3MQKB

Cbf5-nop10-gar1 complex binding with 17mer rna containing aca trinucleotide
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
52
Chain Sequence
RIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
pubmed doi rcsb
molecule keywords tRNA pseudouridine synthase B
molecule tags Isomerase/rna binding protein/rna
source organism Pyrococcus furiosus
total genus 6
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2010-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.40 Mainly Beta Single Sheet Rubrerythrin, domain 2 H/ACA ribonucleoprotein complex, subunit Nop10 3mqkB00
2AUSB 2EY4E 3LWVB 2HVYC 3HAXC 2APOB 3HJYB 3MQKB 3LWPB 3LWRB 3HJWB 3LWOB 2RFKB 3LWQB 2AQCA
chains in the Genus database with same CATH superfamily
5H1Sc 3GTQL 3SS2A 4AHZA 5GAEc 5K2ME 3GTML 4K9FA 2E2IL 2CKCA 3HOYL 3GTLL 1B2OA 1B71A 1Z92B 3JR7A 1R0IA 3S15L 3RZDL 4A3FL 4LHNA 2GMGA 3WWNB 4XGHA 3NFPI 4C3IL 5C4XL 1R0HA 8RXNA 1T9OA 1TWFL 2PVEA 1RYQA 3QQCE 2ZIXA 2KN9A 3IU3I 2JI3A 4B8CD 2M4YA 1IU6A 2R93L 4ME3A 4C2M1 2NVQL 2JA7L 1B13A 1VZGA 5IYDL 3LPEB 4AHWA 4AI3A 1WCML 4LHLA 2E2JL 2KKDA 5IYCL 5AI3A 3GTOL 3KYYA 4BXXL 4V196 2R92L 3S2DL 2V3BB 1QYBA 1TWAL 2EY4E 5RXNA 1ODHA 2B5ID 3WWLA 5FLML 3HAXC 4AR3A 3GTPL 4C3JL 3PIO1 4ZN3B 2PPTA 1RWDA 5GAGc 5M5WL 1BQ9A 3LWPB 3RYGA 3H9CA 5MF6A 3FKIL 1IU5A 4A93L 3PWFA 1PFYA 2JA8L 4A3JL 2AQCA 3K7AL 5JVH1 3HOUL 4POGA 3KYUA 4AR5A 4UY81 2A69D 1PFWA 3LWOB 1K83L 2XJSA 2PSMC 2DSXA 4AHYA 1IROA 1B2JA 2L0ZA 5DM61 4A3LL 5EIOC 1CADA 2XJUA 3LWRB 3I4NL 4JAGA 2K2DA 5C44L 4BBSL 3H97A 2Y0SP 4JAEA 3PKJA 1S24A 1RYTA 1RDVA 1SMMA 3MSUA 4JAFA 2JA6L 3PKIA 4POFA 3FDJA 4ZN1B 1YK4A 5MFZA 2V0EA 1T9PA 5IYBL 1BFYA 4AI1A 1PFVA 4BY7L 2RDVA 3PZAA 3HOWL 4A3IL 3HJYB 2O5JD 1IRNA 1LTLA 4RXNA 3S1NL 2PMZP 1QQTA 2PVXA 3J7Z1 4QIWP 5C4JL 3KYVA 2C6BA 3H9BA 1SFOL 1SMUA 5IP7L 2PYAA 4C3HL 2A6ED 4TVMA 4A3GL 1VZIA 3I4ML 3RZTA 4AI2A 4A3DL 2XJQA 1YUXA 1NNQA 1LKMA 3HKZP 3MPSA 3S1QL 5IP9L 1R0FA 3A44A 1NXEA 1I50L 1PZXA 3HOXL 1FHMA 1T9QA 3M3YL 3ZG6A 5DM71 3RZ6A 2V0FA 5GAHc 3PL5A 3GTKL 5AI2A 1R0GA 2QL0A 2H12A 4X6AL 2RFKB 2JA5L 3S14L 2LCQA 1FHHA 3PIP1 1YV1A 3QVDA 2CKAA 4A3BL 2MS3A 2Z3RB 5M5YL 2JI1A 3CQZL 3PO2L 2WAQP 3HJWB 3M4OL 1VCXA 4YWMA 2CR8A 5FJ8L 2B63L 1H7VA 4U671 1YUZA 3K35A 1SMWA 2BE5D 1RB9A 5MFPA 3S2HL 4A3EL 3LNLA 5AN9H 2WB1P 2M6OA 3S1ML 2VL6A 7RXNA 4GS7D 6RXNA 4A3KL 1R0JA 2XJPA 3HOZL 4Y52L 