3OILA

Human carbonic anhydrase ii mutant a65s, n67q (ca ix mimic) bound by 2-ethylestradiol 3-o-sulfamate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Carbonic Anhydrase Isozyme Specific Inhibition by Sulfamated 2-Ethylestra Compounds
rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
total genus 77
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3oilA00
4QK3A 3DCCA 2POUA 4HEWA 5EHWA 1XPZA 4KP8A 5FLSA 3RZ7A 3HKNA 1DCBA 1ZNCA 3HKTA 1CILA 2GD8A 3D9ZA 1FQLA 3JXGA 5JQTA 1ZH9A 3V3HB 1LZVA 4CA2A 3P5LA 1CCTA 1OKLA 3RG4A 4RIUA 1CINA 1CAMA 3DAZA 1BNTA 3P44A 1H9QA 1IF6A 1URTA 3PJJA 3MZCA 4WUQA 5DSMA 4MDGA 1AVNA 3U7CA 1OKNA 3L14A 3M04A 5FNHA 1CNWA 2CA2A 4N16A 3K34A 5SZ3A 3N2PA 4CQ0A 3K2FA 3RYYA 3V7XA 4Q7PA 1RAZA 3F4XA 3N3JA 5FLOA 2CBEA 5EH7A 1XQ0A 1TEQX 4FIKA 4XZ5A 2EU2A 1FSRA 1LGDA 3IBUA 4BCWA 3DC3A 3OIKA 4YXIA 4GL1X 4YXOA 4Q83A 1I9PA 1CAKA 3RG3A 4QEFA 4COQA 1CA2A 3RZ8A 1FR7A 3IBLA 1BNNA 1UGEA 1DCAA 4RN4A 4FU5A 4PYYA 1ZSAA 4HF3A 2NNGA 1LUGA 1TEUX 3BL1A 1TE3X 1CCUA 5JEGB 5BRUA 1HEAA 3S75B 1FR4A 1HUHA 3T82A 4E3HA 4Q6EA 2WEJA 3MNKA 4FRCA 4Q06A 3NI5A 1BN4A 3OIMA 2FOVA 3MHLA 4RUZA 3V3IB 4YWPA 2H4NA 3M2YA 2OSFA 4YGNA 3MNAA 4K0TA 1CVDA 4JSZA 1T9NA 1TBTX 2NNSA 4Q08A 2CBDA 2HFWA 2HD6A 3KONA 4Z1JA 3KKXA 4PYXA 1H4NA 4ZWXA 2ILIA 4FL7A 1CNXA 3UYQA 4HT2A 1V9EA 5FL4A 4CNVA 2NN1A 3M3XA 2VVBX 3NB5A 1CIMA 1I90A 3F7BA 1HUGA 5CLUA 4YGKA 5FNJA 3S76A 3V3FA 1Z97A 4PZHA 3T5ZA 1YDDA 3HKQA 4YXUA 3M1JA 5SZ4A 1G4JA 3IGPA 6CA2A 4HT0A 4K13A 1G48A 3ZNCA 4X5SA 1Z9YA 1CVAA 1FSQA 4Q6DA 3S78B 1FLJA 1Y7WA 4G7AA 1A42A 4IWZA 2W2JA 3EFTA 3M5SA 3S71B 3N0NA 2FOQA 4RFCA 4RFDA 5EHVA 3RZ5A 1FQMA 3N4BA 4QTLA 1HEDA 4YGJA 3DCWA 5HPJA 3F7UA 3DC9A 5FLPA 5E2NA 4WR7A 3V5GA 1BNUA 3B4FA 5DSJA 1CVEA 4QJPA 7CA2A 1CCSA 3KLDB 1DMXA 2Q1QA 1FQNA 1I9LA 5C8IA 4R59A 1G6VA 2FNMA 5JQ0A 2FW4A 1CNBA 4WW8A 1RZCA 3MHMA 3SBIA 2IT4A 4XIXA 4QJMA 1BCDA 3S74B 4KNJA 5EKJA 4E3DA 5BNLA 1JD0A 1UGBA 5EH5A 2NNOA 4QSBA 3PYKA 2NWZA 3EFIA 1I9NA 2CBBA 2NNVA 2NXRA 5E2RA 3ZP9A 2HKKA 5L3OA 3TVNX 1HEBA 3T84A 4M2RA 5E5UA 3MNJA 4Q78A 1CAJA 3KIGA 1BN1A 4MLTA 3RGEA 4JSWA 2NWOA 4ILXA 4ZX1A 5E2MA 4MLXA 4BF1A 1I9OA 1MOOA 1CNGA 5FNKA 4ZWIA 1IF5A 3KOKA 4Y0JA 3IEOA 4ZX0A 4ITPA 4Q49A 5EZTX 5EH8A 2NWYA 1G1DA 1G0EA 1KWRA 4FVNA 4FVOA 4LU3A 4YHAA 4R5AA 3PO6A 1UGGA 2POVA 3DD0A 1DMYA 1RJ5A 5E2SA 3TVOX 1YDCA 3OYSA 1UGDA 1I91A 3DBUA 4Q0LA 1AM6A 8CA2A 4CNRA 2NXTA 2X7TA 1BZMA 1BV3A 5DSIA 5FLQA 3SBHA 3P3HA 3CAJA 5DOGA 4L5VA 2ZNCA 3V3JA 3T83A 5IPZA 1CVCA 3RYZA 5BRWA 4KNNA 4XFWA 4E3GA 5E28A 3OYQA 4PXXA 2CABA 5G01A 2NXSA 5DSQA 3R17B 2FNNA 1IF4A 2QP6A 4Z1KA 1CVBA 5EIJA 5DRSA 1G4OA 3OY0A 4L5WA 4K0SA 1YDAA 3P5AA 5DOHA 1OKMA 3MDZA 5DSOA 1CA3A 4QIZA 2X7UA 5FDCA 1I8ZA 3ML5A 1JV0A 1G0FA 1TTMA 3JXHC 4JS6A 3U3AX 2HNCA 3RZ1B 4M2WA 4KUYA 4IDRX 4K0ZA 5JESB 2NMXA 5EKHA 4KV0A 1ZSCA 4QSIA 1BN3A 1HCAA 1CAIA 3BL0A 1EOUA 4R5BA 3W6HA 2FOUA 1G45A 4WW6A 4YYTA 2HL4A 4YX4A 3CYUA 4Q8YA 1IF7A 1UGCA 2AX2A 3M5EA 1CNHA 4MDLA 1BNMA 4DZ9A 5A6HA 4Q7SA 4Z1EA 3V3GB 3DD8A 1I9QA 4YGLA 2NN7A 4E5QA 