3MYWA

The bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSAYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title The 0.25-nm X-ray structure of the Bowman-Birk-type inhibitor from mung bean in ternary complex with porcine trypsin.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA02
2ANKH 3GY2A 1P04A 4AORA 2ZECA 1QQUA 3BEFB 3K6ZA 4TPIZ 2BLOA 1J14A 4XOJA 1GI9B 4CH8B 4YT7H 3LIWA 3QO6A 1FY1A 1O3DA 2NU1E 3B8JA 1K1NA 1EZQA 1Z8JB 4I31A 3F9EA 3RMLH 1A61H 1UVTH 2VVUA 1TALA 4BAOB 2VWNA 3OSYA 3KNXA 1TYNA 4JZDH 3M5NA 1ABJH 4ASHA 1P9UA 3A86A 3GY8A 1WCZA 2JH0D 2A5AA 1EP6A 5JB8S 4J2YB 3BIUH 2J94A 4OS6A 1YLDA 3ZZ5A 5AFYH 2IPHA 1GHXH 2WINI 5TCAA 2GVFA 2P3UB 3F9HA 1Y5UT 2AMDA 3QZRA 1FY4A 4K69A 1LQDB 1P02A 4JZFH 4Y11E 1YCPK 1QHRB 2F9BH 4AZ2B 3VXFH 3T25A 3KQBA 4BXWA 1PYTC 3AW1A 1EJMA 1WTHD 1SG8B 1UTPA 4CHAC 1GHWH 1Q2WA 1WQSA 1AY6H 4HZHA 1ETTH 4VGCC 1DY9A 1TGTA 1ACBE 2OXSA 2H2ZA 3A7XA 1GJBB 3M5OA 1UVUH 2V3HH 3IWMA 3MWIU 3GYMA 2BHGA 1TNGA 4ESTE 1O5CB 5A0CA 4INKA 2XBXA 1CBWB 1QA0A 2SNWA 3JZ2B 1TB6H 4X0WU 5CHAC 1GI8B 3U9AH 3GCNA 3U1JB 3ZZDA 4X1PU 2A4OA 2ANMH 2RA0A 1LHGH 5GIBA 1DLKB 3NKKA 1TRYA 2C93B 3RXPA 2FOAA 1C2JA 3I29A 1AVWA 2PUXB 1AD8H 1W0ZU 2G55A 1J8AA 2ZDVH 3LU9B 2GP9B 3UIRA 1CA8B 3QGNB 2DUCA 2BD9A 2ZU2A 3KEEA 1NN6A 1AMHA 1XXDA 2VGCB 1C5OH 1MKWH 1MTSA 3K2UA 1FIZA 5TCCA 1AI8H 1L2EA 5AVDA 3NXPA 4A6LA 4B2AA 3V3MA 3AASA 2CJIA 2ZC9H 1P2KA 5PTPA 4DGJA 4X2YA 4R0IA 3K65B 4MDSA 1EQ9A 1GBTA 1FXYA 4A1TA 3U1IB 1O2WA 3M7QA 2ZFPH 1CBWC 5FBEA 1EKBB 2FZZA 6GCHG 2BM2A 1A7SA 3M3VA 3TH3H 1FY5A 2FI4E 2A31A 5GWZA 1D6WA 4Y8YA 1C1TA 1GBKA 4ISOA 1N1LA 3DD2H 3QWCH 1HYLA 5FPYA 1TX7A 2PV9B 3PMJA 4PROA 2J92A 1MKXH 3NK8A 1B0FA 1DDJA 1BTWA 1NRSH 2J38A 2JETC 2UWOA 1ARCA 3BEUA 3S9CA 4GAWA 1L4ZA 3UFAA 5A0AE 1XKAC 1M9UA 1HAIH 1O35A 2FOBA 2IN2A 1A46H 4DG4A 2P59A 3RXAA 2G81E 1Z7KA 3UTUH 1UTOA 2EI6A 3SV9A 1WUNH 1N8OB 1LHFH 3A8AA 1BRCE 1ZJKA 1JXPA 2BX4A 1K2I1 1ZLRA 4JZEH 5C3NA 1AKSA 2BD7A 3PO1B 2ZFTA 2Q6GA 2TIOA 3QTVH 5DO4H 5AHGH 5FX6A 4YLQH 4YOIA 4GVUA 1GBAA 2Z3EA 4YO9A 3WY8A 2B7DH 3PWBA 4I8KA 2CGAA 4INLA 2GMTC 4NIYA 1TA6A 1TOCB 1FZZA 1KXEA 3IG6B 2BY5X 1GVZA 3BTGE 5HMAA 3SU0A 3AVZA 2BVRH 1EX3A 2C8XB 3BG4B 1AVXA 2HPPH 1OX1A 3MFJA 4JYUH 1RTLA 3A84A 1YBWA 4ISLA 5C5OA 1JRTA 2NU4E 2VIPA 1KDQA 1V2ST 1QRZA 3E0NB 2GZ7A 1T7CA 4D9QA 3HKJB 5L30H 1C5XB 2ZDNA 1F5KU 2A7JA 1GI3A 4ABAA 2RDLA 4M7GA 1C9PA 4RSPA 1DXWA 2R9PA 2H6MA 3LOXA 4X1RU 3ZVDA 1GI7B 1S84A 2BLQA 3A88A 1TX8A 4NSVA 3RC6A 1K1PA 4JZIA 1IOEA 2NU2E 1O3OA 3VGCC 1D9IA 3SJOA 4A1VA 3SJ8A 4IBLH 2GT7A 1EAUA 3HATH 3RXEA 3O8DA 1K1LA 4MVNA 2VVVA 4K1TA 4TWWA 2HALA 1PPZA 1C2DA 2QY0B 1TE0A 3T5FH 1AVGH 1DANH 1GHAG 1BITA 1P3CA 1EOLA 3B9FH 3QGJA 3W95A 2WPKS 1PQ8A 3E90B 3LGTA 3BTQE 5GXPA 3M35A 4YLUA 2GKVE 1GMDG 1XKBC 3QLPH 1ANEA 2QA9E 4NZLA 1ZYOA 2FTMA 3QUMP 2XC5A 2W3KA 1ELEE 4U30A 3MNXA 2WPLS 2I6SA 4X8UH 5HM9A 1GPZA 3EQ0H 1MTNB 2EEKA 6LPRA 3S7KB 1IQJA 1P03A 3SV6A 1A0JA 2EC9H 4NFEA 2O8MA 3LKWA 2BOKA 1Z8IB 3LJOA 1XUHA 2W3IA 4F4OC 3MU1A 4CRCA 1GJ7B 3SJIA 1C2GA 3GY5A 4BOHA 3ESTA 1C5VA 1YPHC 1YPKH 1GI4A 1HAYB 2BQ7B 2VJ1A 1MAYA 1K1JA 4MLFB 4A5TS 1ZTKA 3I77A 1ARBA 1DX5M 4X2WA 2VNTA 1NM6A 1C1PA 1VCWA 1ZSJA 2QYIA 3BTME 4LOYH 2BDIA 4KELA 4YESB 1HLTH 2PGBB 2HLCA 4WY3A 2XTTB 1ESBA 4ZAEA 3BN9A 1UVSH 1AN1E 1UK3A 3MH5A 1C1VH 1ZR0A 3KHVA 4UFDH 3A7WA 3BIVH 1Y3UA 4MPWA 5FCRA 4H42U 1VJAU 3DHKH 1HUTH 6GCHF 1C1NA 1SQAA 5J4QA 1MKWK 3C1KA 4ZKNU 2BZ6H 2R2MB 1VJ9U 2CF8H 5EGMA 2ZCKP 4UFEH 1QBNA 2ZU3A 1NESE 1QJ6B 1BBRK 4Q80A 1ELVA 4ZHMU 4NA7A 3A7VA 4LK4A 3ELAH 1J9CH 1HIAA 1W14U 1G3DA 2OD3B 4NZQA 1FPCH 3ENSB 3V13A 3FZDA 1EASA 1TWXB 4Q7YA 4R8TB 3S69A 1P3EA 2FX6A 3SU1A 4K5ZA 2R0LA 3A87A 1XMNB 1NRQH 2XBVA 1X7AC 4WXIA 2G8TA 2FLRH 1O2XA 4X2XA 3RXTA 2PUQH 3G01A 1EZUC 3SNCA 1C2HA 1CT4E 3GCTG 1GMCG 2FP7B 5EXMA 3ZVFA 2P3FH 1SBWA 1NRRH 1ELFA 4UEHH 4NIXA 2ODQA 4E05H 3UNQA 5EG4A 3H7TA 1HJAC 3MU4A 2FI5E 1MKXK 4JYVH 2PKSC 3MNSA 2VH6A 1O2PA 3GCHB 4GSOA 1TA2A 4MQAA 4A92A 1HAVA 2VIVA 3QK1A 2ANWA 1EXFA 3W94A 4B2CA 2XBWA 1SGFA 4IGDA 1DLEA 2OLGA 4FUHA 3M36A 8GCHG 3FP8E 1ZRBA 1C2IA 1HAHH 1RS0A 2ZHDA 3P6ZB 5EOKA 1RIWC 2A4QA 3UPEA 3RUOA 1MAXA 1PQ5A 1WTGH 3MH6A 1MD7A 1NTPA 1GJ4H 4JYTA 3TH4H 1IQGA 4ABHA 1ZMJA 1GCTC 1O2YA 2UUJB 3SJ9A 1QL8A 3D65E 2GDEH 2ZGJA 3PV4A 3VB6A 2BDCA 1PQ7A 2DE8A 1T4UH 1RTFB 8ESTE 1D4PB 3EA9A 5A2MH 3RU4T 3TH2H 1C5LH 1THRH 4Q7XA 1TBZH 2W26A 2BY8X 1OYTH 3MI4A 4XDEA 2OP9A 1C5WB 1E36B 2K1QA 1Y3WA 2D2DA 2NU0E 1O2JA 3R3GB 1GBJA 9ESTA 3SGQE 2ASUB 3A7ZA 1FDPA 4X6NA 1AFQB 4IMZA 1XUKA 3ZVBA 3E16B 5T3HA 1O0DH 1LVOA 2AMPA 2FS9A 3BTTE 1FNIA 1EZXC 2ZFSA 4WF8A 3P95A 1AUTC 1F7ZA 4CREA 1P10A 1HB0B 2J34A 1TNLA 1YPLH 4WMEA 3E1XB 2DE9A 3K6YA 1TIOA 1OP8A 4XBCA 1BTUA 1GI5A 1DUEA 1OWDA 4FVDA 4WH8A 1OXGA 1GDNA 1UCYK 2PSXA 4GHTA 2F9VA 4MNWA 1QL7A 1SB1H 1GHAF 5EU8A 1C5RA 1P09A 4TYDA 1K22H 1S5SA 5FBIA 1WU1A 2ZGBH 3A8CA 3QTOH 1GMDF 1HGTH 3EAJA 3U98H 4KKDA 3MYWA 2C8YB 3SV2H 3PB1E 1G2MA 1V2QT 3I78A 2Q1JA 1TQ0B 2OQUA 3STJA 9LPRA 3RXFA 3DT0H 4AB9A 2ZGXH 1O3FA 1TX6A 