA 2WMPA 1BD2E 3FN9A 1MFAH 1LEGA 1W8OA 2IQAB 5H37H 2YD2A 1TETH 3H3PH 1VFAB 4DUXA 4X5XA 4GJTB 3REWB 4ODVL 2YK1H 4G6JL 1A47A 2ZOLB 1P4BH 2WLYA 4U1MA 4ZG1A 1FNGA 1P7HL 1KTDA 3VWJA 5I18L 5IEKA 5SX4H 5IHUL 3W11D 3T2PA 1WZLA 3VI3F 1BQHB 1BEYL 3FT3A 4XP6H 4P2RB 3GI8H 3FO0L 3S98A 3BE1L 4JHAL 3RU8H 4CVXA 1PQZB 5IIEA 2XA8H 4L9LB 4NZDA 3WIHA 4G8GE 5C07B 4NRZA 3QNYA 2NY0D 3RP1A 5I75C 1D9KB 2DKMA 4UTAL 5JR1L 1ACZA 3BP6B 4X4XB 1EZVX 3PWJA 3DXAA 2L7UA 2R1YB 1NCUA 4PGBB 5I17B 3FMGL 3BT2H 3MXVH 2XT1B 5IHUH 3G6JB 3DX7A 2E7LA 1I8LA 1KCSL 1ZLSL 3BZEA 5F8QC 5EOCJ 3EDDA 5GGRB 1NL0H 3VXQA 3WN5A 5JTWA 2M8XA 3WUWB 1MCFA 5DJXA 2ZNWA 3AREB 4XP6L 3DV6A 5BOZG 3QDMA 3PV6B 5F93C 4AEIL 1AJ7L 2B4CL 4AG4H 4I5BB 5F6IB 5DEGA 2E7BA 4PJXE 5BV7H 2FHFA 1CBVL 5HDOA 3ULUD 1D6EB 4MAYB 1MEXH 5GS1A 4MWFA 3VCLB 4CNIA 1L7TL 1TJIL 1KCLA 5INDB 3I2CH 4NQSA 2W9EH 5ITFB 1BOGA 1KTLA 3G5VA 1KYOJ 2KH2B 2ZUVA 2E6QA 1H0DA 4L3CB 4XVSL 4YO0B 4LK4A 1SJHB 3W9EB 3IU4H 2VTFA 3VH8B 4JFYB 3HCVA 5EO1B 5DJDA 3H7BA 4RGOH 5ERWA 1WGOA 1F4YH 1MY7A 4K3JH 2R0WH 4OJFL 5ALCH 1F4XH 1MFBH 1TZGH 2VMFA 3KR3H 5JOFB 1WBXA 5HHVL 3UROR 1D7FA 1M4KA 3KS0H 3P0VL 4NUGL 3HN3A 3PUCA 3UZVB 3LEVH 4YAQA 1EMTH 2AXGA 2A83A 1VFAA 4OCYL 4ODUB 2EDLA 2XZZA 4QRPA 3RY6C 3QEGH 4PJGB 4P4KD 1F4WH 4ZAKA 3ZE2E 1YEKH 4HUWB 3BHBB 1ZT7B 3MV8B 3D39E 4D9QE 2BNRD 3WUWA 1SBBA 3WLBB 1U93A 3FTGB 1QFWH 1A1NB 1JZ8A 1MFCH 5D7JB 4TQEH 1MHEA 4HFUL 2FB4L 3TO2B 1W8NA 3A0OA 5D96B 4P23C 2IWGA 3LKNA 5FGCB 4HSQA 4LU5H 4NQEB 4QXUL 2H45A 4MD4B 1SM3L 4ZFZA 4JPIA 1XGUA 4P46A 4KKCD 4FHBD 2O5ZL 5CZXD 4GG6E 1J86A 2XICA 3NIFE 5ISZE 1FGNH 5C6PB 2JELH 1QFWI 3VI4E 4NZRL 1JGDB 5ISZB 5F9WC 4K7PY 2VDKL 4L3EE 1U41A 4OCMC 4PR5A 5L2JB 3QQ9D 3MLSL 2X4NA 2EXYD 5IF0A 3HG1A 4WY7L 5D1QD 2I07B 3RHWF 4ZFFB 3NCFB 3WMSA 1QFPA 4LLDB 5FOBB 4JKMA 2WIIA 3MV7E 3QWOA 1QACA 5BO1L 2F19H 4K9EL 3PP3H 4S2SB 4GG6F 3B83A 1IC5H 3MBXH 4HFUH 4AENB 1W2KT 2MOVA 2APFA 3INUH 2BVPA 3F62A 5I1KL 3TT1L 3H42H 3ZZ1A 1N8ZA 5T1LA 1BF8A 4ZUUA 4I18C 3KPSB 4QHLB 1S7SB 5D1QB 5BZDA 5DVKA 1OL0A 1QP1A 1PGRB 1QVOA 4QRSB 4NKIH 4XNQA 1AGEB 4KJYB 2YKLL 3OAUH 5INDA 1CD1B 1ZVYA 4RNRB 3NCYS 1UFUA 1QSZA 1PKQA 4LLMB 3IKCA 2BDNL 3TNMB 2CKBA 2GK0A 4FQXA 1BZQK 1OAYL 1DR9A 1FFNB 2VIRA 3ULUE 3VH8A 4U1LB 5HPOA 3I50L 3EYVA 4OZGA 3S37L 1WAAF 2XA8L 3I9GH 1NEZB 4S0TD 1XF2A 4W6WB 3VGHA 3O11B 1TZHB 1J0IA 3GMQB 1J1PH 1X5HA 2DL2A 4UOW1 5DDHB 4YBQD 3V0AC 3GSOB 4JDZB 2Y07L 3VFNB 4C4KO 3IFNL 3LDBC 1UWXH 3X14A 5IOPB 3O2WH 1XGRA 2YWYA 5DMIL 1UM6H 3C60B 4HUVA 4X99B 5KOVC 3EYSL 5SWZE 3MJ9H 1I9JH 3HLAB 5EU7E 4OTXH 3H3PL 2NW3A 3BDYL 3BPLC 1XGUB 2FX8L 5LQBH 1G9NH 4OCSL 4E41A 1RIHL 5BS0B 1XF5B 3EDEA 1KN4L 2CUIA 5I9QC 2B7DT 1GZQB 3MLTB 5IVZA 1A3RH 4AJ0A 4G5ZL 3WFBH 1Z9SA 1C1EL 1TVBA 1MEXL 2UVFA 1JZ5A 4HUKB 4RMUA 3NH7L 4N0CC 2Z93A 5EU4A 3LVEA 3KWWA 3VE0B 1KBGL 1R5WB 4ODXB 3HMXL 3QWOB 3EYUL 4MDJA 1AGFA 4JDTL 1RZGA 5D7JD 4S11A 2J8OA 2CMRH 4JKLA 4IDJH 5ICYA 3MCLH 5H35B 2APVA 2R0LL 3DSFH 5LCVL 2JKXA 5F9AC 4KKBC 1ZA3A 1LHZA 4U4BA 5GRWA 3BKML 4PJ8A 5FYLE 4M02A 3KPOB 2H1PL 4LCYB 3ARYA 1S9XB 5E5MB 3K8KA 3UDWC 2P43B 4ZFOA 1ZOXA 4NN7B 4X5WA 5IB5A 1D3CA 1TTFA 4H20L 4UINL 5F7KC 1UG9A 4Z7NE 5CEYA 3OX8B 3H9YA 4KDWA 2F8XC 1T1YB 4JO3H 3LMJH 1F6FB 1PKQB 5I73B 1KJ2B 3MRDB 5ANMB 5GGSY 4PRPE 5GGRY 1MQKH 1Y6MR 2VABB 4PJXA 5J13C 4F15C 2AK1H 4M1GL 2I5YH 1J1OL 3GGWB 4JFHE 1OGAE 1EH9A 1RIUL 1TCRB 2PYEB 5HVWA 1HHJB 2W9EL 4HAFA 1K8IB 4MHHG 4BZ2L 3RDTD 3LKRB 5LBSL 3I6LE 2OTWB 4XCCH 3N0PB 4KZDH 3HAEB 3NCCB 1CLOL 3OMZA 2CJUH 1BP3B 1UWGH 4XCNB 1A6ZB 4NC1C 5I8KL 3GUTB 2Y5TA 2W60B 3MRMA 1OQXA 3DRQA 3IDIA 1AD9B 5KSBA 3CC5B 3PNWA 4XPHH 2C3XA 2OR8A 4NM4L 2ZOLA 4UV7L 3HPJB 