3D8WA 2ABEA 4MO8A 5EKMA 4HBAA 4WL4A 5JGSB 1F2WA 5FL5A 5JGTB 4CNXA 4TWMA 3NJ9A 2VVAX 2EU3A 4CNWA 5SZ1A 4TWLA 5EHEA 3UYNA 1KEQA 3VBDA 4XIWA 1CRAA 5L6KA 4RUXA 4E9OX 1BNQA 1JCZA 1YO0A 1CAOA 5FL6A 1CNKA 3F8EA 3KNEA 4KAPA 2WD3A 1UGAA 1ZE8A 3DCSA 3M96A 1THKA 3M1WA 5E5RA 3RYJB 5CACA 4QY3A 3DVBA 3BETA 3DA2A 2GEHA 3M1KA 2FMGA 3KOIA 5JDVB 3V2MA 1LG6A 3T5UA 1BNWA 1TH9A 1UGFA 3DVCA 1CVHA 5AMGA 3RZ0B 2QO8A 3P55A 1LG5A 4QK1A 5FNMA 2QOAA 5AMDA 3S77B 4XE1A 4Z0QA 3B1BA 5G0BA 5DSNA 1ZFKA 3OKUA 3MHIA 3DV7A 3GZ0A 1ZSBA 3M5TA 4Q99A 3IBIA 1CVFA 1FQRA 3FE4A 4YVYA 3M1QA 1KOPA 3S73B 1CNCA 9CA2A 1CNYA 1IF9A 3D0NA 3ML2A 5LMDA 1I9MA 1BNVA 5DSLA 1CAZA 5G0CA 4MTYA 3MNHA 3Q31A 3MNIA 1J9WA 2Q1BA 3P4VA 3S97A 5JG5B 1Z93A 3MHCA 4N0XB 2WEOA 3IAIA 4QIYA 1AZMA 4Q7VA 4QK2A 1ZGEA 5SZ7A 1YO2A 2AW1A 2CBAA 4QSAA 2Q38A 3HKUA 1HCBA 12CAA 1BICA 4E3FA 1XEVA 4KUWA 4LP6A 3HFPA 1G3ZA 4RH2A 3M14A 4KP5A 4C3TA 4CACA 1CANA 1OQ5A 4KUVA 4MDMA 5DSRA 4M2VA 3P58A 1YDBA 2FOYA 3HS4A 3SAXA 1IF8A 3D93A 1RZAA 4UOVA 5J8ZA 1CNIA 4Q8ZA 3JXFA 3V2JA 4ITOA 4QJXA 1RZDA 1MUAA 3KS3A 3CZVA 4WUPA 1G54A 4Z1NA 3HLJA 3LXEA 1XEGA 3W6IA 4M2UA 1TB0X 3M67A 4ZWZA 4Q90A 1RAYA 4Q8XA 4QJWA 4Q7WA 3FFPX 2H15A 1V9IC 4Q9YA 2HOCA 1H9NA 3M98A 1CALA 3M2XA 1TG3A 1ZGFA 2FOSA 2FNKA 3MWOA 4YGFA 5JEPB 3RLDA 4FPTA 2WD2A 4K1QA 3C7PA 1G52A 3M40A 3MMFA 4QSJA 3S72B 2EZ7A 4RIVA 3OILA 1FSNA 1CAYA 1HVAA 2POWA 3MYQA 3OKVA 2WEGA 5BYIA 5FNLA 4KNIA 1CNJA 4L5UA 5SZ5A 2NWPA 5FNGA 3SAPA 1KOQA 1CRMA 4RUYA 4JSAA 1CZMA 3S9TA 3P3JA 5JG3B 4DZ7A 5AMLA 5JEHB 5DSPA 5CA2A 4HEZA 5SZ2A 4KNMA 3D92A 3CA2A 4QJOA 3S8XA 3M2ZA 1CAHA 2O4ZA 5CJFA 3RJ7A 1TG9A 1KWQA 3MNUA 4ZWYA 2WEHA 3IBNA 3KWAA 5DSKA 5A25A 3FW3A 5EOIA 5E2KA 4E49A 5FLRA 1RZBA 5BRVA 4JSSA 4Q81A 3U45X 3RYXB 5DVXA 3K7KA 5FLTA 4E4AA 1RZEA 3M2NA 3RYVB 3MHOA 4ZAOA 3TMJA 2X7SA 3DVDA 4HU1A 5FNIA 1ZFQA 4LHIA 4BF6A 4ETQC 2F14A 2OSMA 1RJ6A 4Q07A 5SZ0A 3R16A 4PQ7A 1HECA 2CBCA 3T85A 4HEYA 5SZ6A 2FMZA 4QJ0A 4Q09A 1G46A 1G53A 3QYKA 1YO1A 5FDIA 4G0CA 3U47A 4Q87A 5G03A
chains in the Genus database with same CATH superfamily
4QK3A 3DCCA 2POUA 4HEWA 5EHWA 1XPZA 4KP8A 5FLSA 3RZ7A 3HKNA 1DCBA 1ZNCA 3HKTA 1CILA 2GD8A 3D9ZA 1FQLA 3JXGA 5JQTA 1ZH9A 3V3HB 1LZVA 4CA2A 3P5LA 1CCTA 1OKLA 3RG4A 4RIUA 1CINA 1CAMA 3DAZA 1BNTA 3P44A 1H9QA 1IF6A 1URTA 3PJJA 3MZCA 4WUQA 5DSMA 4MDGA 1AVNA 3U7CA 1OKNA 3L14A 3M04A 5FNHA 1CNWA 2CA2A 4N16A 3K34A 5SZ3A 3N2PA 4CQ0A 3K2FA 3RYYA 3V7XA 4Q7PA 1RAZA 3F4XA 3N3JA 5FLOA 2CBEA 5EH7A 1XQ0A 1TEQX 4FIKA 4XZ5A 2EU2A 1FSRA 1LGDA 3IBUA 4BCWA 3DC3A 3OIKA 4YXIA 4GL1X 4YXOA 4Q83A 1I9PA 1CAKA 3RG3A 4QEFA 4COQA 1CA2A 3RZ8A 1FR7A 3IBLA 1BNNA 1UGEA 1DCAA 4RN4A 4FU5A 4PYYA 1ZSAA 4HF3A 2NNGA 1LUGA 1TEUX 3BL1A 1TE3X 1CCUA 5JEGB 5BRUA 1HEAA 3S75B 1FR4A 1HUHA 3T82A 4E3HA 4Q6EA 2WEJA 3MNKA 4FRCA 4Q06A 3NI5A 1BN4A 3OIMA 2FOVA 3MHLA 4RUZA 3V3IB 4YWPA 2H4NA 3M2YA 2OSFA 4YGNA 3MNAA 4K0TA 1CVDA 4JSZA 1T9NA 1TBTX 2NNSA 4Q08A 2CBDA 2HFWA 2HD6A 3KONA 4Z1JA 3KKXA 4PYXA 1H4NA 4ZWXA 2ILIA 4FL7A 1CNXA 3UYQA 4HT2A 1V9EA 5FL4A 4CNVA 2NN1A 3M3XA 2VVBX 3NB5A 1CIMA 