2AEIH 4FUBA 1CO7E 5AFZH 1SLWB 2PSYA 1SHHB 2SFAA 1L4DA 3MH7A 1GCDA 2SGDE 2ZO3H 1FN8A 4ISNA 3U8TH 1EATA 1BA8B 1TRNA 1V6DA 5CE1A 1QJ7B 1W11U 1EOJA 1H8DH 2QF3A 5LPFA 1C1OA 3SZNA 2YOLA 1PYTD 4ISIH 5BRRE 4OS7A 4J1YA 1BOQA 1ANBA 4AX9H 2WV4A 3MNCA 2B0FA 1W2KH 5C5NA 1DWCH 2XCNA 4ABBA 4NA8A 4D7GA 3ZZ6A 4CHAB 1VITF 1C2KA 2FOEA 3M5MA 4VGCB 1O2TA 2BOHB 4B74A 2F3CE 4ZUHA 1CVWH 1GG6B 2ZTYA 2PHBA 1SGQE 2W7SA 3RMNH 1HAZB 4ZKRU 3SUDA 2BX3A 7ESTE 1PFXC 1W8BH 1DUAA 1KSNA 4B76A 2P8OB 5CMXH 3ATWA 4SGBE 1V2OT 1NROH 1NS3A 1ZPZA 1EAXA 5CHAB 3FP7E 1ELAA 1D6RA 3SU6A 1BMLA 1G37A 3CP7A 3QX5H 3ATKA 1Y3XA 1QFKH 1GBDA 3OX7U 1XVOA 3DFLA 4ZMAH 3S7HB 3H5CB 4F49A 1O2ZA 1WV7H 3U8OH 2THFB 2QIQA 3BV9B 1SVPA 1H8IH 2ESTE 3IITA 3ATIA 2ODPA 1DWEH 1O5AB 1GDUA 4X6MA 3TK5A 3KQCA 3SGBE 2AIQA 4RKOB 3D62A 3GCTF 1C4U2 3H7OA 2YNAA 1K9OE 1G3EA 1SOZA 1GMCF 1D3TB 1UTQA 1GBHA 3TNTA 1EB2A 1CGJE 1CE5A 4QT8C 1BIOA 2ZGHA 3SUEA 4FUJA 2V0BA 1GG6C 1AWFH 4Y8XA 2VH0A 1H1BA 5K7RA 2XC4A 5LPEA 5JBTA 5F8ZA 4DJZB 5B6OA 8GCHF 1C5PA 2B9LA 1O5FH 3P8GA 3Q3YA 3NPSA 2P8OC 3RLYH 1G3BA 1O33A 7LPRA 5JBBS 2GV7A 5DP3A 1MCTA 1KYNA 2ILNA 4DOQA 3TJNA 4IN2A 1VCPA 1L1JA 2W5EA 1DSTA 4X1SU 1WBGB 1EB1H 4U2WA 3SV7A 4UD9H 3M5LA 1UTKA 2FTLE 1O2NA 1HDTH 1QNJA 3TJUA 2JETB 1SGFG 3GY7A 5DK1A 3RXVA 1Q3XA 2GV6A 1E37B 1Y5AT 3SU4A 1QRWA 1IQMA 3O8CA 4BTTB 4YOGA 1AE8H 1K1MA 1TAWA 2WV5A 2ZFQH 3SO3A 1V3XA 2P93A 3RP2A 3ZVAA 1ZPBA 1CT2E 2GT8A 2ZCHP 3A89A 2PKAA 4INHA 1UTNA 1TLDA 5F8XA 2HWLB 1MD8A 2JH6D 1GBIA 1PPHE 2QXGA 2VWLA 2SGAA 2ZEBA 1LKBA 1YM0A 4E7RG 2HNTF 2FWWA 2G5NA 3TJVA 1TQ7B 2RA3A 3A80A 4Z0KA 4O3TA 2GMTB 1O2LA 1PPEE 2AYWA 1TMUH 1HAOH 3A7YA 5LH8A 1XM1A 1DXPA 1RXPA 3TJOA 1YCPM 3RMMH 1UJ1A 2BY9X 3MH4A 1EAIA 4JZ1A 1YKTA 4X8TH 2BDHA 3P70B 1GJ6A 3RXOA 4BAHB 2HNTC 2QXHA 3GY3A 5EXLA 1SGCA 5JDUB 1PQAA 4OS5A 1O2MA 5E0GA 7GCHG 1S82A 1J17T 3SNDA 2FOHA 1P06A 2KAIA 1EAWA 1G30B 2CHAC 2RCEA 2ZZUH 4Y7BA 3VB4A 4X6OA 1EPTC 1BCUH 4OS1A 1QIXB 1ZHPA 2ZU1A 3BTFE 1BRUP 1S81A 1LVYA 2Z7FE 4D7FA 1BTYA 4WMDA 3NCLA 1CHGA 1GJCB 3E0PB 3VGCB 1OWKA 3KF2A 2H9EH 3DFJA 3SU2A 4H4FA 2J95A 1HBTH 2EA3A 1BB0B 5JPMH 3T27A 1WOFA 2QF0A 4IN1A 2Z9KA 5FAHA 3RXRA 2HNTE 4AB8A 1AU8A 2Y82A 2J4IA 1H9IE 2ZF0H 4OGXA 1O3KA 4B75A 1DT2A 3A85A 1DSUA 2VIQA 1LKAA 1OSSA 3TU7H 1T8OA 2ZIQH 3E8LA 2A2XH 5TJXA 2F83A 3RMOH 5BPEA 1MTVA 1ZTLA 2R0KA 1FONA 1LO6A 1KTSB 1O2IA 1WYKA 4CR9A 3FZZA 4ZHAA 4U01A 2FYQA 3ITIA 5GDSH 1A1RA 4DCDA 1HV7A 8KME2 1LHCH 3ZYDA 5GCHG 5DKMA 1TGNA 5DP4A 1YPGH 2HOBA 2SNVA 2WPIS 1N6YA 3KIDU 1HIAB 2ZDLA 1KXFA 2ALVA 2IOTA 1GHBG 3NUMA 3AW0A 1GWAA 1XUFA 3KCGH 1O3GA 2FOMB 1EZSC 1ETRH 1XX9A 6ESTA 3L6PA 4FU7A 1V2PT 5E0JA 1SGDE 2P16A 3HGPA 1HJ8A 2BXUH 2PTNA 3SUFA 4LZ1H 1Z8GA 1EPTA 1P0SH 1UK2A 5A8XA 1Y3YA 1O2VA 2RG3A 3UR6A 1VCQA 3O8BA 1LPGB 3RXIA 3SNAA 5DPAA 4XBDA 3RXKA 4ABIA 3OYPA 1SGEE 2H5DA 1P9SA 3ODFA 4IC6A 2ZDAH 4RN6A 1HAPH 1TGBA 1F0TA 2C8ZB 2Z9LA 2G51A 1FAKH 1LVMA 4WVPE 1HAVB 1O3BA 1TFXA 4ZH8A 5HM2A 1AE5A 2BYAX 1SGTA 1NPMA 1O5DH 1D3DB 1DPOA 3JZ1B 1Z71A 2GGVB 1C5UA 1W0YH 2R3YA 2PLXA 1C5NH 4CBNA 3D49H 1RTKA 2UWLA 3T2NA 3RXSA 3VFEA 2ZHQH 1NU9A 1G2LA 1KLJH 3CS0A 5A8ZA 2ZTZA 1BJUA 4HI3A 3HKIB 3M61U 4FU8A 1HXEH 1XVMA 1F0UA 1ZRKA 2F9UA 4CRBA 1CT0E 3BTEE 1QTFA 1PPGE 4Y0ZE 2Z9IA 1TBQH 3TGIE 1V2KT 3SQEE 4D8NA 2TPIZ 1BBRE 4ZROA 5SGAE 3ZZ8A 1YLCA 1BHXF 1JIMA 5C67A 5A09A 3GDSA 4BNRA 3RC5A 3RM2H 1ZPCA 1QL9A 2SGQE 2ZI2H 2OBOA 2ZNKH 2M5TA 1VITG 2OC1A 3KGPA 1UTLM 2Z9GA 2BXTH 3VB3A 4JK5A 2A5KA 1HJAB 4OGYA 1L1NA 1F92A 1ELTA 2PKSB 1P05A 3LPRA 1QBVH 1ELGA 1V2TT 1ZHRA 1MQ5A 2C90B 3N7OA 4B73A 1BMAA 2TRMA 1Q31A 4THNH 3T62A 1TNIA 3Q3XA 1P2IA 1O39A 5JB9S 4TWYA 4NCYA 2JH5D 1SC8U 2XWAA 1RIWB 1P12E 3C27B 1YPHE 2ZG0H 4TY7A 1GMHG 1BRAA 1GCTB 4AG2A 4GPGA 2P95A 2F9NA 4CRDA 1NFXA 1DY8A 1E34B 3CENA 1V2WT 2ANYA 1TRMA 3FVFB 2Y81A 4GUXA 7GCHF 1IQKA 2VIWA 1FV9A 1O3PB 1OPHB 1V2RT 2PTCE 3UOUA 3SJKA 2D8WA 1OP0A 3GDVA 3HK3B 1TPOA 1Y5BT 1MH0A 1V2NT 1IHSH 1OWHA 2FI3E 3TGJE 4ZHLU 1GJ9B 5DJ7A 2IJOB 3SBKA 4KTUA 4Q7ZA 2WUCA 3FANA 1UMAH 3VB5A 1DWDH 2V35A 1ORFA 5FPTA 2O9QA 1P2OA 1GGDC 2BVXH 1QGFA 1OWIA 2A1DB 5HYOA 2O8WA 1BUIA 3GYLB 3MO9A 4FUDA 5JBCS 1W12U 1SFQB 3VEQB 4DURA 4KTSA 4XSKU 2BD8A 5E2OA 1SFIA 1BZXE 1DITH 1UHBA 2O8TA 3P92A 5J4SA 2FESH 5JBAS 3ZZ3A 1PPFE 2TGTA 1MZDA 2WPJS 2VWOA 1C1WH 2HGTH 2PW8H 5T6DA 4UDWH 1A0LA 4ZXXH 4X2VA 4AGJA 3A81A 4Y76A 3GICB 1C2EA 2PGQB 1T31A 2VIDA 3HPTB 1QRXA 2ULLA 1O2QA 3UR9A 5ABWA 1O2HA 1UCYE 1HNEE 1P2JA 3E3TA 1YF4A 2A45B 3OTJE 3PYHA 5EPYA 1A3EH 1BRBE 5GCHF 1FUJA 1UVPA 1NRNH 1OOKB 3EYDA 4RKJB 1DFPA 4K8BA 1BTHH 1Y8TA 1YPMH 1GHBF 3E91A 1PPCE 1RRKA 2EI7A 7KMEH 2OUAA 4E06H 4CH2B 3ZZBA 1O2OA 2BDYA 1ANCA 4NGAH 3MU8A 5ESBA 2QV1A 3ZVCA 2OQ5A 2VINA 3GY6A 2ZHWH 2CMYA 3ZZ9A 1WAYB 2SGEE 1BMMH 4DVAU 5FX5A 3PMBB 1FI8A 3O8RA 3Q00A 2VIOA 1HPGA 1RJXB 3PROA 3RXLA 1PPBH 3BTHE 2ZQ1A 5FPSA 2WYJA 2BQ6B 3A83A 5ETXA 1SR5C 2BQWB 3F9FA 2PR3A 1ZGIA 1H4WA 4MPXA 2CF9H 1JBUH 1MTUA 1NY22 5EQRA 1QQ4A 2BY6X 1NC6A 1F5RA 2OCVB 4X6PA 3SU5A 5F6MA 5EW2H 2BB4A 1DM4B 4MTBA 1JRSA 5C1YA 3ZVEA 1W7XH 1SPJA 