4NSKB 4OCYH 4HT1L 5D1XC 5CEZD 5E2UH 3U0WH 4D0BB 5I1JH 2FEDD 2VZTA 5DS8A 3T04D 3RGVC 4Y5YC 3BKYL 1DQQB 2OR7A 3K80A 5EPMB 4JFDE 4M3JA 4GRWH 5I1LB 1UA6L 3BP7A 4TUJA 4PJGF 4LEOA 5C0BB 1NDGA 4JRXB 1MRCH 4JJ5B 2EDRA 4TOYH 4AMKH 5DEZA 1X5GA 3PL6A 2CJUL 3B43A 1QEWA 1IGJB 4K3EH 3WYRA 4H1LH 3MLWL 4IOIA 4EBQL 1X5AA 2RB8A 3CLFH 1XZ0B 5HHPB 5IB2B 2OSLA 5B39G 3D25B 3GK8L 4Z5RB 4JM2C 5FCUL 3OB8A 3BPCA 4N8CL 4JRXD 1S9XA 3OKLA 5D2LE 1YYLH 2YUXA 3LQZB 1IEAB 1NBZA 1VFMA 5E4IA 4I18A 3ZTNL 4L5FL 5IFHH 4YDIH 1KENL 3PWPB 5F7FA 4N90D 3CAFA 4X6CB 5FM5M 4NKMA 1KXTB 5CUSL 4P23D 4H5SB 3ZKXC 3BKCH 3HI6L 5D8JH 5K9JH 4HIHB 2NYYD 4ZUSA 2HTLD 4LFHG 2YZ1A 1P7QB 5DMIH 2YRZA 4AMKL 5HYSA 4G9FA 3BUYB 5CJQH 4DW2H 5KS9B 3BZEB 1VFOA 3P11H 4KKBD 2ZCKL 4QYOA 3VG9B 1Y18B 2B8OT 1LO3L 4YFEA 4XI5D 3T8XB 1E4JA 4LSQL 5IMLB 1DN0B 4CKVX 3AC0A 3BEVB 2GT9B 3OL2A 5IVOA 3DARA 2NR6D 4WI2A 1H15B 3HE7A 4S1SL 4XWGL 5L0QC 4RFNC 1N4XL 4BK4A 3QWQB 2CLVA 1D5BA 3AM8A 3TCLB 5IK3B 4DTGL 1YYLL 3QUZB 4HPYH 5KW9L 1OAYH 2NXYB 2NY2B 4NDMB 1OGTA 2EDQA 4CNIB 1IM9B 4U0RC 4O2FB 5AUMA 1T21B 4CMMB 3BRGC 5EZLA 5K9JL 2D9QB 1RULL 2B2XH 3WFDH 1FCGA 4NZJA 3CCHB 3WDHA 3GZKA 1INEH 5J12C 3L95A 3MRNB 2WWMC 4LVNB 4QHMB 1A4KB 4ISVB 3THML 3GMLA 4FZEL 3P11L 2R0KL 4RAUB 4FS0A 1DUYB 1IT9L 1EAPA 3LIZH 3GBML 3MLRH 4M7ZB 4MAUH 4R2GC 3TO2A 4U6XB 1L7IL 3IS1X 3D3VB 4HKJA 5ENWB 3O2WL 1H3PL 1EV2E 3CLEL 4GBXA 1T2JA 2ESVD 3H8NA 4OLVH 3C5JB 3MQIA 1TJGH 5BMFH 4AT6B 3GMOB 2NY3D 2QHRL 3TBTB 5EN2B 3D39A 2GSGB 4Z9KB 2KUTA 5MENE 2CDFA 4O00A 3BE1H 1BAFL 4NC1E 2P48B 3SPVA 1EXUB 4JZNA 3ZDYF 2MQ3A 1KG0A 5TF1H 1A3RL 1Z5LA 1Z9OA 5JW5B 3UYPA 5EA0L 4FQCH 3DNKA 2AQ2A 1PY4A 1S8DA 1QHPA 5LWYH 3PWUA 4PB9H 1UJ3A 3OKLB 1ZSDB 1I1FA 3H9HA 4YDJB 1GXEA 2A6IA 1E4WL 2BOBA 4TVPD 4P46B 5KSAC 5JHDD 3V5HA 5IM7A 4KJWC 2NY6B 3WDIA 2D4DA 1S9VB 2YN5A 2ARJA 2FYYB 3MCLL 2VXSH 1MCEA 5C70A 4LF3A 1N7ML 2UYLB 1GYAA 2ADJA 1MI5E 1X44A 5BMFL 1JI1A 2NW2B 1A7PH 1T22B 2EKSB 4U1NB 4F57L 2PW2A 3EO1A 4NBYB 5E9DA 3C60D 2D9CA 4MNQB 3CDGB 4AEIH 4OZFH 1FNEB 1KJ3L 4YZFE 4NBZB 4ORZC 5E9DD 3PQYD 4XCEB 3NFPB 3W5NA 3QJFA 1K4DA 3VFTB 1T0NB 5IG7B 3KDMB 4JO3L 2D7OA 1NC4D 4QRSA 1NC2A 4PGDB 4D0DB 4MXQC 2EXWD 1S7SA 2BVOB 3S97C 5HHNB 3D0LB 2GEEA 2R2BB 3TYGL 1G0YR 1Q72L 4WW2C 4R3SA 5DWUL 1I1AC 1N0XL 2HMID 3UO1L 3QP3A 3LRGA 2A6KA 1QSVA 3CCHA 4BELD 4OF6A 4U1LA 1HYSD 3B5HA 3RWEA 5SWQB 5HTSA 3TNMA 3MGTB 3MV11 4PB0L 1YEFH 1T5XA 3TPUB 1XGRB 1PYWB 3JSSA 4EUPB 2NY0B 2H6PB 3HMXA 4Z7NF 3ZE0E 3X13B 2AEQH 4JVPA 5C0AD 4WO4B 5DD0L 2XG5A 5JHLL 3R06B 4JRYD 3IDJA 4RWYL 2NY7L 3VRJB 2QLVB 3QCTL 4PY7A 3RGVA 2NX5A 1MSPA 4QTIL 2EDWA 1VERA 3VXOA 3S37X 3FRPG 4J3TA 3CSYA 1KT2B 1VGEH 2I60L 4Z95L 3O6KL 4U3CA 4N1CA 5DJ2A 3TIDA 3O3EA 3QG7H 3V9FA 5CJ5A 4P2OD 4Z77B 2O5ZH 4R26L 4YPGB 2FJGA 5EU6A 5T3ZH 1JF6A 4L8SA 2J5LC 1D6EA 1M7DB 2A6IB 1ZLUK 5HHMB 1HHGB 3BIAX 5GRXG 5F1OB 5ICYB 5FYJE 4JM2A 1KIPB 3HZYB 3PXHA 3V0VA 5F1KC 3CFEB 2PO6B 1AQKL 2QEJA 4LNRA 4OGAC 5KW9H 4GKSB 1P4LB 3QXVA 4OLZL 5HD8C 3KWWB 5SWQA 2NY3B 2ESVA 3NFSH 4KKCC 4OLUH 4ONGH 2XY1A 1CVSC 1FCCA 4FP8L 4FQ2L 3WN5C 4TVPE 2VDRL 1LE9A 4YDLB 3NAAL 4MSWB 3R8QA 1HDMB 2VL4A 1FDLL 3WFHB 2F53E 4QOKE 4P3WA 4GRLC 3LH2H 4JFXA 1IMHC 4KHTL 2Y06L 3SKJH 4WV1C 1RJZA 3WLBA 2BXZA 1F4YL 3QPQD 3G5XB 3OR6B 4JRWA 4K8RC 5D70H 5I15L 1ZT7A 4FABL 3CH1B 4X6BA 1FSKC 4HAGA 4TUKL 5CD3B 1G7HB 1Y6KR 1JTPA 3VFUA 2VLJB 4LGSB 1U8QB 4JCLA 1WEJL 4X6CF 3O3BA 5CLWA 4MJ6A 5I8CB 4QGTA 2UWEB 4JCMA 1G0DA 3DUHA 1Q0YL 5IQ7H 1YNLL 5D7IF 1C5CH 3TBWB 3TFKC 1YC8A 3BW9A 5EC2B 4I8DA 1N59A 5B8CB 1NJ9B 4Y16B 2AXHA 5ISZA 1MFCL 1NGYA 4G8GB 4G9DA 4HJGB 5D93B 3LKPB 5F88A 5KBNC 4NJAH 3BX7C 3VXRB 4HJJL 2BJML 4NO0A 2CGRH 