1I90A 3F7BA 1HUGA 5CLUA 4YGKA 5FNJA 3S76A 3V3FA 1Z97A 4PZHA 3T5ZA 1YDDA 3HKQA 4YXUA 3M1JA 5SZ4A 1G4JA 3IGPA 6CA2A 4HT0A 4K13A 1G48A 3ZNCA 4X5SA 1Z9YA 1CVAA 1FSQA 4Q6DA 3S78B 1FLJA 1Y7WA 4G7AA 1A42A 4IWZA 2W2JA 3EFTA 3M5SA 3S71B 3N0NA 2FOQA 4RFCA 4RFDA 5EHVA 3RZ5A 1FQMA 3N4BA 4QTLA 1HEDA 4YGJA 3DCWA 5HPJA 3F7UA 3DC9A 5FLPA 5E2NA 4WR7A 3V5GA 1BNUA 3B4FA 5DSJA 1CVEA 4QJPA 7CA2A 1CCSA 3KLDB 1DMXA 2Q1QA 1FQNA 1I9LA 5C8IA 4R59A 1G6VA 2FNMA 5JQ0A 2FW4A 1CNBA 4WW8A 1RZCA 3MHMA 3SBIA 2IT4A 4XIXA 4QJMA 1BCDA 3S74B 4KNJA 5EKJA 4E3DA 5BNLA 1JD0A 1UGBA 5EH5A 2NNOA 4QSBA 3PYKA 2NWZA 3EFIA 1I9NA 2CBBA 2NNVA 2NXRA 5E2RA 3ZP9A 2HKKA 5L3OA 3TVNX 1HEBA 3T84A 4M2RA 5E5UA 3MNJA 4Q78A 1CAJA 3KIGA 1BN1A 4MLTA 3RGEA 4JSWA 2NWOA 4ILXA 4ZX1A 5E2MA 4MLXA 4BF1A 1I9OA 1MOOA 1CNGA 5FNKA 4ZWIA 1IF5A 3KOKA 4Y0JA 3IEOA 4ZX0A 4ITPA 4Q49A 5EZTX 5EH8A 2NWYA 1G1DA 1G0EA 1KWRA 4FVNA 4FVOA 4LU3A 4YHAA 4R5AA 3PO6A 1UGGA 2POVA 3DD0A 1DMYA 1RJ5A 5E2SA 3TVOX 1YDCA 3OYSA 1UGDA 1I91A 3DBUA 4Q0LA 1AM6A 8CA2A 4CNRA 2NXTA 2X7TA 1BZMA 1BV3A 5DSIA 5FLQA 3SBHA 3P3HA 3CAJA 5DOGA 4L5VA 2ZNCA 3V3JA 3T83A 5IPZA 1CVCA 3RYZA 5BRWA 4KNNA 4XFWA 4E3GA 5E28A 3OYQA 4PXXA 2CABA 5G01A 2NXSA 5DSQA 3R17B 2FNNA 1IF4A 2QP6A 4Z1KA 1CVBA 5EIJA 5DRSA 1G4OA 3OY0A 4L5WA 4K0SA 1YDAA 3P5AA 5DOHA 1OKMA 3MDZA 5DSOA 1CA3A 4QIZA 2X7UA 5FDCA 1I8ZA 3ML5A 1JV0A 1G0FA 1TTMA 3JXHC 4JS6A 3U3AX 2HNCA 3RZ1B 4M2WA 4KUYA 4IDRX 4K0ZA 5JESB 2NMXA 5EKHA 4KV0A 1ZSCA 4QSIA 1BN3A 1HCAA 1CAIA 3BL0A 1EOUA 4R5BA 3W6HA 2FOUA 1G45A 4WW6A 4YYTA 2HL4A 4YX4A 3CYUA 4Q8YA 1IF7A 1UGCA 2AX2A 3M5EA 1CNHA 4MDLA 1BNMA 4DZ9A 5A6HA 4Q7SA 4Z1EA 3V3GB 3DD8A 1I9QA 4YGLA 2NN7A 4E5QA 3D8WA 2ABEA 4MO8A 5EKMA 4HBAA 4WL4A 5JGSB 1F2WA 5FL5A 5JGTB 4CNXA 4TWMA 3NJ9A 2VVAX 2EU3A 4CNWA 5SZ1A 4TWLA 5EHEA 3UYNA 1KEQA 3VBDA 4XIWA 1CRAA 5L6KA 4RUXA 4E9OX 1BNQA 1JCZA 1YO0A 1CAOA 5FL6A 1CNKA 3F8EA 3KNEA 4KAPA 2WD3A 1UGAA 1ZE8A 3DCSA 3M96A 1THKA 3M1WA 5E5RA 3RYJB 5CACA 4QY3A 3DVBA 3BETA 3DA2A 2GEHA 3M1KA 2FMGA 3KOIA 5JDVB 3V2MA 1LG6A 3T5UA 1BNWA 1TH9A 1UGFA 3DVCA 1CVHA 5AMGA 3RZ0B 2QO8A 3P55A 1LG5A 4QK1A 5FNMA 2QOAA 5AMDA 3S77B 4XE1A 4Z0QA 3B1BA 5G0BA 5DSNA 1ZFKA 3OKUA 3MHIA 3DV7A 3GZ0A 1ZSBA 3M5TA 4Q99A 3IBIA 1CVFA 1FQRA 3FE4A 4YVYA 3M1QA 1KOPA 3S73B 1CNCA 9CA2A 1CNYA 1IF9A 3D0NA 3ML2A 5LMDA 1I9MA 1BNVA 5DSLA 1CAZA 5G0CA 4MTYA 3MNHA 3Q31A 3MNIA 1J9WA 2Q1BA 3P4VA 3S97A 5JG5B 1Z93A 3MHCA 4N0XB 2WEOA 3IAIA 4QIYA 1AZMA 4Q7VA 4QK2A 1ZGEA 5SZ7A 1YO2A 2AW1A 2CBAA 4QSAA 2Q38A 3HKUA 1HCBA 12CAA 1BICA 4E3FA 1XEVA 4KUWA 4LP6A 3HFPA 1G3ZA 4RH2A 3M14A 4KP5A 4C3TA 4CACA 1CANA 1OQ5A 4KUVA 4MDMA 5DSRA 4M2VA 3P58A 1YDBA 2FOYA 3HS4A 3SAXA 1IF8A 3D93A 1RZAA 4UOVA 5J8ZA 1CNIA 4Q8ZA 3JXFA 3V2JA 4ITOA 4QJXA 1RZDA 1MUAA 3KS3A 3CZVA 4WUPA 1G54A 4Z1NA 3HLJA 3LXEA 1XEGA 3W6IA 4M2UA 1TB0X 3M67A 4ZWZA 4Q90A 1RAYA 4Q8XA 4QJWA 4Q7WA 3FFPX 2H15A 1V9IC 4Q9YA 2HOCA 1H9NA 3M98A 1CALA 3M2XA 1TG3A 1ZGFA 2FOSA 2FNKA 3MWOA 4YGFA 5JEPB 3RLDA 4FPTA 2WD2A 4K1QA 3C7PA 1G52A 3M40A 3MMFA 4QSJA 3S72B 2EZ7A 4RIVA 3OILA 1FSNA 1CAYA 1HVAA 