1QURH 1UVOA 3MU0A 3BSQA 1W13U 1LMWB 3S9AA 4AYYB 4OS4A 2AGIX 1BJVA 2TGAA 4NWKA 1KXAA 3ZV8A 1A4WH 1LPZB 4O9VA 3M7TA 3U8RH 1C1RA 2C3SA 3A8DA 1T4VH 1BDAA 1TOMH 2BLVA 1PJPA 2H1UA 2NWNA 1CHOG 1V2VT 2XYAA 4TY6A 2GX4A 3BF6H 5E8EH 5IYTA 1MMJN 1MBQA 1KXDA 3FFGA 5EW1H 2UUFB 4ABGA 2PKAB 3KL6A 4I8LA 1GJ5H 1AO5A 2GCTC 4FUCA 1AB9C 1QA7A 4KGAA 1U6QA 3DUXH 1JOUB 3SNEA 1SQTA 3GCOA 1O32A 1T32A 3RXGA 2Z94A 2D1JA 3V0XA 4FU9A 1HJ9A 4LZ4B 2QXIA 3LONA 1BQYA 1C4V2 1THSH 4DIIH 1KXBA 1K1IA 1C5QA 3RXMA 3DA9B 4BXSA 1P2QA 5ESTE 3SGAE 2Q6FA 1ZMNA 4I32A 2ZKSA 3RXDA 4H6SB 2B8OH 3VXEH 4ZKSU 1TPAE 1A0HB 1JWTA 1HAXB 4E7NA 3UWJH 3ZV9A 5A0BA 4HFPB 2A2QH 4GLYA 1GMHF 1J16A 2H9HA 1BMNH 1BTZA 2V3OH 1UK4A 3RXQA 1MU6B 1ANDA 1O5GH 1FIWA 4FVBA 3PMHB 3B23B 2R3UA 1E38B 1ABIH 2BY7X 2KAIB 2WYGA 1A5IA 4Y8ZA 5C20A 1SI5H 3RLWH 1AQ7A 1O2UA 2UWPA 2O8LA 3URDA 1FY8E 5C1XA 3Q76A 3UQOA 1VZQH 1S85A 2WPHS 3AAVA 2XC0A 2G5VA 2R2WU 5T6GA 3RC4A 1DVAH 1KXCA 2QAAA 4HTCH 2ZCLP 3SN8A 1QB1A 4MNXA 4X1QU 5EQQA 1F5LA 4I8JA 1AKSB 2ZWLH 3S0NA 3SOSA 4I8HA 1QB9A 2Y5HA 1KY9A 3P8OA 1MCVA 1O36A 4ABDA 1NRPH 3PTBA 3UOPA 1GBFA 3ZZCA 3TIUA 3T29A 2SGFE 1ELDE 1IQLA 2ZU4A 4U32A 1C1SA 1P01A 2LPRA 2OC0A 1OKXA 3TGKE 4WMFA 3M37A 1GI2A 4IW4E 4Y0YE 1ZSKA 2ZP0H 4K8YA 1XUJA 1GVKB 1GBLA 2O8UA 2J9NA 1O3IA 2G00A 2Z3CA 1KDQB 5I46H 1SLVB 1GHZA 5DG6A 3LJJA 1C4Y2 2BVSH 1SGYE 2C4FH 1D3QB 2XWBI 1QY6A 3RU4D 3L33A 1GBBA 1OWEA 4GCHG 1O3EA 1LQEA 2QGRA 2TGDA 1QJ1B 3ZYEA 1MTWA 4Y10E 2CHAB 4AGKA 3D23A 4O3UA 4K60A 3OY6U 1F0RA 1EPTB 1K28D 1Z1IA 3RXHA 3AAUA 2FYRA 3ATMA 2OC7A 1CQQA 1SSXA 5DP9A 2A5IA 4ZXYH 2ZPQA 1G36A 2P94A 3RM0H 3VB7A 3M3TA 5JYIA 1JMOH 5EXNA 2AH4X 2FOCA 4GHQA 3LGIA 3EGKH 5E2PA 3MO6A 2TBSA 4AFSA 5LPRA 4NWLA 1ZHMA 2TGPZ 4WH6A 1GJDB 2BDAA 1THPB 2G4TA 5A8YA 1G32B 1OS8A 3E6PH 2AMQA 2Z3DA 3Q3KA 4IC5A 2XRCA 2XCFA 1O5EH 4ZKOU 2A0QB 1RFNA 3A7TA 2GD4B 2OTVA 2B5TB 2ZU5A 3PLKA 4UONA 4CBOA 2Q6DA 3ODDA 1BBRH 1FAXA 3ATLA 4NIVA 5DGJA 4NA9H 5FCKA 1TABE 2Z6BD 1LDTT 1C1QA 1GI6A 1SL3A 1TGCA 2Y80A 4A1XA 4WJG2 2QN5T 1P57B 1Y59T 1LVBA 2ZHEH 2GZ9A 1Z1JA 4WWYA 1NFWA 4B2BA 1AGJA 5DP6A 1INCA 1EP5A 2FS8A 1A5GH 3A82A 2AGEX 1MU8B 3UQVA 2WUBA 1ZZZA 2Y5FA 4WXVA 2W7UA 5AF9H 1IQIA 3LH1A 1S6HA 1SOTA 1B7XB 4D76A 2UUYA 1CHOF 2FIRH 3MO3A 3V12A 1KTTB 1ZSLA 1TGSZ 2BMGB 1TBRH 1SGPE 4AFQA 5FXLA 1P8VC 1TMTH 2HPQH 2ZHFH 1XXFA 4ABFA 6CHAB 1GDQA 4ABEA 3MHWU 1T8NA 2F9OA 3SQHE 1C5SA 4O97A 4XFQA 3EA7A 1IQNA 3SV8A 3P8NA 1C1UH 1IQHA 4UFGH 5DP8A 4AG1A 2H9TH 2VGCC 5EODA 4CR5A 2QC2A 4IS5A 3KN2A 3PM3A 2ZPSA 3RU4E 3NZIA 3TNSA 3R0FA 1MQ6A 1C1MA 3LGWA 1O2KA 1O38A 5C1UA 1GHYH 5HGGA 4CRAA 5C2ZA 1YPJH 2FX4A 1FJSA 4X1NU 3MU5A 1SLUB 1YGCH 1ELBA 3FAOA 3KQDA 5L2ZH 2G4UA 1A2CH 1K1OA 3BG8A 4OS2A 1GJ8B 1SGNE 3GY4A 4YOJA 1HCGA 4MPVA 2ZTXA 4BANB 4DY7B 3PLPA 2BD5A 5HXFA 3PMAB 4XBBA 4KTCA 5K0HA 1W7GH 1S0RA 3NWUA 5EPNA 4K1SA 5GPIB 4NIWA 2AGGX 5H4IB 2AS9A 1QB6A 3V7TA 2CXVA 3UUZA 1UCYH 5DP7A 6CHAC 2J2UA 1LHEH 3LC5A 1O3CA 4AFZA 1YC0A 1L1GA 1UHBB 2FEQH 4Y6DA 4Y71A 1TONA 3RXJA 1O3NA 3SW2B 3UY9A 1N8OC 1TMBH 2V6NA 3UREA 1O3HA 3EA8A 1V2LT 2Z9JA 2FOGA 1BHXB 3PO1C 3BEIB 2BLWA 1KLTA 4IMQA 2PFEA 1AUJA 3M7UA 3LGUA 1LTOA 2JKHA 3A8BA 3TK6A 1UO6A 2ODYB 3TLOA 3ZVGA 4NSYA 4AN7A 1QBOA 1DE7H 4TPYA 4MNVA 5F03A 4DW2U 2G52A 1LHDH 3FP6E 4B1TA 1O3LA 3BG4C 1NFUA 1F0SA 4MPUA 1AZ8A 4ABJA 4BAQB 2ZQ2A 3TPIZ 1V2UT 1FY3A 1NZQH 2GCHG 3KQEA 4GCHF 2C8WB 1DICA 2FM2A 3T28A 2HVXA 2VB0A 3SORA 4FUIA 5L2YH 4AFUA 1SHYA 2BZAA 1CA0B 1LCYA 1W10U 3GDUA 4NG9H 1MBMA 2BD2A 3PTNA 3SI3H 2D26C 2FOFA 1CGHA 3LGVA 1TPPA 1O3JA 1BT7A 1GGDB 3F6UH 4HGCA 3VPKA 3STIA 3LDXH 3LGYA 4O03A 2GDDA 4AOQA 3EDXB 1DOJA 1C9TA 4BAMB 1NT1A 5G4BA 5IDKA 5I25A 2OBQA 1T8LA 3QN7A 2A4RA 1XUGA 1WQVH 1AZZA 1S0QA 2A7CA 1GJAB 2ZFFH 3T26A 5GJ4B 1GBMA 1L0ZA 4H6TA 4MG3A 2FDAA 5FHTA 3MOCA 1A5HA 1B5GH 4NFFA 1ZTJA 1SQOA 2A4GA 2XNIA 1MUEB 2HRVA 1O37A 1ZOMA 4A7IB 1OWJA 1AHTH 1C5TA 1VR1H 2AFQB 2FPZA 1QCPA 3BTWE 3GISB 1GI0A 1LPKB 1YYY1 2BD4A 1IQEA 3RXUA 4Z6AH 1DS2E 1YCPH 1CA0C 3EE0B 2BDGA 1C2FA 1MTNC 1WSSH 2P3TB 3UWIA 2GTBA 1IQFA 4ISHH 1CGIE 3F1SB 3TITA 3URCA 2QCYA 1UTJA 2H5CA 2FLBH 5T6FA 4JK6A 3U69H 1GBEA 2F9PA 3BTDE 2STAE 1OYQA 4UE7H 1ESTA 1E0FD 1IAUA 1GI1A 1OP2A 1EJAA 2XXLA 1ID5H 1NU7B 4YTAA 1J15A 1G3CA 3Q77A 1GVLA 3ZZAA 4BTIB 4I33A 3LH3A 1KLIH 4FUGA 3ZZ4A 4Q2KA 2XW9A 4UFFH 1O3MA 3SI4H 1AIXH 1GBCA 4LXBH 1ZJDA 3K9XB 3MTYA 1VGCB 3OY5U 1CSOE 1O5BB 1A3BH 1ZGVA 2ZA5A 1JIRA 4DT7B 1O2GH 2ZFRH 1O2SA 2ALPA 1ZMLA 2VVCA 4MNYA 3PLBA 4YT6H 1DWBH 1VITH 1NFYA 3S9BA 2BD3A 1S6FA 4YZUA 5DP5A 1HRTH 3SHCH 3MMGA 3LT3A 3TK9A 1TNHA 4XE4A 1HAGE 1QR3E 4Y79A 1C5YB 5LGOA 1D3PB 1F2SE 3SHAH 1BTPA 1V2JT 1GL1A 2SGPE 2Y6TA 4FUEA 1EUFA 4K3JA 1O31A 5F8TA 4I7YH 1G9IE 1K21H 2A32A 1RGQA 3F9GA 4BAKB 1NO9H 1O34A 4X8VH 3HGNA 3BTKE 1H9LB 1HXFH 1FQ3A 2VU8E 2UUKB 1ETSH 8LPRA 3UNRA 1FLEE 1SMFE 3P8FA 2GCTB 2CV3A 1AWHB 2XBYA 1T8MA 1AB9B 1EJNA 1YP9A 3M3SA 1O2RA 4B71A 2CN0H 1HFDA 3L3TA 2F91A 1C2LA 1E35B 1YPEH 4JMYA 4KP0A 2BTCE 1S83A 3ZZ7A 3RXCA 2FODA 2YNBA 2QXJA 1CU1A 3PWCA 1SGIB 4I8GA 1P2MA 2FMJA 4AYVB 1VGCC 2BDBA 4X8SH 1IHTH 4DIHH 2A7HA 2VWMA 4K1EA 1ELCA 3GCHC 3CS7A 1V2MT 1AFEH 1B0EA 1GHVH 3SNBA 3LC3A 1ESAA 1UTMA 1SGRE 2Y5GA 2Y7XA 2ZDMA 4K2YA 3RDZA 1TPSA 2PWXA 2LNCA 1N6XA 2NU3E 2AIPA 2AERH 3OU0A 1P11E 2STBE 4FXGH 2GCHF 1RD3B 1TNJA 3QDZB 1MZAA 2GZ8A 3GOVB 1Y3VA 2WPMS 1FMGA 3F68H 4JCNA 1FPHH 3UNSA 1O3AA 3QZQA 1C5MD 1H9HE 1BTXA 5E0HA 2FXRA 4SGAE 1KIGH 3SUGA 2FO9A 3TVJB 1AFQC 1C5ZB 1SLXB 4BTUB 2ZPRA 1P2NA 1XUIA 1Z6EA 4FUFA 3SU3A 1Z6JH 2OINA 1C2MA 2EI8A 3MNBA 2I6QA 1GL0E 4CRFA 2ZDKA 3HK6B 3RXBA 5EQSA 1Z8RA 5L6NH 4YM9A 2ZGCA 2OC8A 3P17H 1TNKA 1W3CA 1FN6A 4D9RA 4Y7AA 2Y7ZA 1O30A 4CRGA