2H26B 4G9FD 1A7RH 2FZ3A 3VFMA 5DC0A 2XZCL 3CDCA 2E9BA 5I1IH 2OTWA 3QIUB 5F7DA 4YWGH 1LO0L 3FHQA 1CE6B 4LMQE 4K9EC 2V7NB 2ZSWA 4R0LC 2R9HD 3EO0A 2GTZB 1RJYA 3V7MA 1OF2B 3BISA 1OTSD 5I6XC 3SBWC 5DUML 3RZCD 2VKWA 2B0SH 3RVTC 1NKOA 2NCMA 1V3MA 5TDNB 1FH5H 5TQ2L 5H2BA 1OLLA 5C0RH 5KSBB 3TC9A 1QHOA 2CIKA 4Z0XB 1RIHH 3GSVA 2FJGB 4KJYA 1G7HA 3S4SA 4K07A 2NYYC 2R4RL 1QVOB 3LD8B 3QDMD 4ELMF 1IGJA 1DQDH 4E0RA 5C0FB 5HHOA 4PJHE 5JIPA 4WO4D 1FL3B 2GK0B 1MCJA 3VA6A 3T2OA 1RVFL 1KELH 4JJ5A 5ICXB 5HD8D 2DAVA 3RDTC 5IBUG 4PV9B 4XP5L 4RA0C 4YE4H 4JRYA 5HYJA 2X44D 1MQ8A 2BSRA 3MXWH 1FFNA 2VIRB 2XWTB 5LAXB 1MCSA 3BMWA 4PRPA 5LCVH 4NO0B 4TULH 3ARUA 1P1ZA 4KVCH 3U36B 1RU9L 4NQVB 2ICES 4CVZB 4GUPA 3ZYZA 1HXYB 3MRCA 1XCTB 1P7QA 4Q9RH 1UB5A 1CVRA 5IB2A 4JGUA 1ZHLA 4Y5YB 1I9EA 3RWCB 3C60C 1MCPH 5MENA 4E5XA 4JY6A 1G7IB 3OJDB 1T1ZA 3MBEC 1ADQL 5ITBL 2GQHA 1DN0A 3CVHL 5L2KB 4YDVA 4BFBD 3D1MC 1JTTA 3CIQA 4BZYA 1R3JA 3PABA 3MSPA 3BRFA 4N0YL 4FQXC 2JB6B 4QRTA 2Y25A 5DJAA 1CDGA 1MJJB 4Y8AA 4Z95H 4M6AA 1I3VA 1BMGA 5LG1A 5E8PA 2DTML 3SE8L 5KS9E 3EJZD 3F58L 4JKWA 1D6VH 4WI6A 1U8MA 2A0LD 1T7WA 4HX1A 3QH3B 1IGML 4M8QA 2RFXA 3QFJE 5EZIL 3TVMD 5J3HC 2R23B 5BRZB 2CR3A 1DVFC 1A6UH 1IKNA 4DCQA 1I3GH 2E3VA 4XVJL 1MREL 5E8OB 4Z8FH 4TUOA 1CDHA 4PLKC 5H94B 4YEFA 2GJZB 5DRZA 1EAPB 1TDQA 2X4UB 3UCRA 2DQEL 1B0RA 1IL1A 4TTGA 1MOEA 5FYKH 4RFNB 3S36X 2D2OA 5F8RC 3T0EA 1U8HA 4PJ8B 4ZO7A 4YHMH 5DMGD 1L9MA 4XPGL 1FDLH 2QQNH 1FFPB 2WAHA 4PJFA 4Z7VF 5GJSL 4OZIA 2ZKHL 5T1MB 4WFEE 5B4MD 1UXSB 3TH2T 5BV7C 4R6UA 5EOTA 1H9VA 1VGEL 3D3VD 1WBYB 1UKTA 4YXLL 3L6FB 3BP4B 3BWUC 4NWUL 3GBLA 4E42A 2BZDA 4PV9A 4WHTA 4TPRH 4IRZL 1S7XA 4U2ZA 4X6DE 5CMAA 5B3JE 1OB1B 1JVKA 3H7LA 3OXRA 5B21A 3QDME 4FQHA 3FFCD 3DJ9A 2DM2A 3KPQB 1MNUH 1UM4L 2DQJL 2LFGA 3EJZC 3GGWA 3LZFH 1XCQA 4IDLA 1T7XA 2ZSVB 5DYOA 1AR1D 2IJ0C 2BSED 1YA5A 4OCRL 4N8CH 1MLCA 1P84K 4C58B 3G6DH 3GEWB 3LKRA 4H25B 2DI8A 3MRBB 4OIIL 2F8OA 3B3IB 4MVBC 3TA3D 1U6AL 3H2WA 1RIUH 4YHYB 4GAJH 4KMTL 5LGJB 4UQ2A 3NPSB 3SDDC 5IMMB 2YZ8A 4HGKC 2DQTL 5IJKC 1R3JB 3P4MA 2NY4C 3PABB 2R29L 4S1DC 3GIZH 2OTUA 1OGAB 3MV7D 4IOFC 5F9JA 3MFGB 1U8KB 1CDBA 2R2CA 4G8IA 4YH6A 4RIRB 1UWGL 3BVNB 2ZCKH 1E4XH 2Y06H 4N0RA 3W81A 1IEBB 2BVOA 1JWSA 2YRPA 3K1KC 1U9KA 35C8L 4AM0A 4L1DA 3CXHJ 2ZOKB 3BP4A 3EO1B 2EIZB 5E9DB 3L3IA 2XTJB 5AZ2H 3BQUC 4S1SH 4XWGH 3FN3A 4C83B 1UEYA 1CLYH 1DUZB 3U0WL 1NMCC 2HLAA 2X09A 4PJEB 3RWDB 3QWRA 5I1JL 2HFFB 4AEHL 1EEZA 4DWHA 2VC2H 4C56A 1SVCP 4KRPD 1HQ4A 4LKXB 3VMPA 2AJVL 4P5MA 4RZCB 4JG0H 1E27B 3ULVD 2YD7A 5D5ME 2HP4A 5I1AA 4I0PC 1ZA6B 5EB9A 4LLWA 5KOMC 5GJTH 5E7FA 4EUPA 4IM8A 4WWKB 5D6CB 3QIBD 1WV7T 2I07A 3ZHDA 4BFIB 1RULH 3S3JA 1RZKC 2KL6A 2ED8A 5CEZL 3QDJA 1PW3A 4O5LL 3SOBH 3OKMA 4UAOB 4PJCA 4CW1B 4ZXBB 5HHQA 1Z9LA 2RJMA 3MCKA 4I13B 1R24A 25C8L 3RWJB 1W72H 4M5YL 3QO0B 1ZTXH 4Z7UF 2XN9B 3RQ3A 5BXFA 4HQQH 3MZGB 5AYUL 1NSNL 3HFML 4JG1H 4KXZH 3DRTB 4U6YB 4EEEA 2KDGA 4WHTB 3LRSA 5FHBL 3S88H 5IB3B 1DFBL 4RAHA 3UX9B 3AUVA 3MLYH 4HXBH 2F53A 4QOKA 1UM5H 3CUPB 3T65A 5GPRA 3FQXA 2ICWI 4GW5B 4N0FB 4P2CG 3P9LB 3CDFA 3KPLA 3U0TA 3EO9H 3QJHA 2P42B 1RUKL 4U1JA 1X7QB 2CRYA 3CVHB 4K2UL 4NKDB 2ZUQC 3DPBA 1BGXL 2FX9H 4WV1A 3C6LB 4OKVB 2OL3A 3ROLB 3C9NA 5A2LH 4ODVH 1C12B 4P4KA 5B38G 1XR8B 5IBLC 4P2YA 1R3IH 4M6OL 4OF5A 43CAB 5K9OB 2XKNB 1U8NB 1NBVL 1AGDB 1S5HA 3VD5A 3CFDB 4R4NC 1NBYA 4NQDD 1MHPH 1RHFA 5CD3A 5HYFA 2VITA 4JHAH 3RU8L 4N8PA 5I1HL 4MVBD 4CU7A 5T33H 5D72L 2CRZA 1T66C 2B1HL 2BRQA 1I8IA 1DUYA 2DWEB 3NZ8A 3QHZL 4HIIA 3QUXD 2R1YA 2YUVA 5CEXA 3LQAL 2VQUA 5DVNA 3HPLB 4KAQH 2EYTB 5EOQL 1RK0B 5T1DH 3AM8C 4UT9H 3G5XA 2QSVA 3VFRB 5IVZB 4WFFE 2V5TA 2NY4B 5F7UA 