4JADA 3GTJL 2HVYC 2A68D 4A3ML 1S30A 4AR6A 2VUML 1TWGL 1QCVA 2XJRA 3VPBE 4AYBP 1Y1WL 2NVTL 4YWLA 3KYWA 1BQ8A 2JI2A 1I3QL 1DVBA 1LKPA 1ZRPA 2YU9L 5M3ML 1CAAA 3P8BA 4XXBB 5EINC 2NVYL 3H0GL 1C09A 3J7Y1 1IW7D 5M3FL 3B08B 1TWCL 2C6AA 2AYJA 4TPUA 1S2ZA 2XJTA 4Y7NL 2J9UB 2R7ZL 5MLC3 3H3VM 4AHXA 5JVG1 5IY0A 3LWVB 3MQKB 4A3CL 2A6HD 1I6HL 2AUSB 4BY1L 1OWCA 3RZOL 5M5XL 5C3EL 4BBRL 2E2HL 1TWHL 1Y1VL 3S1RL 1RDGA 3S17L 2M4VA 1PFUA 5MGNA 1E8JA 1F4LA 1VZHA 2NVXL 3P2AA 5GADc 1DX8A 3GTGL 1LKOA 1OWBA 1WJVA 1NXGA 2M6PA 3B0AB 3KYXA 2NYDA 4AI0A 2Z3QB 3H99A 1YK5A 2HR5A 3HOVL 4WFN1 4G6BA 3S16L 1BE7A 3PO3L 2APOB 4E6YA 2XJVA 4AR4A 1JYBA 2ERSA 1BRFA 1P7PA 1R9TL 2ERJA 3LWQB
chains in the Genus database with same CATH topology
2AUSB 2EY4E 3LWVB 2HVYC 3HAXC 2APOB 3HJYB 3MQKB 3LWPB 3LWRB 3HJWB 3LWOB 2RFKB 3LWQB 2AQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUS B;  2EY4 E;  3LWV B;  2HVY C;  3HAX C;  2APO B;  3HJY B;  3MQK B;  3LWP B;  3LWR B;  3HJW B;  3LWO B;  2RFK B;  3LWQ B;  2AQC A; 
#chains in the Genus database with same CATH topology
 5H1S c;  3GTQ L;  3SS2 A;  4AHZ A;  5GAE c;  5K2M E;  3GTM L;  4K9F A;  2E2I L;  2CKC A;  3HOY L;  3GTL L;  1B2O A;  1B71 A;  1Z92 B;  3JR7 A;  1R0I A;  3S15 L;  3RZD L;  4A3F L;  4LHN A;  2GMG A;  3WWN B;  4XGH A;  3NFP I;  4C3I L;  5C4X L;  1R0H A;  8RXN A;  1T9O A;  1TWF L;  2PVE A;  1RYQ A;  3QQC E;  2ZIX A;  2KN9 A;  3IU3 I;  2JI3 A;  4B8C D;  2M4Y A;  1IU6 A;  2R93 L;  4ME3 A;  4C2M 1;  2NVQ L;  2JA7 L;  1B13 A;  1VZG A;  5IYD L;  3LPE B;  4AHW A;  4AI3 A;  1WCM L;  4LHL A;  2E2J L;  2KKD A;  5IYC L;  5AI3 A;  3GTO L;  3KYY A;  4BXX L;  4V19 6;  2R92 L;  3S2D L;  2V3B B;  1QYB A;  1TWA L;  2EY4 E;  5RXN A;  1ODH A;  2B5I D;  3WWL A;  5FLM L;  3HAX C;  4AR3 A;  3GTP L;  4C3J L;  3PIO 1;  4ZN3 B;  2PPT A;  1RWD A;  5GAG c;  5M5W L;  1BQ9 A;  3LWP B;  3RYG A;  3H9C A;  5MF6 A;  3FKI L;  1IU5 A;  4A93 L;  3PWF A;  1PFY A;  2JA8 L;  4A3J L;  2AQC A;  3K7A L;  5JVH 1;  3HOU L;  4POG A;  3KYU A;  4AR5 A;  4UY8 1;  2A69 D;  1PFW A;  3LWO B;  1K83 L;  2XJS A;  2PSM C;  2DSX A;  4AHY A;  1IRO A;  1B2J A;  2L0Z A;  5DM6 1;  4A3L L;  5EIO C;  1CAD A;  2XJU A;  3LWR B;  3I4N L;  4JAG A;  2K2D A;  5C44 L;  4BBS L;  3H97 A;  2Y0S P;  4JAE A;  3PKJ A;  1S24 A;  1RYT A;  1RDV A;  1SMM A;  3MSU A;  4JAF A;  2JA6 L;  3PKI A;  4POF A;  3FDJ A;  4ZN1 