chains in the Genus database with same CATH superfamily
2ANKH 2J98A 3GY2A 1P04A 4AORA 2ZECA 1QQUA 3BEFB 3K6ZA 4TPIZ 2BLOA 1J14A 4XOJA 1GI9B 3OFND 4CH8B 4YT7H 3LIWA 3QO6A 1FY1A 1O3DA 2NU1E 3B8JA 1K1NA 1EZQA 1Z8JB 4I31A 3F9EA 3RMLH 1A61H 1UVTH 2VVUA 1TALA 4BAOB 2VWNA 3OSYA 3KNXA 1TYNA 4JZDH 3KQ5A 3M5NA 1ABJH 2LP6A 4ASHA 1P9UA 3A86A 3GY8A 1WCZA 2JH0D 2A5AA 1EP6A 5JB8S 4J2YB 3BIUH 2J94A 4OS6A 1YLDA 3ZZ5A 5AFYH 2IPHA 1GHXH 2WINI 5TCAA 2GVFA 2P3UB 3F9HA 1Y5UT 2AMDA 4RT1A 3QZRA 1FY4A 5HIYA 4K69A 1LQDB 1P02A 4JZFH 4Y11E 1YCPK 1QHRB 2F9BH 4AZ2B 3VXFH 3T25A 3KQBA 4BXWA 1PYTC 1E1RD 3AW1A 1EJMA 2IJD1 1WTHD 1SG8B 1UTPA 4CHAC 1GHWH 1Q2WA 1WQSA 1AY6H 4HZHA 1ETTH 4VGCC 1DY9A 2V7QD 1TGTA 1ACBE 2OXSA 2H2ZA 2V3MA 3A7XA 1GJBB 3M5OA 1UVUH 2V3HH 3IWMA 3MWIU 3GYMA 2BHGA 1TNGA 4ESTE 2KFWA 1O5CB 5A0CA 4INKA 2XBXA 1CBWB 1QA0A 2SNWA 3JZ2B 1TB6H 4X0WU 5CHAC 1GI8B 3U9AH 3GCNA 3U1JB 3ZZDA 4X1PU 2A4OA 2ANMH 2RA0A 1LHGH 5GIBA 1DLKB 3NKKA 1S6LA 1TRYA 2C93B 3RXPA 2FOAA 1C2JA 3I29A 1AVWA 2PUXB 1AD8H 1W0ZU 2G55A 1J8AA 2ZDVH 3LU9B 2GP9B 3UIRA 1CA8B 3QGNB 2DUCA 2BD9A 2ZU2A 3KEEA 1NN6A 1AMHA 1XXDA 5KECA 2VGCB 1C5OH 1MKWH 1MTSA 3K2UA 1FIZA 5TCCA 1AI8H 1L2EA 5AVDA 3NXPA 4A6LA 4B2AA 3V3MA 3AASA 2CJIA 2ZC9H 1P2KA 5PTPA 4DGJA 4X2YA 4R0IA 3K65B 4MDSA 1EQ9A 1GBTA 1FXYA 4A1TA 3U1IB 1O2WA 2XOKD 3M7QA 2ZFPH 1CBWC 5FBEA 1QZ8A 1EKBB 2FZZA 6GCHG 2BM2A 1A7SA 3M3VA 3TH3H 1FY5A 2FI4E 2A31A 5EJLA 5GWZA 1D6WA 4Y8YA 1C1TA 1GBKA 4ISOA 1N1LA 3DD2H 3QWCH 1HYLA 5FPYA 1TX7A 2PV9B 3PMJA 4PROA 2J92A 1MKXH 3NK8A 1B0FA 1DDJA 1BTWA 1E1QD 2JETC 1NRSH 2J38A 2UWOA 1ARCA 3BEUA 3S9CA 4GAWA 1L4ZA 3UFAA 5A0AE 1XKAC 1M9UA 1HAIH 1O35A 2FOBA 2IN2A 1A46H 4DG4A 2P59A 3RXAA 2G81E 4OM9A 1Z7KA 3UTUH 1UTOA 2EI6A 3SV9A 1WUNH 1N8OB 1LHFH 3SYJA 2WHXA 1BRCE 3A8AA 1ZJKA 1JXPA 2BX4A 1K2I1 1ZLRA 4JZEH 5C3NA 1AKSA 2BD7A 3PO1B 2ZFTA 2Q6GA 3N7DA 2TIOA 3QTVH 5DO4H 5AHGH 5FX6A 4YLQH 4YOIA 4GVUA 1KMHB 1GBAA 2Z3EA 4YO9A 3WY8A 2RFKC 2B7DH 3PWBA 4I8KA 3U28C 2CGAA 4INLA 2GMTC 4DT4A 4NIYA 1TA6A 1TOCB 1FZZA 1KXEA 3IG6B 2BY5X 1GVZA 3BTGE 5HMAA 3SU0A 3N7EA 3AVZA 1NBMD 1EX3A 2BVRH 2C8XB 1AVXA 2HPPH 3BG4B 1OX1A 3MFJA 4JYUH 1RTLA 3A84A 4YXWD 1YBWA 4ISLA 5C5OA 1JRTA 2NU4E 2VIPA 1KDQA 3WWBA 1V2ST 1QRZA 3E0NB 2GZ7A 1T7CA 2CK3D 3UB0A 4D9QA 3HKJB 5L30H 1C5XB 2ZDNA 1F5KU 2A7JA 1GI3A 4ABAA 2RDLA 4M7GA 1C9PA 4RSPA 1DXWA 2R9PA 2H6MA 3LOXA 4X1RU 3ZVDA 1GI7B 1S84A 2BLQA 3A88A 1TX8A 4NSVA 3RC6A 1K1PA 4JZIA 1IOEA 2NU2E 1O3OA 3VGCC 1D9IA 3SJOA 4A1VA 3SJ8A 4IBLH 2GT7A 1EAUA 3HATH 3RXEA 3O8DA 1K1LA 4MVNA 2VVVA 4K1TA 4TWWA 2HALA 1PPZA 1C2DA 2QY0B 1TE0A 3T5FH 1AVGH 1DANH 1GHAG 1BITA 1P3CA 1EOLA 2WV9A 3B9FH 3QGJA 3W95A 1K0HA 2WPKS 1PQ8A 5C17A 2KM0A 3E90B 3LGTA 3BTQE 5GXPA 3M35A 4YLUA 2GKVE 1GMDG 1XKBC 3QLPH 1ANEA 2QA9E 4NZLA 5HIZA 1UW7A 1ZYOA 2FTMA 3QUMP 2KCYA 2W3KA 2XC5A 1ELEE 4U30A 3MNXA 2WPLS 2I6SA 4X8UH 5HM9A 1GPZA 3EQ0H 1MTNB 3FN8A 2EEKA 6LPRA 1H8HD 3S7KB 1IQJA 1P03A 4ZCNA 3SV6A 1A0JA 2EC9H 4NFEA 2O8MA 3LKWA 2BOKA 1Z8IB 3LJOA 1XUHA 2W3IA 4F4OC 3MU1A 4CRCA 1GJ7B 3SJIA 1C2GA 3GY5A 4BOHA 2K8IA 3ESTA 1C5VA 1YPHC 1YPKH 1GI4A 1HAYB 2BQ7B 2VJ1A 1MAYA 1K1JA 4MLFB 4A5TS 1ZTKA 1NBME 3I77A 1ARBA 1DX5M 4X2WA 2VNTA 1NM6A 1C1PA 1VCWA 1ZSJA 2QYIA 3BTME 4LOYH 2BDIA 4KELA 4YESB 1HLTH 5IK2D 2PGBB 2HLCA 4WY3A 2XTTB 1ESBA 4ZAEA 3BN9A 1UVSH 1AN1E 1UK3A 3F3BA 3MH5A 1C1VH 1ZR0A 3KHVA 4UFDH 3A7WA 3BIVH 1Y3UA 1YWUA 4MPWA 5FCRA 2KCPA 4H42U 1VJAU 3DHKH 1HUTH 2WPDD 1C1NA 1SQAA 6GCHF 1MKWK 3C1KA 5J4QA 4ZKNU 2BZ6H 2R2MB 1VJ9U 2CF8H 5EGMA 2ZCKP 4UFEH 1QBNA 2ZU3A 1NESE 1QJ6B 1BBRK 4Q80A 1ELVA 4ZHMU 4NA7A 3A7VA 4LK4A 3ELAH 1J9CH 1HIAA 1W14U 1G3DA 2OD3B 4NZQA 1FPCH 3ENSB 3V13A 3FZDA 4B6FA 1EASA 1TWXB 4M9FA 4Q7YA 4R8TB 3S69A 1P3EA 2FX6A 3SU1A 4K5ZA 2R0LA 3A87A 1XMNB 1NRQH 2XBVA 1X7AC 4WXIA 2G8TA 2FLRH 1O2XA 4X2XA 3RXTA 2PUQH 3G01A 1EZUC 3SNCA 1C2HA 1CT4E 3GCTG 1GMCG 3OEHD 2FP7B 5EXMA 3ZVFA 2P3FH 2J98B 1SBWA 1NRRH 1ELFA 4UEHH 4NIXA 2ODQA 4E05H 3UNQA 5EG4A 3H7TA 1HJAC 3MU4A 2FI5E 1MKXK 4JYVH 2PKSC 3MNSA 2VH6A 1O2PA 3GCHB 4GSOA 1TA2A 4MQAA 4A92A 1HAVA 2VIVA 3QK1A 2ANWA 1EXFA 3W94A 4B2CA 2XBWA 1SGFA 4IGDA 1DLEA 2OLGA 4FUHA 3M36A 8GCHG 3FP8E 1ZRBA 1C2IA 1HAHH 1RS0A 2ZHDA 3P6ZB 5EOKA 1RIWC 2A4QA 3UPEA 3RUOA 1MAXA 1PQ5A 4FETA 1WTGH 3MH6A 1MD7A 1NTPA 1GJ4H 4JYTA 3TH4H 1IQGA 4ABHA 1ZMJA 1GCTC 1O2YA 2UUJB 3SJ9A 1QL8A 3D65E 2GDEH 2ZGJA 3PV4A 3VB6A 2BDCA 1PQ7A 2DE8A 1T4UH 1RTFB 2GJGA 1D4PB 3EA9A 