4UTAH 4DN3H 4IRSB 4MD0B 3VWKB 5IV2B 3CMOH 4RQQB 4FFZH 3MXVL 3O6MH 3SKMB 1LEIB 1T0MB 4HFWA 3OHXA 5EFIB 5KVDH 2UWEA 3SBWA 1FVDA 3RFZC 1INQA 3WFZA 5JW5A 1MAKA 5H8DA 4CW1A 1T7VA 4Y4FB 3RVWD 4LSUL 3M17B 2XTJE 1YEFL 1CE6A 5EBWA 1L0YA 4WEBL 5TF0A 5KSBE 4ZOAA 2QQKH 5DD0H 5EU3B 1JYNA 4JHWH 4G9DB 4XXDA 2IEPA 4G7YL 4WTZA 2FNBA 3NOIA 5HGAB 3S5LA 4W70A 1U6AH 1DQTA 5J06A 5D7IE 4JQXC 3MO1B 3BEWA 3BIBX 4D2NA 3C8DA 1KJ2H 3KPRB 2DQTH 4KKNA 4J3UA 2AW2A 2W9DL 4ONOA 5DJZB 3SCMB 4KY1H 3MRKB 4XPGH 1B88A 2N56A 4AH2A 2DWEA 3NZ8B 4HIIB 5CEXB 1E4KA 2COQA 2DLHA 2AXGB 4ODUA 1HK6A 1HKLL 2YPKA 3VW3H 3SJVD 5E95B 4CDHA 3QUYC 2R0WL 5J3HD 4Z0XA 1X6LA 3H3BC 1HILB 2O5YH 5FDWB 3QCUL 3MV9E 3ELAT 2Z92B 1F3JB 3B2VL 1HKFA 2Q76A 3U79A 4YGVB 3ARXA 2F54D 5HDBF 4OIAA 5DTFB 4LSRH 2HTKC 4U3HA 3E6HB 4HKBB 5CILL 1ROWA 4O02L 4X6DA 4GW4B 4HCRA 1CGYA 1H3VA 5D7LB 4XNZC 1IGTB 4Z0BH 2BY2A 5DUBA 1QO3B 5DI8B 3FQNA 4KI5C 2ATKA 1LO2L 3P77A 3T2NH 5FFLA 4KRPB 2IANB 2LAAA 4HLJA 4O4YH 1DQJA 4JANA 3LN4B 1RI8A 4Z7VE 2P1YA 1ND0A 4XC1H 3V7AG 4WFGD 4G6MH 3WNMA 4MNQD 4K55A 1G6RA 3IDJB 5E99L 5FYLD 5HI5D 2EZ0C 4U31A 2QKIB 5EWIH 3FONA 4LLDA 5I15H 3B6SB 4F7TB 1JHTA 1AH1A 5TE7L 4MZ2A 4XCYB 4NQCA 1P69B 3BRDA 4H88H 5E2VL 3K81A 3GHBH 2ZCHH 1VFUA 4RISH 1KB5L 5T1KA 2J6EH 3BI9X 2Q8AL 1Q94B 1LO2H 3FT2B 2VLRE 2ENYA 3UTQA 1T1YA 4DGYH 1KUMA 1IC5L 2IBZY 3OJ2C 4H8WL 3V79C 4JPVL 2ZG3A 4FFYL 3KPNA 3SGKA 2VLLB 3RWGB 5TFSH 1DBBH 1MLBB 1PFCA 5D1ZC 1HNGA 4PJAE 4X7FC 1XGTB 1FFOB 5MI0C 1LO0H 3LQZA 3QXWA 1R0AH 4ZO9A 4B53A 4HZLA 1S78C 1UEMA 4R4FL 2EE3A 5CJ8A 3I3EA 4WUUB 4N9GB 1DBJH 4HG4K 4TNWK 5J89A 3QEQD 4IS6B 3S5LG 2KZWA 4IBLT 4YBLC 3L6FA 2DIBA 4OIBA 4QRUB 5KS9A 4Z5RA 4OGYL 1MCQA 2DLEA 4X9BA 1X5XA 4YHZL 2X89D 5A2KH 4KFZC 5DTFA 1FVEB 4Z7UB 1J1PL 5DQJA 1C7TA 4PJFB 5EOQH 2BSTB 1DANU 2FGWL 1T80A 1T3FB 4L8CB 3QUYB 2FIKA 5HGBA 5GS1C 5A1AA 1AI1H 3F5WA 4OUUB 4NUJB 3SDCC 5DJ8A 3QQ9C 3PHQA 3LN4A 2GK2A 5JPNA 3RWGA 4JPWH 4UZGA 4RBPH 5J1AA 4F3FA 4LP5A 1CE1H 4WENB 4MQXD 1ORQA 2BNQD 5FUZL 4B41A 3BQUA 4EI5D 3FB5B 1YN6B 1RFDL 1W0YT 4LVOC 3WXVH 1YY8B 3IRPX 4RIRA 1MCNA 4PRIE 1ZT4B 5C0DA 3FFCE 1FYTD 1IEBA 5FO9A 4K71B 4LAQL 3UYRL 1Q9LB 3RY6A 3OSKA 3OZ9H 1BZ9A 4BQ8A 4N0YH 4M7LT 3IJYA 3MA9H 4BH7A 3JBG7 1BBJB 5AUMB 1RUAH 1GAFL 1RUMH 4UOW0 1SJXA 3S4SB 3PWPA 4UQ2B 3OXSA 5IBLD 2X1QA 3FZUC 4LPVA 5EO9A 1FYHB 4OGXL 5IW3A 3DGGB 3X11B 4HIHA 2AERT 1GVIA 4KV5E 4BQBA 4GG6A 4KVNH 3O45B 3TLRA 3TF7C 4FFZL 2VL5A 5DO2D 4LSRL 1VACB 1OTTC 3I75B 1M7IA 2UWEE 2DIJA 4PJ7F 5B39A 3U82B 4I3SH 1RV6X 5JQ6L 2AQ1A 1IFHL 4UQ3A 5EBMB 5DRWA 1DN2A 2R56L 1GL4B 1KCSH 2OL3L 2HVJB 1WWAX 1VKXB 3U2SA 5CSZA 5C0IB 3TCXA 1U42A 3FT3B 4M7LH 1HXYA 4LPWA 4WHDA 4U1NA 4EQ2A 5B8CC 1FZKA 2HFGL 3KNBA 3SGEI 1J1OH 1S78D 2DQDH 4YIQA 2C3VA 5DFTA 1LILA 5IFAH 5EZJA 1KFAH 5L2KA 4UV4L 3VRLF 4KTEH 1WLHA 1KB5A 5FYJD 2MNUA 4G43A 3FB7B 4DZ8B 1F2QA 5GSVA 3RDTA 3IDXL 4OLYH 4CBPA 3CZFA 4ODHH 1PY9A 3SGEH 5JORA 4OKVA 3CSBA 4P59H 2QSCH 3QCUH 1ULVA 4PG9A 5MHSD 3BSZH 1UM4H 2DQJH 4GT7A 5E70A 1G7MB 5I74B 4F3FB 3DVNB 1XF3A 5EULV 4F7PA 2D0HA 4LEOB 5TPWL 1DJSA 1TZGL 3PP4H 5TGBA 4I5BA 3R4DA 2IADB 3TN0A 4X7SH 3OR7B 3VFTA 1UCBL 4DK3A 4OIIH 1Z5LB 1OAUH 3I6KB 3IETB 3LB6C 1DBBL 5BS0D 4NO5B 2EDEA 4EXKA 1YY9C 4MA3B 5KZCB 2DM7A 5DGRA 4OCXH 4YUEL 3DX6B 4K23L 4NQED 5E6IC 3X13A 1VSCA 1VA9A 2XFXA 3D0LA 4LEXH 4LLVB 4YGAB 5F9DC 1R0AL 3MUZ1 5ICZB 1MI5D 2OSLB 3WXWL 4BH7B 2YD9A 3DX9B 4Y89A 3CXHK 5E8EA 2C4FT 2NZ9C 1MCLA 2FYYA 3GJEB 2J8UB 2A6KB 4XHJC 35C8H 1S5IH 4NO2B 3VI4F 3I3DA 3Q5TA 4KK6C 1WBXB 4OGYH 1MHEB 2H2SC 2Z31C 2XRAL 1GIGH 1JP5A 2VITB 2P46B 2AAVA 1A22B 2AI0L 3D48R 1JGVH 1A7QH 1PKOA 3MJ7A 4XX1E 5GS0L 3W9DA 5J9PA 3L5WB 4OI7A 