2POWA 3MYQA 3OKVA 2WEGA 5BYIA 5FNLA 4KNIA 1CNJA 4L5UA 5SZ5A 2NWPA 5FNGA 3SAPA 1KOQA 1CRMA 4RUYA 4JSAA 1CZMA 3S9TA 3P3JA 5JG3B 4DZ7A 5AMLA 5JEHB 5DSPA 5CA2A 4HEZA 5SZ2A 4KNMA 3D92A 3CA2A 4QJOA 3S8XA 3M2ZA 1CAHA 2O4ZA 5CJFA 3RJ7A 1TG9A 1KWQA 3MNUA 4ZWYA 2WEHA 3IBNA 3KWAA 5DSKA 5A25A 3FW3A 5EOIA 5E2KA 4E49A 5FLRA 1RZBA 5BRVA 4JSSA 4Q81A 3U45X 3RYXB 5DVXA 3K7KA 5FLTA 4E4AA 1RZEA 3M2NA 3RYVB 3MHOA 4ZAOA 3TMJA 2X7SA 3DVDA 4HU1A 5FNIA 1ZFQA 4LHIA 4BF6A 4ETQC 2F14A 2OSMA 1RJ6A 4Q07A 5SZ0A 3R16A 4PQ7A 1HECA 2CBCA 3T85A 4HEYA 5SZ6A 2FMZA 4QJ0A 4Q09A 1G46A 1G53A 3QYKA 1YO1A 5FDIA 4G0CA 3U47A 4Q87A 5G03A
chains in the Genus database with same CATH topology
4QK3A 3DCCA 2POUA 4HEWA 5EHWA 1XPZA 4KP8A 5FLSA 3RZ7A 3HKNA 1DCBA 1ZNCA 3HKTA 1CILA 2GD8A 3D9ZA 1FQLA 3JXGA 5JQTA 1ZH9A 3V3HB 1LZVA 4CA2A 3P5LA 1CCTA 1OKLA 3RG4A 4RIUA 1CINA 1CAMA 3DAZA 1BNTA 3P44A 1H9QA 1IF6A 1URTA 3PJJA 3MZCA 4WUQA 5DSMA 4MDGA 1AVNA 3U7CA 1OKNA 3L14A 3M04A 5FNHA 1CNWA 2CA2A 4N16A 3K34A 5SZ3A 3N2PA 4CQ0A 3K2FA 3RYYA 3V7XA 4Q7PA 1RAZA 3F4XA 3N3JA 5FLOA 2CBEA 5EH7A 1XQ0A 1TEQX 4FIKA 4XZ5A 2EU2A 1FSRA 1LGDA 3IBUA 4BCWA 3DC3A 3OIKA 4YXIA 4GL1X 4YXOA 4Q83A 1I9PA 1CAKA 3RG3A 4QEFA 4COQA 1CA2A 3RZ8A 1FR7A 3IBLA 1BNNA 1UGEA 1DCAA 4RN4A 4FU5A 4PYYA 1ZSAA 4HF3A 2NNGA 1LUGA 1TEUX 3BL1A 1TE3X 1CCUA 5JEGB 5BRUA 1HEAA 3S75B 1FR4A 1HUHA 3T82A 4E3HA 4Q6EA 2WEJA 3MNKA 4FRCA 4Q06A 3NI5A 1BN4A 3OIMA 2FOVA 3MHLA 4RUZA 3V3IB 4YWPA 2H4NA 3M2YA 2OSFA 4YGNA 3MNAA 4K0TA 1CVDA 4JSZA 1T9NA 1TBTX 2NNSA 4Q08A 2CBDA 2HFWA 2HD6A 3KONA 4Z1JA 3KKXA 4PYXA 1H4NA 4ZWXA 2ILIA 4FL7A 1CNXA 3UYQA 4HT2A 1V9EA 5FL4A 4CNVA 2NN1A 3M3XA 2VVBX 3NB5A 1CIMA 1I90A 3F7BA 1HUGA 5CLUA 4YGKA 5FNJA 3S76A 3V3FA 1Z97A 4PZHA 3T5ZA 1YDDA 3HKQA 4YXUA 3M1JA 5SZ4A 1G4JA 3IGPA 6CA2A 4HT0A 4K13A 1G48A 3ZNCA 4X5SA 1Z9YA 1CVAA 1FSQA 4Q6DA 3S78B 1FLJA 1Y7WA 4G7AA 1A42A 4IWZA 2W2JA 3EFTA 3M5SA 3S71B 3N0NA 2FOQA 4RFCA 4RFDA 5EHVA 3RZ5A 1FQMA 3N4BA 4QTLA 1HEDA 4YGJA 3DCWA 5HPJA 3F7UA 3DC9A 5FLPA 5E2NA 4WR7A 3V5GA 1BNUA 3B4FA 5DSJA 1CVEA 4QJPA 7CA2A 1CCSA 3KLDB 1DMXA 2Q1QA 1FQNA 1I9LA 5C8IA 4R59A 1G6VA 2FNMA 5JQ0A 2FW4A 1CNBA 4WW8A 1RZCA 3MHMA 3SBIA 2IT4A 4XIXA 4QJMA 1BCDA 3S74B 4KNJA 5EKJA 4E3DA 5BNLA 1JD0A 1UGBA 5EH5A 2NNOA 4QSBA 3PYKA 2NWZA 3EFIA 1I9NA 2CBBA 2NNVA 2NXRA 5E2RA 3ZP9A 2HKKA 5L3OA 3TVNX 1HEBA 3T84A 4M2RA 5E5UA 3MNJA 4Q78A 1CAJA 3KIGA 1BN1A 4MLTA 3RGEA 4JSWA 2NWOA 4ILXA 4ZX1A 5E2MA 4MLXA 4BF1A 1I9OA 1MOOA 1CNGA 5FNKA 4ZWIA 1IF5A 3KOKA 4Y0JA 3IEOA 4ZX0A 4ITPA 4Q49A 5EZTX 5EH8A 2NWYA 1G1DA 1G0EA 1KWRA 4FVNA 4FVOA 4LU3A 4YHAA 4R5AA 3PO6A 1UGGA 2POVA 3DD0A 1DMYA 1RJ5A 5E2SA 3TVOX 1YDCA 3OYSA 1UGDA 1I91A 3DBUA 4Q0LA 1AM6A 8CA2A 4CNRA 2NXTA 2X7TA 1BZMA 1BV3A 5DSIA 5FLQA 3SBHA 3P3HA 3CAJA 5DOGA 4L5VA 2ZNCA 3V3JA 3T83A 5IPZA 1CVCA 3RYZA 5BRWA 4KNNA 4XFWA 4E3GA 5E28A 3OYQA 4PXXA 2CABA 5G01A 2NXSA 5DSQA 3R17B 2FNNA 1IF4A 2QP6A 4Z1KA 1CVBA 5EIJA 5DRSA 1G4OA 3OY0A 4L5WA 4K0SA 1YDAA 3P5AA 5DOHA 1OKMA 3MDZA 5DSOA 1CA3A 4QIZA 2X7UA 5FDCA 1I8ZA 3ML5A 1JV0A 1G0FA 1TTMA 3JXHC 