5A2MH 4RI0A 3RU4T 3TH2H 1C5LH 1THRH 4Q7XA 1TBZH 2W26A 2BY8X 1OYTH 3MI4A 4XDEA 2OP9A 1C5WB 1E36B 2K1QA 1Y3WA 2D2DA 2NU0E 1O2JA 3R3GB 1GBJA 9ESTA 3SGQE 2ASUB 3A7ZA 1FDPA 4X6NA 1AFQB 4IMZA 1XUKA 2JIZD 3ZVBA 3E16B 5T3HA 1O0DH 1LVOA 2AMPA 2FS9A 3BTTE 1FNIA 1EZXC 2ZFSA 4WF8A 3P95A 1AUTC 1F7ZA 4CREA 1P10A 1HB0B 2J34A 1TNLA 1YPLH 4WMEA 3E1XB 2DE9A 3K6YA 1TIOA 1OP8A 4XBCA 1BTUA 5EIYA 1GI5A 1DUEA 1OWDA 4FVDA 3F2GA 4WH8A 1OXGA 1GDNA 1UCYK 2PSXA 4GHTA 2F9VA 4MNWA 1QL7A 1SB1H 1GHAF 5EU8A 1C5RA 1P09A 4Q63A 4TYDA 5CDFE 1K22H 1S5SA 5FBIA 1WU1A 2ZGBH 3A8CA 3QTOH 1GMDF 1HGTH 3EAJA 3U98H 4KKDA 3MYWA 2C8YB 3SV2H 3PB1E 1G2MA 1V2QT 3I78A 2Q1JA 1TQ0B 2OQUA 3STJA 9LPRA 3RXFA 3DT0H 4AB9A 2ZGXH 2RDEA 1O3FA 1TX6A 2AEIH 4FUBA 1CO7E 5AFZH 1SLWB 2PSYA 1SHHB 2KR7A 2SFAA 1L4DA 3MH7A 1GCDA 2SGDE 2ZO3H 1FN8A 4ISNA 3U8TH 1EATA 1BA8B 1TRNA 1V6DA 5CE1A 1QJ7B 1W11U 1EOJA 1H8DH 2QF3A 5LPFA 1C1OA 3SZNA 2YOLA 1PYTD 4ISIH 5BRRE 4OS7A 4J1YA 1BOQA 1ANBA 4AX9H 2WV4A 3MNCA 2B0FA 1W2KH 5C5NA 1DWCH 2XCNA 4ABBA 3FOAA 4NA8A 4D7GA 3ZZ6A 4CHAB 3DSGA 1VITF 1C2KA 2FOEA 3M5MA 4VGCB 1O2TA 2BOHB 4B74A 2VBCA 2F3CE 3WWFA 4ZUHA 1CVWH 1GG6B 2ZTYA 2PHBA 1SGQE 2W7SA 3RMNH 1HAZB 4ZKRU 3SUDA 2BX3A 7ESTE 1PFXC 1W8BH 1DUAA 1KSNA 4B76A 2P8OB 5CMXH 3ATWA 4SGBE 1V2OT 1NROH 1NS3A 1ZPZA 1EAXA 5CHAB 3FP7E 1ELAA 1D6RA 3SU6A 1BMLA 1G37A 3CP7A 3QX5H 3ATKA 1Y3XA 1QFKH 1GBDA 3OX7U 1XVOA 3DFLA 4ZMAH 3S7HB 3H5CB 4F49A 1O2ZA 1WV7H 3U8OH 2THFB 2QIQA 3BV9B 1SVPA 2HLDD 1H8IH 2ESTE 3IITA 3ATIA 2ODPA 1DWEH 1O5AB 1GDUA 4X6MA 3TK5A 3KQCA 3SGBE 2F4LA 2AIQA 4RKOB 3D62A 3GCTF 1C4U2 3H7OA 2QE7D 1K9OE 1G3EA 2YNAA 1SOZA 1GMCF 1D3TB 1UTQA 1GBHA 3TNTA 5B6LA 1EB2A 1CGJE 1CE5A 4QT8C 1BIOA 2ZGHA 3SUEA 4FUJA 2V0BA 1GG6C 1AWFH 4Y8XA 2VH0A 1H1BA 5K7RA 2XC4A 5LPEA 5JBTA 5F8ZA 4DJZB 5B6OA 4I86A 8GCHF 1C5PA 2B9LA 1O5FH 3P8GA 3Q3YA 3NPSA 2P8OC 3RLYH 1G3BA 1O33A 7LPRA 5JBBS 2GV7A 5DP3A 1MCTA 1KYNA 2ILNA 4DOQA 3TJNA 4IN2A 1VCPA 1L1JA 2W5EA 1DSTA 3PV5A 4X1SU 1WBGB 1WDIA 1EB1H 4U2WA 3SV7A 5DN6D 4UD9H 3M5LA 2HVYB 1UTKA 2FTLE 1O2NA 1HDTH 1QNJA 3TJUA 2JETB 1SGFG 3GY7A 5DK1A 3RXVA 1Q3XA 2GV6A 3AK5A 1E37B 1Y5AT 3SU4A 1QRWA 1FX0B 1IQMA 3O8CA 4BTTB 4YOGA 1AE8H 1K1MA 1TAWA 2WV5A 2ZFQH 3SO3A 1V3XA 2P93A 3RP2A 3ZVAA 1ZPBA 1CT2E 2GT8A 2ZCHP 3A89A 2PKAA 4INHA 1UTNA 1TLDA 5F8XA 2HWLB 1MD8A 2JH6D 1GBIA 1PPHE 2QXGA 2VWLA 2SGAA 2ZEBA 1OHHD 1LKBA 1YM0A 4E7RG 2HNTF 2FWWA 2G5NA 3TJVA 1TQ7B 2RA3A 3A80A 4Z0KA 4O3TA 2GMTB 1O2LA 1PPEE 2AYWA 1TMUH 1HAOH 3A7YA 5LH8A 1XM1A 1DXPA 1RXPA 3TJOA 1YCPM 3RMMH 1UJ1A 2BY9X 3MH4A 1EAIA 4JZ1A 1YKTA 4X8TH 2BDHA 3P70B 1GJ6A 3RXOA 4BAHB 2HNTC 2QXHA 3GY3A 5EXLA 1SGCA 5JDUB 1PQAA 4OS5A 2K0QA 1O2MA 5E0GA 7GCHG 1S82A 1J17T 3SNDA 2FOHA 1P06A 2KAIA 1EAWA 1G30B 2CHAC 2RCEA 2ZZUH 4Y7BA 5CHBA 3VB4A 4X6OA 1EPTC 1BCUH 4OS1A 1QIXB 1ZHPA 2ZU1A 3BTFE 1BRUP 1S81A 1LVYA 2Z7FE 4D7FA 1BTYA 4WMDA 3NCLA 1CHGA 1GJCB 3E0PB 3VGCB 1OWKA 3KF2A 2H9EH 3DFJA 3SU2A 4H4FA 2J95A 1HBTH 2EA3A 1BB0B 5JPMH 3T27A 1WOFA 2QF0A 4IN1A 2Z9KA 5FAHA 3RXRA 2HNTE 4AB8A 1AU8A 2EY4C 2Y82A 2J4IA 1H9IE 2ZF0H 4OGXA 1O3KA 4B75A 1DT2A 3A85A 1DSUA 2VIQA 1LKAA 1OSSA 3TU7H 1T8OA 2ZIQH 3E8LA 2A2XH 5TJXA 2F83A 3RMOH 5BPEA 1MTVA 1ZTLA 2R0KA 1FONA 1LO6A 1KTSB 1O2IA 1WYKA 4CR9A 2XNDD 3FZZA 4ZHAA 4U01A 2FYQA 3ITIA 5GDSH 1A1RA 4DCDA 1HV7A 8KME2 1LHCH 3ZYDA 5GCHG 5DKMA 1TGNA 5DP4A 1YPGH 2HOBA 2SNVA 2WPIS 1N6YA 3KIDU 1HIAB 2ZDLA 1KXFA 3NRLA 2ALVA 2IOTA 5C94A 1GHBG 3NUMA 3OE7D 3AW0A 1GWAA 1XUFA 3KCGH 1O3GA 1YLNA 2FOMB 1EZSC 1ETRH 1XX9A 6ESTA 3L6PA 4FU7A 1V2PT 5E0JA 1SGDE 2P16A 3HGPA 1HJ8A 2BXUH 2PTNA 3SUFA 4LZ1H 1Z8GA 1EPTA 1P0SH 1UK2A 5A8XA 1Y3YA 1O2VA 2M2AA 2RG3A 3UR6A 5KEDA 1VCQA 3O8BA 1LPGB 3RXIA 3SNAA 5DPAA 4XBDA 3RXKA 4ABIA 3OYPA 1SGEE 2H5DA 1P9SA 3ODFA 4IC6A 2ZDAH 4RN6A 1HAPH 1TGBA 1F0TA 2C8ZB 2Z9LA 2G51A 1FAKH 1LVMA 4WVPE 1HAVB 1O3BA 1TFXA 4ZH8A 5HM2A 1AE5A 2BYAX 1SGTA 1NPMA 1O5DH 1D3DB 1DPOA 3JZ1B 1Z71A 2GGVB 1C5UA 1W0YH 3EE7A 2R3YA 2PLXA 1C5NH 4CBNA 3D49H 1RTKA 2UWLA 3T2NA 3RXSA 3VFEA 2ZHQH 1NU9A 1G2LA 1KLJH 3CS0A 5A8ZA 2ZTZA 1BJUA 4HI3A 2KZ4A 3HKIB 3M61U 4FU8A 4F55A 1HXEH 1XVMA 2YMSC 2J97A 1F0UA 1ZRKA 2F9UA 4CRBA 1CT0E 3BTEE 1QTFA 1PPGE 4Y0ZE 2Z9IA 1TBQH 3TGIE 1V2KT 3SQEE 4D8NA 2TPIZ 1BBRE 4ZROA 5SGAE 3ZZ8A 1YLCA 1BHXF 1JIMA 5C67A 5A09A 3GDSA 4BNRA 3RC5A 3RM2H 1ZPCA 1QL9A 2SGQE 2ZI2H 2L6OA 2OBOA 2ZNKH 4ACAA 2M5TA 1VITG 2OC1A 3KGPA 1UTLM 2Z9GA 2BXTH 3VB3A 4JK5A 2A5KA 1HJAB 4OGYA 1L1NA 1F92A 1ELTA 2PKSB 1P05A 3LPRA 1QBVH 3OTPA 1ELGA 1V2TT 1ZHRA 1MQ5A 2C90B 3N7OA 4B73A 4ASUD 1BMAA 2TRMA 1Q31A 4THNH 3T62A 1TNIA 3Q3XA 1P2IA 1O39A 5JB9S 4TWYA 4NCYA 2JH5D 1SC8U 2XWAA 1RIWB 1P12E 3C27B 1YPHE 2ZG0H 4TY7A 1GMHG 1BRAA 1GCTB 4AG2A 2KX4A 4GPGA 2P95A 2F9NA 2PP6A 4CRDA 1NFXA 1DY8A 2F43B 1E34B 3CENA 1V2WT 2ANYA 1TRMA 3FVFB 2W6ID 2Y81A 4GUXA 1WXRA 7GCHF 1IQKA 2VIWA 1FV9A 1O3PB 1OPHB 1V2RT 2PTCE 3UOUA 3SJKA 2D8WA 1OP0A 3GDVA 3HK3B 1TPOA 1Y5BT 1MH0A 1V2NT 1IHSH 1OWHA 2FI3E 3TGJE 3KYFA 4ZHLU 1GJ9B 5DJ7A 2IJOB 3SBKA 4KTUA 4Q7ZA 2WUCA 3FANA 1UMAH 3VB5A 1DWDH 2V35A 1ORFA 5FPTA 