3SGKC 1UQSB 4ZAKB 2NX5B 3IDNA 1KENH 4PLNC 5EBWB 2APWA 5I19L 3RL1A 4LLQB 4CVWA 2BVYA 3EJYD 3H9SA 1FYTA 3EYOA 3QUXC 3MLVL 1EHXA 3BEVA 4PJ9D 1FSKB 2PCPA 3SJVE 1XGYH 4JFDB 3ZTJH 1O7SA 3SKMA 1LEIA 5GGVY 4Y5XB 2VNCA 6FABH 2CK0L 1T7ZA 2X4PA 4WI8A 4MSWA 1NPUA 4ZAKD 3LS4H 3MV01 3EOBB 4U7MA 1CCZA 3EFFA 1DLFH 3D6GA 3IJSB 2MFNA 4OD3H 3E6FA 3MV9B 1KC5H 2WSKA 1A1MB 3HZKB 3LQAC 4PR5B 5L2JA 2J8UE 1MJ7H 1NMBL 4IMLB 1GPOL 4KUCD 4L8DA 1N5YH 3MLYL 5GS0H 4P4RB 1IGCL 3L3HA 5HHOE 5IF0B 4IMKA 3W39B 5EO0A 5ADOH 1GAFH 5ID1B 5MP6H 3ABZA 4P3DB 4NO3B 5B22A 1T5WA 3LSOB 5EH1A 4ETQA 4OGXH 4WGWB 2Z9TA 4UUJB 2G9HA 2YPLD 4N0UE 3OQ3B 4PJCF 2IPUK 2HKHL 2UZIH 3REWA 1U58A 1IAII 2AXJA 2ZWLT 5KSUA 4ZMAT 3BPNC 2ARWA 1JPSH 2D7QA 5D6CA 3WL9B 2PYFA 2XXCB 2DQUL 1B9ZA 4OZFA 4PJIE 2ARJQ 3PL6B 1RZJL 1K4CB 2GI7A 2CO7B 1JN6A 4RMVA 1TVHB 1QFUH 3EZ8A 3E6HA 4ODTL 5MEPB 3DXAE 4GG8A 2GIYA 1NMBH 1QPXA 4PJIB 1RHHA 1A14L 1IGIL 3IGAB 4NRYB 3HC0B 1BVZA 2OL3H 4JZJB 1H3TA 1RZJC 3QI9B 3GSNA 3QNXA 4M7LL 4N5UA 5IROC 4WI5A 1TXKA 3U4AA 2CDEB 4QTHB 3HC3L 4AIXA 1MUJB 4PD4J 2E8ZA 1TZHA 1BFTA 1G6RB 3WFHA 3F7VB 4Z78A 4PGBA 3B9VA 1WTGT 3KHOA 1LP9A 3QPXL 3NCMA 1JWUA 4WW2B 4X98B 2RCSL 4UILH 1QZ1A 1QA9A 7FABL 3LV3B 3CUPA 3T65B 3V4PH 5C0NC 5FYJL 2JCCF 5DD5L 3BIKA 3QIBB 3T0VA 1P6FA 2CK2A 3QDHA 1VCAA 1KPUB 1FFOA 1EDQA 2HT3D 2ED9A 1J0JA 4M9PA 4Y1AA 3UBXB 4U49A 4Q2ZB 3S96A 2IPTH 3RUGA 3NGBC 1WUNT 2OMNA 4G7YH 3Q6GL 4BYHA 1MH5B 5L7XH 1MLBA 2C3GA 2C3HA 3FOLB 1NBYB 3GSQB 3VDAA 5HBBA 2Z91B 3TBVB 4KDVA 4CN1A 3A67H 1ZGLA 4XC3H 1HZHH 4QO1A 3MYJB 3QIWB 3D2UA 4PV8B 3QPXH 3GSNB 4U1GB 1BECA 2NY6C 2GSIA 3KJ6H 5IP4A 5DJ0A 1FAKT 4BQ9A 1HEZA 2Q87A 3WIIH 5D9SA 3C2SA 3V4PL 2VO5A 1I8IB 5DD5H 3TZVD 1JYVA 2EYSA 1A0QL 3MV8D 3SQBA 4MQ7A 3OKNB 4IEFB 1ZHKB 4Y16C 1ZLWH 3B2VH 4RRPA 1OP3K 5ENWA 5DMJB 3E8UH 3GMRB 3IDXH 4BH8B 5T33L 2O5XL 3RX8A 4XBPB 3LPFA 4X4YB 1BQLH 1DBAH 2NNAA 3GB7B 2IFGA 2QSQA 5LBSH 1WT5A 3AB0C 3AMKA 2BNQB 2FD6H 1A6WH 3EOTL 4TVPH 3MLXL 1KPUA 3I3BA 4Y4HC 2CH8A 2VLJE 4ZO8A 4WVRA 3OHXB 5EFIA 3DSNA 3LKNB 1G9MH 1UB6B 1K8IA 4DKEL 2VUYA 2A2QT 2JTDA 1KIQA 2WWKT 5J11B 2IH1B 2VLRA 3FT4B 3TEUA 3VCLA 3QUZC 1SVZA 3EOAB 4LARH 4R4BB 3P40A 1YMMA 4K8RD 4FFWD 3DRQB 5HGAA 2XXMB 3UTOA 2YA0A 4PRHE 2V6HA 3N85L 4ZUWB 4NQVA 4B0MM 1SYSB 2D7TL 4HPOL 5IVXB 3QDJE 1EO8H 4HBQA 5ERWB 1CL7I 1HIMH 1LVEA 3VXMA 3T77A 5IVXE 3JV4B 3VDCA 2FHCA 4E5XB 1A3LH 1UGNA 2YPKB 4ONGL 4OLUL 2AV1A 1EFXD 1J5OL 1DL7H 3H0TB 3ECBB 2QJDA 2VXVH 4OGAD 2XWBA 2AI0H 4BH8A 3T0BA 3SEPA 3SO5A 2NNAB 2P7TB 4U05A 5DQDH 2NZ9D 3OV6A 1FNAA 1VGKB 3QEGL 4L8BB 4M61A 3WDJA 2G75B 1UJTA 3HR5B 4GKOA 2P5WB 1EO8L 4L4TE 5CILH 2Z4QA 5IW1A 4X4ZA 5IBTH 3CVIH 2HVKB 1GOHA 5IHBA 1HH9A 2OTPA 1JNHB 1CGWA 1G7LB 1J5OH 4KK8D 1OARH 1R3HB 3GMNB 2E27L 2QKIA 4FFVD 5KSAA 3E3QC 3LKSA 5JLZA 1OCWL 3PP3K 2V2XA 5DURB 2AK4E 4PRBB 4KJPD 1KEGH 3RL2A 4XBPA 4X4YA 3O4LA 3NCBB 4GKNA 4V2BA 4L4TA 2GTZA 2J88H 2IAMC 1K6QH 3RWHB 4I18B 3KPPA 2PYED 4ONFL 3GI8L 5GZOD 3ARTA 1P2CA 4ODBD 5DK0B 2F19L 3IB4A 4K9EH 1TLKA 5TE7H 1AP2B 3RKDD 2FH8A 3MBXL 5F7WC 4LLWB 1NUFA 3VA2C 5E6ZA 3VXRE 3EHBD 2PNDA 3FT4A 3X3GH 4YPGA 1CT8B 1RUQH 3NABH 5KJRL 1NCAL 1KB5H 3ARWA 1U0QA 1NLBL 2FO1A 3DLQR 3GDBA 1JMXA 5FUZH 4PJAA 5DSCB 3QUZD 2R4RH 4PJCB 4DGYL 3L3IB 1OARL 1AXSA 4L9LA 2GFBA 3P9WB 4RWHA 4FZ8H 5D5MF 4H8WH 3UTSD 5C7XH 1N3NB 1XIWD 4D9LL 3OKDB 3QNYB 3ZKQD 5GRZA 4KZEL 5DHYA 3IETA 5DK3A 3GIVA 4WJ5A 1ZA6A 5I1DA 2KPNA 3FJTA 3MRGB 3QRGL 1RURL 4WEMB 4QEGA 4YLQT 4MCYA 3EKCA 4BFIA 4LOUD 15C8H 2A6JB 2F53B 4QOKB 1KCRL 4Z7UE 5DJYB 5IJVA 2G60L 4LQFL 5E6IB 4U1IA 4DVRL 4F7MB 4KI1A 2DI9A 1F13A 4HIEB 3FQWB 5AWNL 1S7QA 4JAMA 4OQ1A 3O6FC 3I02B 2D7PA 4MXVF 1BLNB 