4JS6A 3U3AX 2HNCA 3RZ1B 4M2WA 4KUYA 4IDRX 4K0ZA 5JESB 2NMXA 5EKHA 4KV0A 1ZSCA 4QSIA 1BN3A 1HCAA 1CAIA 3BL0A 1EOUA 4R5BA 3W6HA 2FOUA 1G45A 4WW6A 4YYTA 2HL4A 4YX4A 3CYUA 4Q8YA 1IF7A 1UGCA 2AX2A 3M5EA 1CNHA 4MDLA 1BNMA 4DZ9A 5A6HA 4Q7SA 4Z1EA 3V3GB 3DD8A 1I9QA 4YGLA 2NN7A 4E5QA 3D8WA 2ABEA 4MO8A 5EKMA 4HBAA 4WL4A 5JGSB 1F2WA 5FL5A 5JGTB 4CNXA 4TWMA 3NJ9A 2VVAX 2EU3A 4CNWA 5SZ1A 4TWLA 5EHEA 3UYNA 1KEQA 3VBDA 4XIWA 1CRAA 5L6KA 4RUXA 4E9OX 1BNQA 1JCZA 1YO0A 1CAOA 5FL6A 1CNKA 3F8EA 3KNEA 4KAPA 2WD3A 1UGAA 1ZE8A 3DCSA 3M96A 1THKA 3M1WA 5E5RA 3RYJB 5CACA 4QY3A 3DVBA 3BETA 3DA2A 2GEHA 3M1KA 2FMGA 3KOIA 5JDVB 3V2MA 1LG6A 3T5UA 1BNWA 1TH9A 1UGFA 3DVCA 1CVHA 5AMGA 3RZ0B 2QO8A 3P55A 1LG5A 4QK1A 5FNMA 2QOAA 5AMDA 3S77B 4XE1A 4Z0QA 3B1BA 5G0BA 5DSNA 1ZFKA 3OKUA 3MHIA 3DV7A 3GZ0A 1ZSBA 3M5TA 4Q99A 3IBIA 1CVFA 1FQRA 3FE4A 4YVYA 3M1QA 1KOPA 3S73B 1CNCA 9CA2A 1CNYA 1IF9A 3D0NA 3ML2A 5LMDA 1I9MA 1BNVA 5DSLA 1CAZA 5G0CA 4MTYA 3MNHA 3Q31A 3MNIA 1J9WA 2Q1BA 3P4VA 3S97A 5JG5B 1Z93A 3MHCA 4N0XB 2WEOA 3IAIA 4QIYA 1AZMA 4Q7VA 4QK2A 1ZGEA 5SZ7A 1YO2A 2AW1A 2CBAA 4QSAA 2Q38A 3HKUA 1HCBA 12CAA 1BICA 4E3FA 1XEVA 4KUWA 4LP6A 3HFPA 1G3ZA 4RH2A 3M14A 4KP5A 4C3TA 4CACA 1CANA 1OQ5A 4KUVA 4MDMA 5DSRA 4M2VA 3P58A 1YDBA 2FOYA 3HS4A 3SAXA 1IF8A 3D93A 1RZAA 4UOVA 5J8ZA 1CNIA 4Q8ZA 3JXFA 3V2JA 4ITOA 4QJXA 1RZDA 1MUAA 3KS3A 3CZVA 4WUPA 1G54A 4Z1NA 3HLJA 3LXEA 1XEGA 3W6IA 4M2UA 1TB0X 3M67A 4ZWZA 4Q90A 1RAYA 4Q8XA 4QJWA 4Q7WA 3FFPX 2H15A 1V9IC 4Q9YA 2HOCA 1H9NA 3M98A 1CALA 3M2XA 1TG3A 1ZGFA 2FOSA 2FNKA 3MWOA 4YGFA 5JEPB 3RLDA 4FPTA 2WD2A 4K1QA 3C7PA 1G52A 3M40A 3MMFA 4QSJA 3S72B 2EZ7A 4RIVA 3OILA 1FSNA 1CAYA 1HVAA 2POWA 3MYQA 3OKVA 2WEGA 5BYIA 5FNLA 4KNIA 1CNJA 4L5UA 5SZ5A 2NWPA 5FNGA 3SAPA 1KOQA 1CRMA 4RUYA 4JSAA 1CZMA 3S9TA 3P3JA 5JG3B 4DZ7A 5AMLA 5JEHB 5DSPA 5CA2A 4HEZA 5SZ2A 4KNMA 3D92A 3CA2A 4QJOA 3S8XA 3M2ZA 1CAHA 2O4ZA 5CJFA 3RJ7A 1TG9A 1KWQA 3MNUA 4ZWYA 2WEHA 3IBNA 3KWAA 5DSKA 5A25A 3FW3A 5EOIA 5E2KA 4E49A 5FLRA 1RZBA 5BRVA 4JSSA 4Q81A 3U45X 3RYXB 5DVXA 3K7KA 5FLTA 4E4AA 1RZEA 3M2NA 3RYVB 3MHOA 4ZAOA 3TMJA 2X7SA 3DVDA 4HU1A 5FNIA 1ZFQA 4LHIA 4BF6A 4ETQC 2F14A 2OSMA 1RJ6A 4Q07A 5SZ0A 3R16A 4PQ7A 1HECA 2CBCA 3T85A 4HEYA 5SZ6A 2FMZA 4QJ0A 4Q09A 1G46A 1G53A 3QYKA 1YO1A 5FDIA 4G0CA 3U47A 4Q87A 5G03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QK3 A;  3DCC A;  2POU A;  4HEW A;  5EHW A;  1XPZ A;  4KP8 A;  5FLS A;  3RZ7 A;  3HKN A;  1DCB A;  1ZNC A;  3HKT A;  1CIL A;  2GD8 A;  3D9Z A;  1FQL A;  3JXG A;  5JQT A;  1ZH9 A;  3V3H B;  1LZV A;  4CA2 A;  3P5L A;  1CCT A;  1OKL A;  3RG4 A;  4RIU A;  1CIN A;  1CAM A;  3DAZ A;  1BNT A;  3P44 A;  1H9Q A;  1IF6 A;  1URT A;  3PJJ A;  3MZC A;  4WUQ A;  5DSM A;  4MDG A;  1AVN A;  3U7C A;  1OKN A;  3L14 A;  3M04 A;  5FNH A;  1CNW A;  2CA2 A;  4N16 A;  3K34 A;  5SZ3 A;  3N2P A;  4CQ0 A;  3K2F A;  3RYY A;  3V7X A;  4Q7P A;  1RAZ A;  3F4X A;  3N3J A;  5FLO A;  2CBE A;  5EH7 A;  1XQ0 A;  1TEQ X;  4FIK A;  4XZ5 A;  2EU2 A;  1FSR A;  1LGD A;  3IBU A;  4BCW A;  3DC3 A;  