2O9QA 1P2OA 1GGDC 2BVXH 1QGFA 1OWIA 2A1DB 5HYOA 2O8WA 1BUIA 3GYLB 3MO9A 4FUDA 5JBCS 1W12U 1SFQB 3VEQB 4DURA 4KTSA 4XSKU 2BD8A 5E2OA 1SFIA 1BZXE 1DITH 1UHBA 2O8TA 3P92A 5J4SA 2FESH 5JBAS 3ZZ3A 8ESTE 1PPFE 2TGTA 1MZDA 2WPJS 2VWOA 1C1WH 2HGTH 2PW8H 5T6DA 4UDWH 1A0LA 4ZXXH 4X2VA 4AGJA 3A81A 4Y76A 3GICB 1C2EA 2PGQB 1T31A 2VIDA 3HPTB 1QRXA 2ULLA 1O2QA 3UR9A 5ABWA 1O2HA 1UCYE 1HNEE 1P2JA 3E3TA 1YF4A 2A45B 3OTJE 3PYHA 5EPYA 1A3EH 1BRBE 5GCHF 1FUJA 1UVPA 1NRNH 1OOKB 3EYDA 4RKJB 1DFPA 4K8BA 1BTHH 1Y8TA 1YPMH 3ZIAD 1GHBF 3E91A 1PPCE 1RRKA 2EI7A 7KMEH 2OUAA 4E06H 4CH2B 3ZZBA 1O2OA 2BDYA 1ANCA 4NGAH 3MU8A 5ESBA 2QV1A 3ZVCA 2OQ5A 2VINA 3GY6A 2ZHWH 2KCAA 2CMYA 3ZZ9A 1WAYB 2SGEE 1BMMH 4DVAU 5FX5A 3PMBB 1W0JD 1FI8A 3O8RA 3Q00A 2VIOA 1HPGA 3PV2A 1RJXB 3PROA 3RXLA 1PPBH 3BTHE 2ZQ1A 5FPSA 2WYJA 1W0KD 2BQ6B 5T1VA 3A83A 5ETXA 1SR5C 2BQWB 3F9FA 2PR3A 1ZGIA 1H4WA 4MPXA 2CF9H 1JBUH 4B6EA 1MTUA 1NY22 5EQRA 1QQ4A 2BY6X 1NC6A 1F5RA 2OCVB 4X6PA 3SU5A 5F6MA 5EW2H 2BB4A 1DM4B 4MTBA 1JRSA 5C1YA 3ZVEA 1W7XH 1SPJA 1QURH 1UVOA 3MU0A 3BSQA 1W13U 1LMWB 3S9AA 4AYYB 4OS4A 2AGIX 1BJVA 2TGAA 4NWKA 1KXAA 3ZV8A 1A4WH 1LPZB 4O9VA 3M7TA 5C0TA 2EQNA 3U8RH 1C1RA 2C3SA 3A8DA 5EJ1A 1T4VH 1BDAA 1TOMH 4AC9A 2BLVA 1PJPA 2H1UA 2NWNA 1CHOG 1V2VT 2XYAA 4TY6A 2GX4A 3BF6H 5E8EH 5IYTA 1MMJN 1MBQA 1KXDA 3FFGA 5EW1H 2UUFB 4ABGA 2PKAB 3KL6A 4I8LA 1GJ5H 1AO5A 2GCTC 4FUCA 1AB9C 1EFRD 1QA7A 4KGAA 1U6QA 3DUXH 1JOUB 3SNEA 1SQTA 3GCOA 1O32A 1T32A 3RXGA 2Z94A 2D1JA 3V0XA 4FU9A 1HJ9A 4LZ4B 2JJ2D 2QXIA 3LONA 1BQYA 1C4V2 1THSH 4DIIH 1KXBA 1K1IA 1C5QA 3RXMA 3DA9B 4BXSA 1P2QA 5ESTE 2JJ1D 3SGAE 4RT0A 2Q6FA 1ZMNA 4I32A 2ZKSA 3RXDA 4H6SB 2B8OH 3VXEH 4ZKSU 1TPAE 3CNRA 1A0HB 1JWTA 1HAXB 4E7NA 2QF4A 3FO8D 3UWJH 3ZV9A 5A0BA 2L74A 4HFPB 2A2QH 4GLYA 5KGOA 1GMHF 1J16A 2H9HA 3VG8A 1BMNH 1BTZA 2V3OH 1UK4A 3RXQA 1MU6B 1ANDA 1O5GH 1FIWA 4FVBA 3PMHB 3B23B 2R3UA 3N99A 1E38B 1ABIH 2BY7X 2KAIB 2WYGA 1A5IA 4Y8ZA 5C20A 1SI5H 3RLWH 3MQKC 1AQ7A 1O2UA 2OK5A 2UWPA 2O8LA 3URDA 1FY8E 1SQRA 5C1XA 3Q76A 4XD7D 1VZQH 3UQOA 1S85A 2WPHS 3AAVA 2XC0A 2G5VA 2R2WU 5T6GA 3RC4A 1DVAH 1KXCA 2QAAA 4HTCH 2ZCLP 3SN8A 1QB1A 4MNXA 4X1QU 5EQQA 1F5LA 4I8JA 1AKSB 3F2FA 2ZWLH 3S0NA 3SOSA 4I8HA 1QB9A 2Y5HA 1KY9A 3P8OA 1MCVA 1O36A 4ABDA 1NRPH 3PTBA 3UOPA 1GBFA 3ZZCA 3TIUA 3T29A 2SGFE 1ELDE 1IQLA 2ZU4A 4U32A 1C1SA 1P01A 2LPRA 2OC0A 1OKXA 3TGKE 4WMFA 5EJZA 3M37A 2W6JD 1GI2A 4IW4E 4Y0YE 1ZSKA 2ZP0H 4K8YA 1XUJA 1GVKB 1GBLA 2O8UA 2J9NA 1O3IA 2G00A 2Z3CA 1KDQB 5DSFA 5I46H 1SLVB 1GHZA 5DG6A 3LJJA 3DSOA 1C4Y2 2BVSH 1SGYE 2C4FH 1D3QB 2XWBI 1QY6A 3RU4D 3L33A 1GBBA 1OWEA 4GCHG 1O3EA 1LQEA 2QGRA 2TGDA 1QJ1B 3ZYEA 1MTWA 4Y10E 2CHAB 4AGKA 3D23A 4O3UA 4K60A 3OY6U 1F0RA 1EPTB 1K28D 1Z1IA 3RXHA 3AAUA 2FYRA 3ATMA 2OC7A 1CQQA 1SSXA 5DP9A 2A5IA 4ZXYH 2ZPQA 1G36A 2P94A 3RM0H 3VB7A 3M3TA 5JYIA 1JMOH 5EXNA 2AH4X 3F0OA 2FOCA 4GHQA 3LGIA 3EGKH 5E2PA 3MO6A 2TBSA 4AFSA 5LPRA 3KYGA 3GS9A 4NWLA 1ZHMA 2TGPZ 4WH6A 1GJDB 2BDAA 1THPB 2G4TA 5A8YA 5GNDA 1G32B 1OS8A 3E6PH 1VKYA 2AMQA 2Z3DA 3Q3KA 4IC5A 2XRCA 2XCFA 1O5EH 4ZKOU 2A0QB 1RFNA 3A7TA 2GD4B 2OTVA 2B5TB 2ZU5A 3PLKA 4UONA 4CBOA 2Q6DA 3ODDA 1BBRH 1FAXA 3ATLA 4NIVA 5DGJA 4NA9H 5FCKA 1TABE 2Z6BD 1LDTT 1C1QA 1GI6A 1SL3A 1TGCA 2Y80A 4A1XA 4WJG2 2QN5T 1P57B 1Y59T 1LVBA 2ZHEH 2GZ9A 1Z1JA 4WWYA 1NFWA 4B2BA 1AGJA 5DP6A 1INCA 1EP5A 2FS8A 1A5GH 3A82A 2AGEX 1MU8B 3UQVA 2WUBA 1ZZZA 2Y5FA 4WXVA 2W7UA 5AF9H 1IQIA 3LH1A 1S6HA 1MABB 1SOTA 1B7XB 4D76A 2UUYA 1CHOF 2FIRH 2LELA 3FKSD 3MO3A 3V12A 1KTTB 1ZSLA 2JDID 1TGSZ 2BMGB 1TBRH 1SGPE 4AFQA 5FXLA 1P8VC 1TMTH 2HPQH 2ZHFH 1XXFA 4ABFA 6CHAB 1GDQA 4ABEA 3MHWU 1T8NA 2F9OA 3SQHE 1C5SA 4O97A 4XFQA 3EA7A 1IQNA 3SV8A 3P8NA 1C1UH 1IQHA 4UFGH 5DP8A 4AG1A 2H9TH 2VGCC 5EODA 4CR5A 2QC2A 4IS5A 3KN2A 3PM3A 2ZPSA 3RU4E 3NZIA 3TNSA 3R0FA 1MQ6A 1C1MA 3LGWA 1O2KA 1O38A 5C1UA 1GHYH 5HGGA 4CRAA 5C2ZA 1YPJH 2FX4A 1FJSA 4X1NU 3MU5A 1SLUB 1YGCH 1ELBA 3FAOA 3KQDA 5L2ZH 2G4UA 2YMSD 1A2CH 1K1OA 5HKKD 3BG8A 4OS2A 1GJ8B 1SGNE 3GY4A 4YOJA 1HCGA 4MPVA 2YMSB 2ZTXA 4BANB 4DY7B 3PLPA 2BD5A 5HXFA 3PMAB 4XBBA 1BMFD 4KTCA 5K0HA 1W7GH 1S0RA 3NWUA 5EPNA 4K1SA 5GPIB 4NIWA 2AGGX 5H4IB 2AS9A 5C0UA 1QB6A 3V7TA 2CXVA 3UUZA 1UCYH 5DP7A 6CHAC 2J2UA 1LHEH 3LC5A 1O3CA 4AFZA 1YC0A 4TT3D 1L1GA 1UHBB 2FEQH 4Y6DA 4Y71A 1TONA 4HG6A 3RXJA 1O3NA 3SW2B 3UY9A 1N8OC 1TMBH 2V6NA 3UREA 1O3HA 3EA8A 1V2LT 2Z9JA 2FOGA 3WW7A 1BHXB 3PO1C 3BEIB 2BLWA 1KLTA 4IMQA 2PFEA 1AUJA 3M7UA 3LGUA 1LTOA 2JKHA 3A8BA 3TK6A 1UO6A 1YY3A 2ODYB 3TLOA 3ZVGA 4NSYA 4AN7A 1QBOA 1DE7H 4TPYA 4MNVA 5F03A 4DW2U 2G52A 1LHDH 3FP6E 4B1TA 1O3LA 3BG4C 1NFUA 1F0SA 4MPUA 1AZ8A 4ABJA 4BAQB 2ZQ2A 3TPIZ 1V2UT 1FY3A 1NZQH 2GCHG 3KQEA 4GCHF 2C8WB 1DICA 2FM2A 3T28A 2WZQA 2HVXA 2VB0A 3W1EA 3SORA 4FUIA 5L2YH 4AFUA 1SHYA 2BZAA 1CA0B 1LCYA 1W10U 4TSFD 3GDUA 4NG9H 1MBMA 2BD2A 3PTNA 3SI3H 4Z1MD 2D26C 2FOFA 1CGHA 3LGVA 1TPPA 1O3JA 1BT7A 1GGDB 3F6UH 4HGCA 3VPKA 4P00A 3STIA 3LDXH 3LGYA 4O03A 2GDDA 4AOQA 3EDXB 1DOJA 1C9TA 4BAMB 1NT1A 3F0PA 5G4BA 5IDKA 5I25A 2OBQA 1T8LA 3QN7A 2A4RA 