2XY2A 5E1AB 4Q9QL 5D1ZA 4DN4H 1UVQB 4FQPA 3ZDZE 1N5AA 4L8SC 3O9WA 4XAKE 4Y5XA 2VDML 1I75A 1ITBB 3ZKXB 1JJUA 1CQKA 3D9AH 4HXAH 3MLXH 3CFCH 5DT1H 4FTVA 2WW8A 2NXYD 2NY2D 3IRZA 5IW1B 1A9EB 5EUOB 1OP5K 3L9RA 2JCCB 2RFXB 5SWZD 4PJ9B 1A7OH 4DZBB 3ZYJA 3RVTD 1G9NL 1YPZB 2XZQH 1BIHA 1HI6B 4KKAD 2ZG1A 5L88H 3HNSL 1TPXB 4NCC1 3FB5A 3QEHA 2FR4B 4K71C 3L3HB 1KJVA 5F3HA 4LQFH 5FO9B 2X05A 3V5KB 1CTNA 4A2MA 3DO7A 3DYOA 3WFCH 1RZGB 2BXYA 1UJ3B 4X5LA 2XNAA 3EFDH 3WE6A 2V9QA 3WIIL 4UUJA 1NMAL 5F96L 4XCEA 3BO8A 1U8NA 4OFKA 5CJBA 4FNLH 1C7SA 5J13B 1A2YB 4ZNEE 5D1QC 4HIEA 1MY5A 2Y9RT 3UYRH 3DUSB 4JN1H 1T83C 5C0EA 1I8MB 2EKSA 2FX7L 5EG6C 3V6OE 5JW4M 3EW3B 3LHPL 3CK0H 2BVTA 5L9DH 4WCYH 4NZRH 1SHMA 4V2CB 1DBAL 2H1PH 1VACA 4HS8L 5GGQH 2O61B 2P8MB 1ZLWK 5MEPA 1CN4A 2PW1B 2Y6SD 5EBGA 2X4RA 3O2VL 3QJFB 3DURA 2CLRB 1JPTL 5FYKD 5K93A 1MELA 4NNXA 1U36A 3JWOH 5T3XH 4J3OC 1CICB 1B0GA 4OM0H 2P47B 4IOSD 1U8IA 4M43L 3HB3D 3F12A 3CFKA 4LHUA 2ZSVA 1Z2KA 2BMKB 4F58H 2KQMA 3TYFB 1S7UA 1UXWA 4NQTA 1DTUA 3KYKL 4R0LA 3SCMA 1FZKB 4XBEL 5CBAB 3SO3C 3ZL4H 3VXOB 4CMHC 3RA7L 3R8BB 4JAMB 3SGDI 2FX7H 3RWIA 1GHFL 5T3ZL 1T5XB 5D71H 3G9AB 3KR3L 1JI2A 4UTBH 1HYRC 3PJSB 1KLGA 4X8JB 2GAZA 4U6HA 2HFGH 4F33A 3QRFM 4Q9BA 2FSEB 1KCKA 5D2NE 4RA3A 2DQFA 4LPCA 4R8WH 1JPST 3WUWG 4KMTH 5GGTL 1KFAL 4JQIH 1JWSB 5F71A 2V2WA 4JFFA 5ETUB 4P3CL 3BUYA 3O41B 4NM4H 5DHVH 3M8OH 1GH7A 4ZQKA 2YSSB 4YEEA 1QR1A 1XF3B 5JDSA 3V52H 2HLAB 1UYWL 4RQQA 2AEWA 1UH2A 3GHEL 1QQDB 1N6VA 3DX6A 3HUJF 4PG2C 1K3ZA 3U7YH 4KKAC 3IYLW 3IJHB 5IB1B 1FGNL 4LLYA 3RTQB 3PQYB 3AROA 4WFFD 4Y1AB 4JM2B 4XCFL 4KWUA 4DGVL 1ZHKA 4HWZB 4F8TA 2YEZA 1UZ8A 4GKSA 4OCLC 1LEKB 4K7PL 2MJWA 4R8WL 3GSOA 2E27H 2X89A 1HSBB 5AZEH 2DMBA 4HGWB 3H6JA 1F8TL 1U91A 2ZZUT 3TJHD 5SV3A 4RAUA 4OBSA 1Q94A 3ZKNC 3MACH 1JZ2A 4DQOH 3RHWK 4NKMB 4Y4FC 3JTSB 1ED3A 3TN0C 4ALAL 5I1KH 1ODAA 4B7IA 5GS0C 3CFBA 1TZIB 4MA1C 5D7IA 4Q9QH 3PGCB 1F3JA 5CUSH 1Z0MA 3F12B 4OT1H 4M5ZH 2VE6A 3MA7B 5IOPA 3BYYA 2A9NL 4JFQB 1DVFA 3L7FA 1A7BA 2R0LH 3SKNA 5F1SA 3TP4A 1G7JA 1CFQB 3O2DL 1A14H 1IGIH 5M94B 1KG0B 2AEPH 2RGSA 1NGQL 4HJ0C 1QG3A 3FFCA 1T0PB 4FRWA 2DQHH 2HJLB 4HHAA 3JV6A 4G6JH 5SX5K 1V8HA 3RX7A 1FNFA 1UB6A 5SWZB 1A9BB 5E8DH 1DE4A 1CD0A 2MSPA 4NHUB 4N1HB 4HWZA 4H1LA 4WU5A 5TJWK 5I16B 3QQNA 2EIEA 2ERJB 3EDFA 2CK0H 4L3CA 4M4PA 4U1GC 2OQJA 3RKDC 3DVIA 5E5MA 5JW4N 2Z93B 3LN5A 5CIPA 2BY1A 4CMHB 2VQ1A 1S7WA 5F1IB 3T0EC 2VZUA 1MAML 2JK5A 5KAQF 4XGZA 1Z9MA 3B9KB 4GAFB 4GS7C 4YAQB 5F72S 3P2TA 4M61B 1YYML 5HGBB 2VZ3A 3F7QA 5H35A 2A74B 1T1WB 4AM0B 5ACZA 3C6LC 2XN9D 4X80H 1EEUA 2P5EE 3E0GA 3AS2A 4LSVH 1K4DB 3BPLB 4QRQB 5LGHL 2Z8WC 1QSEB 3FAXA 2MCPL 5I71B 1JF1B 3IJHA 3VXUE 3D9AL 1TVHA 2YPVH 3DUUB 2P7TA 2YXMA 2A77L 3BQUB 1JIBA 4LCWD 4MXWH 4XXCC 3ULUH 2FJFA 1MJUL 3HS0A 5JO5A 3W2DL 3JUZA 4LBEB 4X7DC 3S6CA 4JM2D 3GUTA 5L2KE 3PHQB 3A6BH 5MENB 5EUOF 1MUJA 5IJKA 2VXTH 3V6ZB 2DTMH 3WFCL 1YPZF 4JVUA 4N9GA 4M7KL 3IXTA 2FBJL 4G6FB 1AO7B 2JB5L 5KVMC 4JJHA 4F37K 2ICWJ 4UTBL 5DS8B 1JWUB 4HLZH 4X98A 5DK2A 5C92A 2Q1EA 4GKNB 4WFHD 1A6WL 4JN1L 1OQOA 3O8XB 5IT2H 3LS5L 3OKOB 4J8RA 4G80B 1FVEA 4Z7UA 5EBLB 5ALCL 1H8OA 5F1NB 4QLRA 1WF5A 2X1PA 4OUOA 4HD9A 4JRXA 4KPHH 7FABH 1HQRB 5DEGB 3RVVC 4PGDA 4D0DA 4PJHB 4YHML 1F4WL 1V3KA 4QT5B 1KTRL 4D9RE 2EH7H 3D85B 2E7MA 5TH2B 3QO1A 4OM0L 5F7HA 4JE4B 3V2AR 5I8OH 4IRJA 1G84A 1BJ1H 2FL5B 2UY6A 1QRKA 4W6YB 5I75B 4NFCA 4XZUB 4EIZC 2R2HA 1CU4L 5C09A 3V0WH 2AJZA 2AEIT 1KN2L 4O02H 3GSNL 4ENEC 1FLRH 4Z0BL 1QTYT 3RWEB 5JUEL 4DK6A 2IALB 1INDH 1YY8A 3V5DA 2CLZB 1OWRM 5DMYA 3MRQB 1JMZA 1N0XH 5DZOA 2DQCL 1R3KB 3QUMB 3IXTB 3PXJA 5E1AA 5E2TH 1ZLSH 1Z0NA 1ZK9A 1IL1B 1OW0C 2J5LB 5DRZB 