B;  1YK4 A;  5MFZ A;  2V0E A;  1T9P A;  5IYB L;  1BFY A;  4AI1 A;  1PFV A;  4BY7 L;  2RDV A;  3PZA A;  3HOW L;  4A3I L;  3HJY B;  2O5J D;  1IRN A;  1LTL A;  4RXN A;  3S1N L;  2PMZ P;  1QQT A;  2PVX A;  3J7Z 1;  4QIW P;  5C4J L;  3KYV A;  2C6B A;  3H9B A;  1SFO L;  1SMU A;  5IP7 L;  2PYA A;  4C3H L;  2A6E D;  4TVM A;  4A3G L;  1VZI A;  3I4M L;  3RZT A;  4AI2 A;  4A3D L;  2XJQ A;  1YUX A;  1NNQ A;  1LKM A;  3HKZ P;  3MPS A;  3S1Q L;  5IP9 L;  1R0F A;  3A44 A;  1NXE A;  1I50 L;  1PZX A;  3HOX L;  1FHM A;  1T9Q A;  3M3Y L;  3ZG6 A;  5DM7 1;  3RZ6 A;  2V0F A;  5GAH c;  3PL5 A;  3GTK L;  5AI2 A;  1R0G A;  2QL0 A;  2H12 A;  4X6A L;  2RFK B;  2JA5 L;  3S14 L;  2LCQ A;  1FHH A;  3PIP 1;  1YV1 A;  3QVD A;  2CKA A;  4A3B L;  2MS3 A;  2Z3R B;  5M5Y L;  2JI1 A;  3CQZ L;  3PO2 L;  2WAQ P;  3HJW B;  3M4O L;  1VCX A;  4YWM A;  2CR8 A;  5FJ8 L;  2B63 L;  1H7V A;  4U67 1;  1YUZ A;  3K35 A;  1SMW A;  2BE5 D;  1RB9 A;  5MFP A;  3S2H L;  4A3E L;  3LNL A;  5AN9 H;  2WB1 P;  2M6O A;  3S1M L;  2VL6 A;  7RXN A;  4GS7 D;  6RXN A;  4A3K L;  1R0J A;  2XJP A;  3HOZ L;  4Y52 L;  4JAD A;  3GTJ L;  2HVY C;  2A68 D;  4A3M L;  1S30 A;  4AR6 A;  2VUM L;  1TWG L;  1QCV A;  2XJR A;  3VPB E;  4AYB P;  1Y1W L;  2NVT L;  4YWL A;  3KYW A;  1BQ8 A;  2JI2 A;  1I3Q L;  1DVB A;  1LKP A;  1ZRP A;  2YU9 L;  5M3M L;  1CAA A;  3P8B A;  4XXB B;  5EIN C;  2NVY L;  3H0G L;  1C09 A;  3J7Y 1;  1IW7 D;  5M3F L;  3B08 B;  1TWC L;  2C6A A;  2AYJ A;  4TPU A;  1S2Z A;  2XJT A;  4Y7N L;  2J9U B;  2R7Z L;  5MLC 3;  3H3V M;  4AHX A;  5JVG 1;  5IY0 A;  3LWV B;  3MQK B;  4A3C L;  2A6H D;  1I6H L;  2AUS B;  4BY1 L;  1OWC A;  3RZO L;  5M5X L;  5C3E L;  4BBR L;  2E2H L;  1TWH L;  1Y1V L;  3S1R L;  1RDG A;  3S17 L;  2M4V A;  1PFU A;  5MGN A;  1E8J A;  1F4L A;  1VZH A;  2NVX L;  3P2A A;  5GAD c;  1DX8 A;  3GTG L;  1LKO A;  1OWB A;  1WJV A;  1NXG A;  2M6P A;  3B0A B;  3KYX A;  2NYD A;  4AI0 A;  2Z3Q B;  3H99 A;  1YK5 A;  2HR5 A;  3HOV L;  4WFN 1;  4G6B A;  3S16 L;  1BE7 A;  3PO3 L;  2APO B;  4E6Y A;  2XJV A;  4AR4 A;  1JYB A;  2ERS A;  1BRF A;  1P7P A;  1R9T L;  2ERJ A;  3LWQ B; 
#chains in the Genus database with same CATH homology
 2AUS B;  2EY4 E;  3LWV B;  2HVY C;  3HAX C;  2APO B;  3HJY B;  3MQK B;  3LWP B;  3LWR B;  3HJW B;  3LWO B;  2RFK B;  3LWQ B;  2AQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...