1XUGA 1WQVH 1AZZA 1S0QA 2A7CA 1GJAB 2ZFFH 3T26A 5GJ4B 1GBMA 1L0ZA 4H6TA 1H8ED 4MG3A 2FDAA 5FHTA 3MOCA 1A5HA 1E79D 1B5GH 4NFFA 1ZTJA 1SQOA 2A4GA 3OAAD 2XNIA 1MUEB 2HRVA 1O37A 1ZOMA 4A7IB 1OWJA 1AHTH 2QF5A 1C5TA 1VR1H 2AFQB 2FPZA 1QCPA 3BTWE 3GISB 1GI0A 1LPKB 1YYY1 2BD4A 4XRNA 1IQEA 3RXUA 4Z6AH 1DS2E 1YCPH 1CA0C 3EE0B 2BDGA 1C2FA 1MTNC 1WSSH 2P3TB 3DSPA 3UWIA 2GTBA 1IQFA 4ISHH 1CGIE 3F1SB 3TITA 3URCA 3PRDA 2QCYA 1UTJA 2H5CA 2FLBH 5T6FA 4JK6A 3U69H 1GBEA 2F9PA 3BTDE 2STAE 1OYQA 4F48B 4UE7H 1ESTA 2IPQX 1E0FD 1IAUA 1GI1A 1OP2A 1EJAA 2XXLA 1ID5H 1NU7B 4YTAA 1J15A 1G3CA 3Q77A 3SZEA 1GVLA 3ZZAA 4BTIB 4I33A 3LH3A 1KLIH 4FUGA 3ZZ4A 4Q2KA 2XW9A 4UFFH 1O3MA 3SI4H 3DCLA 1AIXH 1GBCA 4LXBH 1ZJDA 3K9XB 3MTYA 1VGCB 3OY5U 4Q4LA 1CSOE 1O5BB 1A3BH 1ZGVA 2ZA5A 1JIRA 4DT7B 1O2GH 2ZFRH 1O2SA 2ALPA 1ZMLA 2VVCA 4MNYA 3PLBA 4YT6H 1DWBH 1VITH 1NFYA 3S9BA 2BD3A 1S6FA 4YZUA 5DP5A 1HRTH 2WSSD 3SHCH 3MMGA 3LT3A 3TK9A 4P02A 1TNHA 4XE4A 1HAGE 1QR3E 4Y79A 1C5YB 5LGOA 1D3PB 1F2SE 3SHAH 1BTPA 1V2JT 2KCOA 1GL1A 2SGPE 2Y6TA 4FUEA 1EUFA 4K3JA 1O31A 5F8TA 4I7YH 1G9IE 1K21H 2A32A 1RGQA 3F9GA 4BAKB 1NO9H 1O34A 4X8VH 3HGNA 3BTKE 1H9LB 1HXFH 1FQ3A 2VU8E 2UUKB 1ETSH 8LPRA 3UNRA 1FLEE 1SMFE 3P8FA 4FOUC 3UAIC 2GCTB 2CV3A 1AWHB 2XBYA 1T8MA 3PRBA 1AB9B 1EJNA 1YP9A 3M3SA 1O2RA 4B71A 2CN0H 1HFDA 3L3TA 2F91A 1C2LA 1E35B 1YPEH 4JMYA 4KP0A 2BTCE 1S83A 3ZZ7A 3RXCA 2FODA 2YNBA 5FL7D 2QXJA 1CU1A 3PWCA 1SGIB 4I8GA 1P2MA 2FMJA 4AYVB 1VGCC 2BDBA 4X8SH 1IHTH 4DIHH 2A7HA 2VWMA 4K1EA 5F53A 1ELCA 3OEED 3GCHC 3CS7A 1V2MT 1AFEH 4ACBA 1B0EA 1GHVH 3SNBA 3LC3A 1ESAA 1UTMA 1SGRE 2Y5GA 2Y7XA 2ZDMA 4K2YA 1COWD 3RDZA 1TPSA 2PWXA 2LNCA 1N6XA 2NU3E 2AIPA 2AERH 3OU0A 1P11E 2STBE 4FXGH 2GCHF 1RD3B 1TNJA 3QDZB 1MZAA 2GZ8A 3GOVB 1Y3VA 2WPMS 1FMGA 3F68H 4JCNA 1FPHH 3UNSA 1O3AA 3QZQA 1C5MD 1H9HE 3F2HA 1BTXA 5E0HA 2FXRA 4SGAE 1KIGH 3SUGA 2FO9A 3TVJB 1AFQC 1C5ZB 1SLXB 4BTUB 2ZPRA 1P2NA 1XUIA 1Z6EA 4FUFA 3SU3A 1Z6JH 2OINA 1C2MA 2EI8A 3H09A 3MNBA 2I6QA 1GL0E 4CRFA 2ZDKA 3HK6B 3RXBA 5EQSA 1Z8RA 5L6NH 1SKYE 4YM9A 2ZGCA 2OC8A 3P17H 1TNKA 1W3CA 1FN6A 4D9RA 4Y7AA 2AHME 2Y7ZA 1O30A 2J5UA 4CRGA
chains in the Genus database with same CATH topology
2ANKH 3GY2A 1P04A 4AORA 2ZECA 1QQUA 3BEFB 3K6ZA 4TPIZ 2BLOA 1J14A 4XOJA 1GI9B 4CH8B 4YT7H 3LIWA 3QO6A 1FY1A 1O3DA 2NU1E 3B8JA 1K1NA 1EZQA 1Z8JB 4I31A 3F9EA 3RMLH 1A61H 1UVTH 2VVUA 1TALA 4BAOB 2VWNA 3OSYA 3KNXA 1TYNA 4JZDH 3M5NA 1ABJH 4ASHA 1P9UA 3A86A 3GY8A 1WCZA 2JH0D 2A5AA 1EP6A 5JB8S 4J2YB 3BIUH 2J94A 4OS6A 1YLDA 3ZZ5A 5AFYH 2IPHA 1GHXH 2WINI 5TCAA 2GVFA 2P3UB 3F9HA 1Y5UT 2AMDA 3QZRA 1FY4A 4K69A 1LQDB 1P02A 4JZFH 4Y11E 1YCPK 1QHRB 2F9BH 4AZ2B 3VXFH 3T25A 3KQBA 4BXWA 1PYTC 3AW1A 1EJMA 1WTHD 1SG8B 1UTPA 4CHAC 1GHWH 1Q2WA 1WQSA 1AY6H 4HZHA 1ETTH 4VGCC 1DY9A 1TGTA 1ACBE 2OXSA 2H2ZA 3A7XA 1GJBB 3M5OA 1UVUH 2V3HH 3IWMA 3MWIU 3GYMA 2BHGA 1TNGA 4ESTE 1O5CB 5A0CA 4INKA 2XBXA 1CBWB 1QA0A 2SNWA 3JZ2B 1TB6H 4X0WU 5CHAC 1GI8B 3U9AH 3GCNA 3U1JB 3ZZDA 4X1PU 2A4OA 2ANMH 2RA0A 1LHGH 5GIBA 1DLKB 3NKKA 1TRYA 2C93B 3RXPA 2FOAA 1C2JA 3I29A 1AVWA 2PUXB 1AD8H 1W0ZU 2G55A 1J8AA 2ZDVH 3LU9B 2GP9B 3UIRA 1CA8B 3QGNB 2DUCA 2BD9A 2ZU2A 3KEEA 1NN6A 1AMHA 1XXDA 2VGCB 1C5OH 1MKWH 1MTSA 3K2UA 1FIZA 5TCCA 1AI8H 1L2EA 5AVDA 3NXPA 4A6LA 4B2AA 3V3MA 3AASA 2CJIA 2ZC9H 1P2KA 5PTPA 4DGJA 4X2YA 4R0IA 3K65B 4MDSA 1EQ9A 1GBTA 1FXYA 4A1TA 3U1IB 1O2WA 3M7QA 2ZFPH 1CBWC 5FBEA 1EKBB 2FZZA 6GCHG 2BM2A 1A7SA 3M3VA 3TH3H 1FY5A 2FI4E 2A31A 5GWZA 1D6WA 4Y8YA 1C1TA 1GBKA 4ISOA 1N1LA 3DD2H 3QWCH 1HYLA 5FPYA 1TX7A 2PV9B 3PMJA 4PROA 2J92A 1MKXH 3NK8A 1B0FA 1DDJA 1BTWA 1NRSH 2J38A 2JETC 2UWOA 1ARCA 3BEUA 3S9CA 4GAWA 1L4ZA 3UFAA 5A0AE 1XKAC 1M9UA 1HAIH 1O35A 2FOBA 2IN2A 1A46H 4DG4A 2P59A 3RXAA 2G81E 1Z7KA 3UTUH 1UTOA 2EI6A 3SV9A 1WUNH 1N8OB 1LHFH 3A8AA 1BRCE 1ZJKA 1JXPA 2BX4A 1K2I1 1ZLRA 4JZEH 5C3NA 1AKSA 2BD7A 3PO1B 2ZFTA 2Q6GA 2TIOA 3QTVH 5DO4H 5AHGH 5FX6A 4YLQH 4YOIA 4GVUA 1GBAA 2Z3EA 4YO9A 3WY8A 2B7DH 3PWBA 4I8KA 2CGAA 4INLA 2GMTC 4NIYA 1TA6A 1TOCB 1FZZA 1KXEA 3IG6B 2BY5X 1GVZA 3BTGE 5HMAA 3SU0A 3AVZA 2BVRH 1EX3A 2C8XB 3BG4B 1AVXA 2HPPH 1OX1A 3MFJA 4JYUH 1RTLA 3A84A 1YBWA 4ISLA 5C5OA 1JRTA 2NU4E 2VIPA 1KDQA 1V2ST 1QRZA 3E0NB 2GZ7A 1T7CA 4D9QA 3HKJB 5L30H 1C5XB 2ZDNA 1F5KU 2A7JA 1GI3A 4ABAA 2RDLA 4M7GA 1C9PA 4RSPA 1DXWA 2R9PA 2H6MA 3LOXA 4X1RU 3ZVDA 1GI7B 1S84A 2BLQA 3A88A 1TX8A 4NSVA 3RC6A 1K1PA 4JZIA 1IOEA 2NU2E 1O3OA 3VGCC 1D9IA 3SJOA 4A1VA 3SJ8A 4IBLH 2GT7A 1EAUA 3HATH 3RXEA 3O8DA 1K1LA 4MVNA 2VVVA 4K1TA 4TWWA 2HALA 1PPZA 1C2DA 2QY0B 1TE0A 3T5FH 1AVGH 1DANH 1GHAG 1BITA 1P3CA 1EOLA 3B9FH 3QGJA 3W95A 2WPKS 1PQ8A 3E90B 3LGTA 3BTQE 5GXPA 3M35A 4YLUA 2GKVE 1GMDG 1XKBC 3QLPH 1ANEA 2QA9E 4NZLA 1ZYOA 2FTMA 3QUMP 2XC5A 2W3KA 1ELEE 4U30A 3MNXA 2WPLS 2I6SA 4X8UH 5HM9A 1GPZA 3EQ0H 1MTNB 2EEKA 6LPRA 3S7KB 1IQJA 1P03A 3SV6A 1A0JA 2EC9H 4NFEA 2O8MA 3LKWA 2BOKA 1Z8IB 3LJOA 1XUHA 2W3IA 4F4OC 3MU1A 4CRCA 1GJ7B 3SJIA 1C2GA 3GY5A 4BOHA 3ESTA 1C5VA 1YPHC 1YPKH 1GI4A 1HAYB 2BQ7B 2VJ1A 1MAYA 1K1JA 4MLFB 4A5TS 1ZTKA 3I77A 