3OIK A;  4YXI A;  4GL1 X;  4YXO A;  4Q83 A;  1I9P A;  1CAK A;  3RG3 A;  4QEF A;  4COQ A;  1CA2 A;  3RZ8 A;  1FR7 A;  3IBL A;  1BNN A;  1UGE A;  1DCA A;  4RN4 A;  4FU5 A;  4PYY A;  1ZSA A;  4HF3 A;  2NNG A;  1LUG A;  1TEU X;  3BL1 A;  1TE3 X;  1CCU A;  5JEG B;  5BRU A;  1HEA A;  3S75 B;  1FR4 A;  1HUH A;  3T82 A;  4E3H A;  4Q6E A;  2WEJ A;  3MNK A;  4FRC A;  4Q06 A;  3NI5 A;  1BN4 A;  3OIM A;  2FOV A;  3MHL A;  4RUZ A;  3V3I B;  4YWP A;  2H4N A;  3M2Y A;  2OSF A;  4YGN A;  3MNA A;  4K0T A;  1CVD A;  4JSZ A;  1T9N A;  1TBT X;  2NNS A;  4Q08 A;  2CBD A;  2HFW A;  2HD6 A;  3KON A;  4Z1J A;  3KKX A;  4PYX A;  1H4N A;  4ZWX A;  2ILI A;  4FL7 A;  1CNX A;  3UYQ A;  4HT2 A;  1V9E A;  5FL4 A;  4CNV A;  2NN1 A;  3M3X A;  2VVB X;  3NB5 A;  1CIM A;  1I90 A;  3F7B A;  1HUG A;  5CLU A;  4YGK A;  5FNJ A;  3S76 A;  3V3F A;  1Z97 A;  4PZH A;  3T5Z A;  1YDD A;  3HKQ A;  4YXU A;  3M1J A;  5SZ4 A;  1G4J A;  3IGP A;  6CA2 A;  4HT0 A;  4K13 A;  1G48 A;  3ZNC A;  4X5S A;  1Z9Y A;  1CVA A;  1FSQ A;  4Q6D A;  3S78 B;  1FLJ A;  1Y7W A;  4G7A A;  1A42 A;  4IWZ A;  2W2J A;  3EFT A;  3M5S A;  3S71 B;  3N0N A;  2FOQ A;  4RFC A;  4RFD A;  5EHV A;  3RZ5 A;  1FQM A;  3N4B A;  4QTL A;  1HED A;  4YGJ A;  3DCW A;  5HPJ A;  3F7U A;  3DC9 A;  5FLP A;  5E2N A;  4WR7 A;  3V5G A;  1BNU A;  3B4F A;  5DSJ A;  1CVE A;  4QJP A;  7CA2 A;  1CCS A;  3KLD B;  1DMX A;  2Q1Q A;  1FQN A;  1I9L A;  5C8I A;  4R59 A;  1G6V A;  2FNM A;  5JQ0 A;  2FW4 A;  1CNB A;  4WW8 A;  1RZC A;  3MHM A;  3SBI A;  2IT4 A;  4XIX A;  4QJM A;  1BCD A;  3S74 B;  4KNJ A;  5EKJ A;  4E3D A;  5BNL A;  1JD0 A;  1UGB A;  5EH5 A;  2NNO A;  4QSB A;  3PYK A;  2NWZ A;  3EFI A;  1I9N A;  2CBB A;  2NNV A;  2NXR A;  5E2R A;  3ZP9 A;  2HKK A;  5L3O A;  3TVN X;  1HEB A;  3T84 A;  4M2R A;  5E5U A;  3MNJ A;  4Q78 A;  1CAJ A;  3KIG A;  1BN1 A;  4MLT A;  3RGE A;  4JSW A;  2NWO A;  4ILX A;  4ZX1 A;  5E2M A;  4MLX A;  4BF1 A;  1I9O A;  1MOO A;  1CNG A;  5FNK A;  4ZWI A;  1IF5 A;  3KOK A;  4Y0J A;  3IEO A;  4ZX0 A;  4ITP A;  4Q49 A;  5EZT X;  5EH8 A;  2NWY A;  1G1D A;  1G0E A;  1KWR A;  4FVN A;  4FVO A;  4LU3 A;  4YHA A;  4R5A A;  3PO6 A;  1UGG A;  2POV A;  3DD0 A;  1DMY A;  1RJ5 A;  5E2S A;  3TVO X;  1YDC A;  3OYS A;  1UGD A;  1I91 A;  3DBU A;  4Q0L A;  1AM6 A;  8CA2 A;  4CNR A;  2NXT A;  2X7T A;  1BZM A;  1BV3 A;  5DSI A;  5FLQ A;  3SBH A;  3P3H A;  3CAJ A;  5DOG A;  4L5V A;  2ZNC A;  3V3J A;  3T83 A;  5IPZ A;  1CVC A;  3RYZ A;  5BRW A;  4KNN A;  4XFW A;  4E3G A;  5E28 A;  3OYQ A;  4PXX A;  2CAB A;  5G01 A;  2NXS A;  5DSQ A;  3R17 B;  2FNN A;  1IF4 A;  2QP6 A;  4Z1K A;  1CVB A;  5EIJ A;  5DRS A;  1G4O A;  3OY0 A;  4L5W A;  4K0S A;  1YDA A;  3P5A A;  5DOH A;  1OKM A;  3MDZ A;  5DSO A;  1CA3 A;  4QIZ A;  2X7U A;  5FDC A;  1I8Z A;  3ML5 A;  1JV0 A;  1G0F A;  1TTM A;  3JXH C;  4JS6 A;  3U3A X;  2HNC A;  3RZ1 B;  4M2W A;  4KUY A;  4IDR X;  4K0Z A;  5JES B;  2NMX A;  5EKH A;  4KV0 A;  1ZSC A;  4QSI A;  1BN3 A;  1HCA A;  1CAI A;  3BL0 A;  1EOU A;  4R5B A;  3W6H A;  