2EXYC 1BVLB 2V7HB 3F65A 1D5IH 2W91A 2XWJB 5I76A 4OLXH 4QWWD 2FBOJ 1FLTX 2GHWB 4NQCB 5C2UB 2ICWB 4G8FA 4S1DD 4JKPH 4MA7L 4X6BB 3ZSSA 5JHLH 3PWNB 5C0AE 3WS6C 3JTTB 2G2RA 3KYMA 3MNWB 1LK2B 4K3DH 4XHQA 3X3FL 1I8LC 5IV2A 3M8OL 3BESR 4U1KA 4CRPA 2CLVB 1XAUA 4HH9A 3V0WL 2YUZA 3INUL 1UYWH 1BQLL 4PJHA 3GM0A 1KLFA 4O9HL 4MQTB 3WO3B 2SEBA 3G08B 1BQHA 2D3VA 4MD4A 3NZHL 4X6FA 1OB1A 3W0WB 1A21A 3DYMA 2VDQL 3FKUS 3QUMH 5CMAB 1XIWA 3MRJA 5E2TL 1T21A 1LO5B 1VEOA 2JJTC 1MFDH 1T6VN 1P9MA 3OAUL 1I85C 5E94A 3CLFL 4YQXH 4YHYC 5HJ3A 2WBJD 3CLEH 2NPLX 2HRPL 2HRLA 4P9MH 8CGTA 3GSUB 3HE7C 5E4EC 3BFOA 1F4HA 3WS3A 4I77H 4NT6B 2H32A 3MRNA 3BN9D 1WT5C 2OJZL 4JFFE 4CAGA 4NQDB 4PREB 2XG4A 3RPIB 4G6FD 3QZWG 4JM2F 4J3WA 1OGTB 4K3DL 3BZ4A 1BOYA 4OM1H 1Q9KA 4JQVA 4APQB 4MNGE 2VDLH 5HYQB 3CNKA 2CDFB 3BGMA 3H9SB 3SDXE 3I84A 4GSDH 5H37G 1QNZL 4P5TD 2HN7B 4G8IB 4F7EB 3AREA 1A3LL 3GMLB 4ZAKC 4LSQH 2FEEI 3TWCH 3C09C 2DB8A 1MVFA 5CINH 1PZ5A 1YZZA 5BVJB 3CFJB 2EEBA 4POYA 5E00B 1JBJA 4TUKH 4JO4H 1N7MH 1PQZA 5IIEB 2P8MA 4NP4L 2Z31B 4P2RD 8FABA 1I9JL 1CICA 1WEJH 2FGWH 4YDLC 1NEUA 3IFLL 4NYLB 4S1RH 5JMOC 1AD0A 3CX5J 2DQHL 2JJWA 3RL1B 1B2WH 3HZKA 3MUY1 3V8CA 4ZXBD 2W0FA 1B0WA 5JA9A 4TSCH 1R3HA 3GMNA 1BD2B 4P46C 5KSAB 1TENA 3KXFB 4ZYKB 3W5MA 2JJVA 1BJMA 4MX7A 4NJAL 2CD0A 4N1EA 5C0CE 5EO0B 1EHLH 1CXEA 3O0RL 4R0LB 4ZXBC 1K5NA 4P2QB 3ALWA 1UXWB 2WQ8A 4GSDL 1Q9LA 4YFLF 1CG9A 5EIIB 1NGXB 4FQIL 2JIXA 2MQCA 1AGCB 4PJ5D 3MV9A 3TWCL 2OYPA 1JFQL 2YKLH 1AR2A 2NY5C 1OCWH 4YHOH 4I9WD 2JIXD 3DETD 2WUCL 4EOWL 1LDSA 2AJSH 5D93C 2XV6B 4F33B 1U93B 5DMGC 1XH3B 5CLTA 1CXHA 2QV2A 4GG6B 3SE3A 4EIGB 4KUCF 3CZJA 4PB0H 5DRXB 3MOAH 2F54A 4WUKL 4M1CC 3KPNB 4PS4H 1FYTB 2XKNA 4ERSH 1F58H 3NFPA 5CJXC 3QDGE 4ZFZB 3GKZA 1JHLH 4OCWL 4ETYA 4TSBH 1MJUH 3LOWA 5GRUL 3RZCA 4KQ3L 4PGJA 3WBDA 3H7BB 2IAMA 3KXFE 4UT9L 2APXA 4OF7A 1RD6A 4TYUA 3CPLA 3PWVA 3T0ED 5MERA 4GUPB 4PJGE 4HWEH 3Q3GB 4Q74A 1NKRA 4WHYH 4NQSB 3IU4L 1MRFH 3EZJB 4IRSD 2YPLB 4HIJA 1R5VA 4YR6A 4QRUA 3QUYD 3ARBD 2VERN 3EGSA 4WCYL 3DROA 4L4VA 1QSEE 3PE9A 3QIWC 4BZ2H 1NLDL 1DEDA 3QNXB 5DJ2B 5TQ0L 2P5EB 1CLOH 3L7FB 3C5SA 2EIBA 1KJ3H 1FBIL 1LO4L 2X70A 5GHWL 1INQB 3NN8B 1YEKL 2CKBH 4YXKH 2EC9T 1U3HD 4HIXH 4KI5F 4XVTH 2JCCA 3UJIH 1WIPA 2UY7A 4GBXD 1A9BA 3G5YA 1WWCA 5ANMA 4MA8L 4NHCL 5D1XB 4ZD3L 1ZHNA 1YEHL 2YMXH 2HT2C 3C09B 3V4UL 1R5IA 1IE5A 3VFPA 1SM3H 3VMNA 1G7QB 5FAAA 3QEHB 2FR4A 2AK4B 1HEZB 4L3AA 1IC7L 2ADGB 4V1DE 1N64L 2RAMA 3ZDYE 3SGJC 1S7WB 5D70L 5FXCH 1MRCL 1KN2H 1QSFB 4H25A 1CDCA 1M7DA 4M00A 5EZOH 1IM9A 1UCBH 5GZND 1ZEAL 1BF2A 1I3GL 4WO4C 5I16A 1TQCB 5EZLB 3B8SA 4Y5XC 3QEQB 4X4MA 4JQIL 4RWYH 4RX4A 5MI0B 2BRRH 3C08L 4QHLA 1BJ8A 3R1GL 5CZXC 1S7TB 1QLRA 3E3QE 5FYLH 3P73B 4OFDA 4JB9H 3DUUA 1OP3H 3IFPA 4R97C 4J12A 4ODWA 2VYRE 3ET9F 1U8OB 4I2XA 4GAYA 3NN8A 5I8CA 3W9DB 3ZTNH 4KGLA 1DSFH 2DI7A 2ZCLH 3NCEB 1CXFA 3S3SA 2CKBB 2OX5A 4YC2B 5FDYA 5CINL 4K3JL 3I75A 1JZ6A 5HHVH 2B5IC 1A7QL 3OG4B 4XCFH 1V5JA 2R0ZL 3U9PH 4NP4H 4X6DB 3GNML 2ADFL 2B4CC 1FNHA 1JPTH 1NGPH 4POZD 1NEZA 3GKWL 3OTTA 3Q3GA 3MRIB 1RK1B 3HMWL 1BFVH 1FH5L 5A16B 5CBEB 3GO1H 4X9IA 5I8EB 4MLIA 1PX4A 3MLZL 5KTEL 2ZSWB 1BWWA 3B9KC 1F90L 1T4KB 3CH8A 3T77B 3QIUA 3O3AA 1FL5A 1ETZB 4QHKJ 1WBZA 4G7VL 3MROA 3UPAA 4N9OB 4NM8L 2WWKO 3ULVF 4JFEE 1DDHB 3KYKH 3KPOA 3FZUD 1E6OL 4KHTH 1KELL 1FPTL 2LVCA 3WHE1 4BM7A 4UU9B 4U7KA 3ROOA 5AD0B 1K8DA 3HZVA 2PW2B 3CXDH 3QNZB 1ZHBB 1ZANL 1F11A 1T89A 1JHKL 4PJ5B 2R0ZH 4WFED 3U9PL 1DEEA 2Y7QA 5D1XA 4S1QH 3MLSH 4FZEH 3GKWH 3M1BB 3STZA 1DUZA 3HG1D 5DD6B 1C5CL 4WNQB 4EI5C 3CVHA 2YPLE 3W0WD 3F8UB 3LDBB 4PS4L 1ACYL 1IM3B 2Y6SC 2HMIC 3GK8H 1F02I 1F58L 1G7LA 3C9NB 5CCKL 1X9QA 