1ARBA 1DX5M 4X2WA 2VNTA 1NM6A 1C1PA 1VCWA 1ZSJA 2QYIA 3BTME 4LOYH 2BDIA 4KELA 4YESB 1HLTH 2PGBB 2HLCA 4WY3A 2XTTB 1ESBA 4ZAEA 3BN9A 1UVSH 1AN1E 1UK3A 3MH5A 1C1VH 1ZR0A 3KHVA 4UFDH 3A7WA 3BIVH 1Y3UA 4MPWA 5FCRA 4H42U 1VJAU 3DHKH 1HUTH 6GCHF 1C1NA 1SQAA 5J4QA 1MKWK 3C1KA 4ZKNU 2BZ6H 2R2MB 1VJ9U 2CF8H 5EGMA 2ZCKP 4UFEH 1QBNA 2ZU3A 1NESE 1QJ6B 1BBRK 4Q80A 1ELVA 4ZHMU 4NA7A 3A7VA 4LK4A 3ELAH 1J9CH 1HIAA 1W14U 1G3DA 2OD3B 4NZQA 1FPCH 3ENSB 3V13A 3FZDA 1EASA 1TWXB 4Q7YA 4R8TB 3S69A 1P3EA 2FX6A 3SU1A 4K5ZA 2R0LA 3A87A 1XMNB 1NRQH 2XBVA 1X7AC 4WXIA 2G8TA 2FLRH 1O2XA 4X2XA 3RXTA 2PUQH 3G01A 1EZUC 3SNCA 1C2HA 1CT4E 3GCTG 1GMCG 2FP7B 5EXMA 3ZVFA 2P3FH 1SBWA 1NRRH 1ELFA 4UEHH 4NIXA 2ODQA 4E05H 3UNQA 5EG4A 3H7TA 1HJAC 3MU4A 2FI5E 1MKXK 4JYVH 2PKSC 3MNSA 2VH6A 1O2PA 3GCHB 4GSOA 1TA2A 4MQAA 4A92A 1HAVA 2VIVA 3QK1A 2ANWA 1EXFA 3W94A 4B2CA 2XBWA 1SGFA 4IGDA 1DLEA 2OLGA 4FUHA 3M36A 8GCHG 3FP8E 1ZRBA 1C2IA 1HAHH 1RS0A 2ZHDA 3P6ZB 5EOKA 1RIWC 2A4QA 3UPEA 3RUOA 1MAXA 1PQ5A 1WTGH 3MH6A 1MD7A 1NTPA 1GJ4H 4JYTA 3TH4H 1IQGA 4ABHA 1ZMJA 1GCTC 1O2YA 2UUJB 3SJ9A 1QL8A 3D65E 2GDEH 2ZGJA 3PV4A 3VB6A 2BDCA 1PQ7A 2DE8A 1T4UH 1RTFB 8ESTE 1D4PB 3EA9A 5A2MH 3RU4T 3TH2H 1C5LH 1THRH 4Q7XA 1TBZH 2W26A 2BY8X 1OYTH 3MI4A 4XDEA 2OP9A 1C5WB 1E36B 2K1QA 1Y3WA 2D2DA 2NU0E 1O2JA 3R3GB 1GBJA 9ESTA 3SGQE 2ASUB 3A7ZA 1FDPA 4X6NA 1AFQB 4IMZA 1XUKA 3ZVBA 3E16B 5T3HA 1O0DH 1LVOA 2AMPA 2FS9A 3BTTE 1FNIA 1EZXC 2ZFSA 4WF8A 3P95A 1AUTC 1F7ZA 4CREA 1P10A 1HB0B 2J34A 1TNLA 1YPLH 4WMEA 3E1XB 2DE9A 3K6YA 1TIOA 1OP8A 4XBCA 1BTUA 1GI5A 1DUEA 1OWDA 4FVDA 4WH8A 1OXGA 1GDNA 1UCYK 2PSXA 4GHTA 2F9VA 4MNWA 1QL7A 1SB1H 1GHAF 5EU8A 1C5RA 1P09A 4TYDA 1K22H 1S5SA 5FBIA 1WU1A 2ZGBH 3A8CA 3QTOH 1GMDF 1HGTH 3EAJA 3U98H 4KKDA 3MYWA 2C8YB 3SV2H 3PB1E 1G2MA 1V2QT 3I78A 2Q1JA 1TQ0B 2OQUA 3STJA 9LPRA 3RXFA 3DT0H 4AB9A 2ZGXH 1O3FA 1TX6A 2AEIH 4FUBA 1CO7E 5AFZH 1SLWB 2PSYA 1SHHB 2SFAA 1L4DA 3MH7A 1GCDA 2SGDE 2ZO3H 1FN8A 4ISNA 3U8TH 1EATA 1BA8B 1TRNA 1V6DA 5CE1A 1QJ7B 1W11U 1EOJA 1H8DH 2QF3A 5LPFA 1C1OA 3SZNA 2YOLA 1PYTD 4ISIH 5BRRE 4OS7A 4J1YA 1BOQA 1ANBA 4AX9H 2WV4A 3MNCA 2B0FA 1W2KH 5C5NA 1DWCH 2XCNA 4ABBA 4NA8A 4D7GA 3ZZ6A 4CHAB 1VITF 1C2KA 2FOEA 3M5MA 4VGCB 1O2TA 2BOHB 4B74A 2F3CE 4ZUHA 1CVWH 1GG6B 2ZTYA 2PHBA 1SGQE 2W7SA 3RMNH 1HAZB 4ZKRU 3SUDA 2BX3A 7ESTE 1PFXC 1W8BH 1DUAA 1KSNA 4B76A 2P8OB 5CMXH 3ATWA 4SGBE 1V2OT 1NROH 1NS3A 1ZPZA 1EAXA 5CHAB 3FP7E 1ELAA 1D6RA 3SU6A 1BMLA 1G37A 3CP7A 3QX5H 3ATKA 1Y3XA 1QFKH 1GBDA 3OX7U 1XVOA 3DFLA 4ZMAH 3S7HB 3H5CB 4F49A 1O2ZA 1WV7H 3U8OH 2THFB 2QIQA 3BV9B 1SVPA 1H8IH 2ESTE 3IITA 3ATIA 2ODPA 1DWEH 1O5AB 1GDUA 4X6MA 3TK5A 3KQCA 3SGBE 2AIQA 4RKOB 3D62A 3GCTF 1C4U2 3H7OA 2YNAA 1K9OE 1G3EA 1SOZA 1GMCF 1D3TB 1UTQA 1GBHA 3TNTA 1EB2A 1CGJE 1CE5A 4QT8C 1BIOA 2ZGHA 3SUEA 4FUJA 2V0BA 1GG6C 1AWFH 4Y8XA 2VH0A 1H1BA 5K7RA 2XC4A 5LPEA 5JBTA 5F8ZA 4DJZB 5B6OA 8GCHF 1C5PA 2B9LA 1O5FH 3P8GA 3Q3YA 3NPSA 2P8OC 3RLYH 1G3BA 1O33A 7LPRA 5JBBS 2GV7A 5DP3A 1MCTA 1KYNA 2ILNA 4DOQA 3TJNA 4IN2A 1VCPA 1L1JA 2W5EA 1DSTA 4X1SU 1WBGB 1EB1H 4U2WA 3SV7A 4UD9H 3M5LA 1UTKA 2FTLE 1O2NA 1HDTH 1QNJA 3TJUA 2JETB 1SGFG 3GY7A 5DK1A 3RXVA 1Q3XA 2GV6A 1E37B 1Y5AT 3SU4A 1QRWA 1IQMA 3O8CA 4BTTB 4YOGA 1AE8H 1K1MA 1TAWA 2WV5A 2ZFQH 3SO3A 1V3XA 2P93A 3RP2A 3ZVAA 1ZPBA 1CT2E 2GT8A 2ZCHP 3A89A 2PKAA 4INHA 1UTNA 1TLDA 5F8XA 2HWLB 1MD8A 2JH6D 1GBIA 1PPHE 2QXGA 2VWLA 2SGAA 2ZEBA 1LKBA 1YM0A 4E7RG 2HNTF 2FWWA 2G5NA 3TJVA 1TQ7B 2RA3A 3A80A 4Z0KA 4O3TA 2GMTB 1O2LA 1PPEE 2AYWA 1TMUH 1HAOH 3A7YA 5LH8A 1XM1A 1DXPA 1RXPA 3TJOA 1YCPM 3RMMH 1UJ1A 2BY9X 3MH4A 1EAIA 4JZ1A 1YKTA 4X8TH 2BDHA 3P70B 1GJ6A 3RXOA 4BAHB 2HNTC 2QXHA 3GY3A 5EXLA 1SGCA 5JDUB 1PQAA 4OS5A 1O2MA 5E0GA 7GCHG 1S82A 1J17T 3SNDA 2FOHA 1P06A 2KAIA 1EAWA 1G30B 2CHAC 2RCEA 2ZZUH 4Y7BA 3VB4A 4X6OA 1EPTC 1BCUH 4OS1A 1QIXB 1ZHPA 2ZU1A 3BTFE 1BRUP 1S81A 1LVYA 2Z7FE 4D7FA 1BTYA 4WMDA 3NCLA 1CHGA 1GJCB 3E0PB 3VGCB 1OWKA 3KF2A 2H9EH 3DFJA 3SU2A 4H4FA 2J95A 1HBTH 2EA3A 1BB0B 5JPMH 3T27A 1WOFA 2QF0A 4IN1A 2Z9KA 5FAHA 3RXRA 2HNTE 4AB8A 1AU8A 2Y82A 2J4IA 1H9IE 2ZF0H 4OGXA 1O3KA 4B75A 1DT2A 3A85A 1DSUA 2VIQA 1LKAA 1OSSA 3TU7H 1T8OA 2ZIQH 3E8LA 2A2XH 5TJXA 2F83A 3RMOH 5BPEA 1MTVA 1ZTLA 2R0KA 1FONA 1LO6A 1KTSB 1O2IA 1WYKA 4CR9A 3FZZA 4ZHAA 4U01A 2FYQA 3ITIA 5GDSH 1A1RA 4DCDA 1HV7A 8KME2 1LHCH 3ZYDA 5GCHG 5DKMA 1TGNA 5DP4A 1YPGH 2HOBA 2SNVA 2WPIS 1N6YA 3KIDU 1HIAB 2ZDLA 1KXFA 2ALVA 2IOTA 1GHBG 3NUMA 3AW0A 1GWAA 1XUFA 3KCGH 1O3GA 2FOMB 1EZSC 1ETRH 1XX9A 6ESTA 3L6PA 4FU7A 1V2PT 5E0JA 1SGDE 2P16A 3HGPA 1HJ8A 2BXUH 2PTNA 3SUFA 4LZ1H 1Z8GA 1EPTA 1P0SH 1UK2A 5A8XA 1Y3YA 1O2VA 2RG3A 3UR6A 1VCQA 3O8BA 1LPGB 3RXIA 3SNAA 5DPAA 4XBDA 3RXKA 4ABIA 3OYPA 1SGEE 2H5DA 1P9SA 3ODFA 4IC6A 2ZDAH 4RN6A 1HAPH 1TGBA 1F0TA 2C8ZB 2Z9LA 2G51A 1FAKH 1LVMA 4WVPE 1HAVB 1O3BA 1TFXA 4ZH8A 5HM2A 1AE5A 2BYAX 1SGTA 1NPMA 1O5DH 1D3DB 1DPOA 3JZ1B 1Z71A 2GGVB 1C5UA 1W0YH 2R3YA 2PLXA 1C5NH 4CBNA 3D49H 1RTKA 2UWLA 3T2NA 3RXSA 3VFEA 2ZHQH 1NU9A 1G2LA 1KLJH 3CS0A 5A8ZA 2ZTZA 1BJUA 4HI3A 3HKIB 3M61U