2FOU A;  1G45 A;  4WW6 A;  4YYT A;  2HL4 A;  4YX4 A;  3CYU A;  4Q8Y A;  1IF7 A;  1UGC A;  2AX2 A;  3M5E A;  1CNH A;  4MDL A;  1BNM A;  4DZ9 A;  5A6H A;  4Q7S A;  4Z1E A;  3V3G B;  3DD8 A;  1I9Q A;  4YGL A;  2NN7 A;  4E5Q A;  3D8W A;  2ABE A;  4MO8 A;  5EKM A;  4HBA A;  4WL4 A;  5JGS B;  1F2W A;  5FL5 A;  5JGT B;  4CNX A;  4TWM A;  3NJ9 A;  2VVA X;  2EU3 A;  4CNW A;  5SZ1 A;  4TWL A;  5EHE A;  3UYN A;  1KEQ A;  3VBD A;  4XIW A;  1CRA A;  5L6K A;  4RUX A;  4E9O X;  1BNQ A;  1JCZ A;  1YO0 A;  1CAO A;  5FL6 A;  1CNK A;  3F8E A;  3KNE A;  4KAP A;  2WD3 A;  1UGA A;  1ZE8 A;  3DCS A;  3M96 A;  1THK A;  3M1W A;  5E5R A;  3RYJ B;  5CAC A;  4QY3 A;  3DVB A;  3BET A;  3DA2 A;  2GEH A;  3M1K A;  2FMG A;  3KOI A;  5JDV B;  3V2M A;  1LG6 A;  3T5U A;  1BNW A;  1TH9 A;  1UGF A;  3DVC A;  1CVH A;  5AMG A;  3RZ0 B;  2QO8 A;  3P55 A;  1LG5 A;  4QK1 A;  5FNM A;  2QOA A;  5AMD A;  3S77 B;  4XE1 A;  4Z0Q A;  3B1B A;  5G0B A;  5DSN A;  1ZFK A;  3OKU A;  3MHI A;  3DV7 A;  3GZ0 A;  1ZSB A;  3M5T A;  4Q99 A;  3IBI A;  1CVF A;  1FQR A;  3FE4 A;  4YVY A;  3M1Q A;  1KOP A;  3S73 B;  1CNC A;  9CA2 A;  1CNY A;  1IF9 A;  3D0N A;  3ML2 A;  5LMD A;  1I9M A;  1BNV A;  5DSL A;  1CAZ A;  5G0C A;  4MTY A;  3MNH A;  3Q31 A;  3MNI A;  1J9W A;  2Q1B A;  3P4V A;  3S97 A;  5JG5 B;  1Z93 A;  3MHC A;  4N0X B;  2WEO A;  3IAI A;  4QIY A;  1AZM A;  4Q7V A;  4QK2 A;  1ZGE A;  5SZ7 A;  1YO2 A;  2AW1 A;  2CBA A;  4QSA A;  2Q38 A;  3HKU A;  1HCB A;  12CA A;  1BIC A;  4E3F A;  1XEV A;  4KUW A;  4LP6 A;  3HFP A;  1G3Z A;  4RH2 A;  3M14 A;  4KP5 A;  4C3T A;  4CAC A;  1CAN A;  1OQ5 A;  4KUV A;  4MDM A;  5DSR A;  4M2V A;  3P58 A;  1YDB A;  2FOY A;  3HS4 A;  3SAX A;  1IF8 A;  3D93 A;  1RZA A;  4UOV A;  5J8Z A;  1CNI A;  4Q8Z A;  3JXF A;  3V2J A;  4ITO A;  4QJX A;  1RZD A;  1MUA A;  3KS3 A;  3CZV A;  4WUP A;  1G54 A;  4Z1N A;  3HLJ A;  3LXE A;  1XEG A;  3W6I A;  4M2U A;  1TB0 X;  3M67 A;  4ZWZ A;  4Q90 A;  1RAY A;  4Q8X A;  4QJW A;  4Q7W A;  3FFP X;  2H15 A;  1V9I C;  4Q9Y A;  2HOC A;  1H9N A;  3M98 A;  1CAL A;  3M2X A;  1TG3 A;  1ZGF A;  2FOS A;  2FNK A;  3MWO A;  4YGF A;  5JEP B;  3RLD A;  4FPT A;  2WD2 A;  4K1Q A;  3C7P A;  1G52 A;  3M40 A;  3MMF A;  4QSJ A;  3S72 B;  2EZ7 A;  4RIV A;  3OIL A;  1FSN A;  1CAY A;  1HVA A;  2POW A;  3MYQ A;  3OKV A;  2WEG A;  5BYI A;  5FNL A;  4KNI A;  1CNJ A;  4L5U A;  5SZ5 A;  2NWP A;  5FNG A;  3SAP A;  1KOQ A;  1CRM A;  4RUY A;  4JSA A;  1CZM A;  3S9T A;  3P3J A;  5JG3 B;  4DZ7 A;  5AML A;  5JEH B;  5DSP A;  5CA2 A;  4HEZ A;  5SZ2 A;  4KNM A;  3D92 A;  3CA2 A;  4QJO A;  3S8X A;  3M2Z A;  1CAH A;  2O4Z A;  5CJF A;  3RJ7 A;  1TG9 A;  1KWQ A;  3MNU A;  4ZWY A;  2WEH A;  3IBN A;  3KWA A;  5DSK A;  5A25 A;  3FW3 A;  5EOI A;  5E2K A;  4E49 A;  5FLR A;  1RZB A;  5BRV A;  4JSS A;  4Q81 A;  3U45 X;  3RYX B;  5DVX A;  3K7K A;  5FLT A;  4E4A A;  1RZE A;  3M2N A;  3RYV B;  3MHO A;  4ZAO A;  3TMJ A;  2X7S A;  3DVD A;  4HU1 A;  5FNI A;  1ZFQ A;  4LHI A;  4BF6 A;  4ETQ C;  2F14 A;  2OSM A;  1RJ6 A;  4Q07 A;  5SZ0 A;  3R16 A;  4PQ7 A;  1HEC A;  2CBC A;  3T85 A;  4HEY A;  5SZ6 A;  2FMZ A;  4QJ0 A;  4Q09 A;  1G46 A;  1G53 A;  3QYK A;  1YO1 A;  5FDI A;  4G0C A;  3U47 A;  4Q87 A;  5G03 A; 