3BAEL 3QIBC 4BSVB 5KSVA 4PUBL 4OFYD 2EC8A 3FCTA 5E08L 1N0LA 1YEDA 2X1OA 4PJDA 5ABDE 4WTZG 1DQML 1HHJA 3TBYB 2BVEA 4GRLB 2NY0C 3FO9B 4NCC2 5JIKA 2WQRA 4LOUC 4OD2A 4CU6A 5HI4C 3O9WD 2R2HB 3IFOA 4RGMC 3O0RH 4HBCL 2CMRL 4P2OC 1YN7B 3UTPE 3VGAB 1LK3L 2VAJA 5C0GA 4PRNA 4YDKL 1P4IH 1XIWC 5DJCA 3DMMC 4YDVB 4UT7H 3IXAB 1NFKA 5IB4A 1QLFA 5ECJE 2EZ0D 5A2JH 4XVJH 3ECBA 1YNTA 3NGBB 1ZHLB 5DXWA 3WXVL 1HHIB 4CADA 2NTFB 2C7UB 1G7JB 1JV5B 5J57B 2W0PA 1IILE 4DQOL 1MPAL 1DP0A 1ZLVH 1LO5A 4XVTL 1AGBA 2BY0A 3Q6FA 4PLKD 4X5WB 5IB5B 3JTTA 3QJHB 1E28A 1AKJB 1OAXH 3BPNB 5IW6B 1IM3A 1A02N 2OXHA 1X5JA 3UBXA 3VWKD 1WCQA 3G08A 5F7LB 4PBWD 4OCWH 4NQUA 5C0CB 2IAMD 4DVBA 1AHWA 1I7UA 3K3QA 1RUKH 4N90E 4EDWH 1FE8L 3DWTA 3FO9A 1B0RB 3QHFL 3T0EE 1IC4L 1A1OB 1CFBA 5E94B 2Q7YA 1KLUB 3T0EB 2FCBA 2XI9A 1JRHL 2FHBA 1AFVH 3UJJL 4Q9RL 3PHOA 3K2UH 1FZOB 3QXAB 3UO1H 2W92A 3HCVB 2DLGA 1PX3A 3CJJA 1TQCC 4LASH 4R7DB 1EGJL 4W4OA 1SJHA 5JQ6H 1ADQH 3RIAF 5ITBH 2R1XB 4RGND 4OZGE 4JB9L 4NO3A 2D03H 1T1WA 5ACZB 5TDPB 1Q9KB 4LCUA 1NFIA 2Z31A 4OCRH 1ZVSB 4N8VG 4JFFD 4B5EA 1KULA 3NCJL 4MNGB 4RDQG 5INCA 5EA0H 3QCTH 1UWEL 3QXUA 1XCQB 4PRPD 3E8UL 3HAEG 3QHFH 1HCVA 5F9OH 1YEHH 2YMXL 1MWAB 5DYOB 1DQQA 2AJ3A 3OAZH 4PJAB 2AQ3A 5DSCA 3TBSB 5CGYD 3UTZB 5GS2D 3VGDA 3TGXA 4O2CA 1E6JH 4O58H 3K2UL 1NAKH 1X5FA 3P30H 4HJGA 4RGOL 3T1FA 4Y5VA 3QSKB 1KACB 1F4XL 1MFBL 4LSTL 4P59L 2A0LC 4DKEH 5KTEH 1OGAA 4U1SB 3KLDA 1FC1A 1NAMB 5CSZB 2X4TA 5EZOL 3VXUA 2D03L 2X4SB 3Q2CA 5I0DA 3ARSA 5JDJA 3QDGD 4OKDA 4LARL 1XT5A 5F9JB 1NANI 3BEWB 1U8LB 5A2FA 3UTSE 4PTUB 2HAZA 4L9DA 2I5YL 2VAAB 5GJSH 2A9MH 2XIDA 2P8LB 4PP2B 3X3FH 5LKNA 1OM3H 1RMFL 1HINL 4JFHD 5FGRA 2ZOKA 2AGJL 3H0TA 5D8JL 5FGBC 4RMWA 5EU6E 1B0GB 3HE7B 5E4EB 1EO7A 4PJEA 3RVUD 3KPSA 4NPYA 4Y4HD 3UTTD 1D5XA 3BVNA 1H3WM 3KYNB 5GGTA 1CZ8H 4S10A 4JM4L 1DL7L 4GO6B 3MUGA 5DF0A 4Z7WB 1S7UB 3PWLB 1MFDL 5BZDB 2W07A 3QO1B 2AABH 4KROC 1IVLA 1NSNH 3PL6D 2OZ4H 2IQAA 5CP7B 1KIPA 3HZYA 1KLUA 4XZUA 3TN0B 2AEQL 1R5VB 3EYFA 4GQ9H 1MIMH 4NKOA 3VWJC 1UADC 3EGSB 3K74B 4PRID 4PRPB 5HGHB 4MYWB 1R24B 1OOAA 2GAZB 3BH8B 2AJUH 3VRLE 4NN5B 4ZPTA 5DJ0B 1I3RA 1T20B 1BVLA 2V7HA 3NACL 5IFJB 4MB4A 3LRSB 2B2XL 3WFDL 3DRTA 4YR6B 2LQRA 3QXDB 2NXYC 2NY2C 4QRPE 4WHCA 2H3NB 3BGFC 1OSZA 4FFWC 5J7CC 2QR0A 3FO1B 1MF2L 2DKSA 2ZUWA 3DYPA 3QG6B 1X7QA 3K8MA 1KGCD 7CGTA 1R3IL 4M6OH 4U6HB 1D5IL 1AP2A 3KPLB 1TJGL 3RNKA 2BNRA 1QSFD 4Q97A 3L5WA 4RMRA 4S1RL 2BCKB 3WJLC 5IB3A 4UDTA 1B2WL 2DBJA 1QSFA 4L4JA 4GBXB 4LCIL 5DJ8B 4LKCA 4LLQA 2IH1A 3ZDXE 2H9GA 4P5KB 5TE4L 5GJTL 1B4JH 2PETA 2PXYC 4IJ3B 1YMMB 4PRHB 3QEQE 2B1AL 2P49B 4NQXA 4UOJA 2AK4D 4DAGH 3ARQA 1CFNB 3ZHKA 4BFEA 4MCZB 5DJDB 4FZ8L 1ZE3C 2X4UA 1S8DB 3SDYL 1W72L 1PSKL 4C55A 1YEJL 4K7FA 4RFEA 4ZTPH 1SYVA 5DUPH 5EUKA 2DN7A 2NXZC 4HF5H 4G6KL 2YD1A 1KPVB 3KLAB 3L7EA 1V05A 3QEQA 4OTXL 2NY4D 1IAIM 1U3HC 3QRGH 4HMEA 2Q8BL 2ITCA 1DBJL 1NCDL 1G7PA 5IGXL 4Y19A 15C8L 1PZ5B 1UACL 1UZ6F 2NZIA 3GI9H 3NCJH 4NZUH 5DFWH 1P9MC 3JTSA 4JPIB 4RMQA 2PO6D 4R96A 3QDJD 5LJYH 1LNUB 1AC0A 4ZNCD 1ETZA 1BVKB 5A3IC 3KYAA 3TYGH 1H3GA 1I3RB 4YWGL 3FTGA 1QR4A 3DSFL 2UWEF 1OAKL 4HUMB 1MRFL 4JQVC 5DGQA 3KS0J 3BKJH 1RK1A 1O7VA 1DQLL 4HCRL 1HHHA 2P8PA 3V6FA 2B20A 4NCDA 4JFPB 4XPTH 1MWAL 3WNNA 5JLZB 1MHPL 4PJIA 5IGXH 3ARGA 4K7FB 4D9QD 2B4CH 4YIQB 3P4OA 5C3LD 3FOMB 4JR9L 1SMAA 4GFTB 3G6AA 5TF1L 2DTSA 2IPTL 3QIBA 3WKMH 2NY5L 3IJYB 5T1LB 1DDHA 3PGFH 1DQDL 5DA4A 5GGVH 4XX1G 3HPJA 4XB7A 4GLRI 1B90A 2P4AB 5GGUB 4DEPB 1CICC 1G6RL 3DI2B 2LU3A 1E4WH 4PJ9C 5E1HB 2Q76B 3F7VA 5C0AB 4PFEA 4DN3L 1A6PA 1IGTA 1U8QA 5J11C 5FM5O 5JMRA 2DL9A 3A6CL 3MRLA 4PLJC 4LRIA 5KSAD 5ACMA 4MMZC 4F7PB 3JWDL 4AZ8A 1CZ8