#chains in the Genus database with same CATH topology
 4QK3 A;  3DCC A;  2POU A;  4HEW A;  5EHW A;  1XPZ A;  4KP8 A;  5FLS A;  3RZ7 A;  3HKN A;  1DCB A;  1ZNC A;  3HKT A;  1CIL A;  2GD8 A;  3D9Z A;  1FQL A;  3JXG A;  5JQT A;  1ZH9 A;  3V3H B;  1LZV A;  4CA2 A;  3P5L A;  1CCT A;  1OKL A;  3RG4 A;  4RIU A;  1CIN A;  1CAM A;  3DAZ A;  1BNT A;  3P44 A;  1H9Q A;  1IF6 A;  1URT A;  3PJJ A;  3MZC A;  4WUQ A;  5DSM A;  4MDG A;  1AVN A;  3U7C A;  1OKN A;  3L14 A;  3M04 A;  5FNH A;  1CNW A;  2CA2 A;  4N16 A;  3K34 A;  5SZ3 A;  3N2P A;  4CQ0 A;  3K2F A;  3RYY A;  3V7X A;  4Q7P A;  1RAZ A;  3F4X A;  3N3J A;  5FLO A;  2CBE A;  5EH7 A;  1XQ0 A;  1TEQ X;  4FIK A;  4XZ5 A;  2EU2 A;  1FSR A;  1LGD A;  3IBU A;  4BCW A;  3DC3 A;  3OIK A;  4YXI A;  4GL1 X;  4YXO A;  4Q83 A;  1I9P A;  1CAK A;  3RG3 A;  4QEF A;  4COQ A;  1CA2 A;  3RZ8 A;  1FR7 A;  3IBL A;  1BNN A;  1UGE A;  1DCA A;  4RN4 A;  4FU5 A;  4PYY A;  1ZSA A;  4HF3 A;  2NNG A;  1LUG A;  1TEU X;  3BL1 A;  1TE3 X;  1CCU A;  5JEG B;  5BRU A;  1HEA A;  3S75 B;  1FR4 A;  1HUH A;  3T82 A;  4E3H A;  4Q6E A;  2WEJ A;  3MNK A;  4FRC A;  4Q06 A;  3NI5 A;  1BN4 A;  3OIM A;  2FOV A;  3MHL A;  4RUZ A;  3V3I B;  4YWP A;  2H4N A;  3M2Y A;  2OSF A;  4YGN A;  3MNA A;  4K0T A;  1CVD A;  4JSZ A;  1T9N A;  1TBT X;  2NNS A;  4Q08 A;  2CBD A;  2HFW A;  2HD6 A;  3KON A;  4Z1J A;  3KKX A;  4PYX A;  1H4N A;  4ZWX A;  2ILI A;  4FL7 A;  1CNX A;  3UYQ A;  4HT2 A;  1V9E A;  5FL4 A;  4CNV A;  2NN1 A;  3M3X A;  2VVB X;  3NB5 A;  1CIM A;  1I90 A;  3F7B A;  1HUG A;  5CLU A;  4YGK A;  5FNJ A;  3S76 A;  3V3F A;  1Z97 A;  4PZH A;  3T5Z A;  1YDD A;  3HKQ A;  4YXU A;  3M1J A;  5SZ4 A;  1G4J A;  3IGP A;  6CA2 A;  4HT0 A;  4K13 A;  1G48 A;  3ZNC A;  4X5S A;  1Z9Y A;  1CVA A;  1FSQ A;  4Q6D A;  3S78 B;  1FLJ A;  1Y7W A;  4G7A A;  1A42 A;  4IWZ A;  2W2J A;  3EFT A;  3M5S A;  3S71 B;  3N0N A;  2FOQ A;  4RFC A;  4RFD A;  5EHV A;  3RZ5 A;  1FQM A;  3N4B A;  4QTL A;  1HED A;  4YGJ A;  3DCW A;  5HPJ A;  3F7U A;  3DC9 A;  5FLP A;  5E2N A;  4WR7 A;  3V5G A;  1BNU A;  3B4F A;  5DSJ A;  1CVE A;  4QJP A;  7CA2 A;  1CCS A;  3KLD B;  1DMX A;  2Q1Q A;  1FQN A;  1I9L A;  5C8I A;  4R59 A;  1G6V A;  2FNM A;  5JQ0 A;  2FW4 A;  1CNB A;  4WW8 A;  1RZC A;  3MHM A;  3SBI A;  2IT4 A;  4XIX A;  4QJM A;  1BCD A;  3S74 B;  4KNJ A;  5EKJ A;  4E3D A;  5BNL A;  1JD0 A;  1UGB A;  5EH5 A;  2NNO A;  4QSB A;  3PYK A;  2NWZ A;  3EFI A;  1I9N A;  2CBB A;  2NNV A;  2NXR A;  5E2R A;  3ZP9 A;  2HKK A;  5L3O A;  3TVN X;  1HEB A;  3T84 A;  4M2R A;  5E5U A;  3MNJ A;  4Q78 A;  1CAJ A;  3KIG A;  1BN1 A;  4MLT A;  3RGE A;  4JSW A;  2NWO A;  4ILX A;  4ZX1 A;  5E2M A;  4MLX A;  4BF1 A;  1I9O A;  1MOO A;  1CNG A;  5FNK A;  4ZWI A;  1IF5 A;  3KOK A;  4Y0J A;  3IEO A;  4ZX0 A;  4ITP A;  4Q49 A;  5EZT X;  5EH8 A;  2NWY A;  1G1D A;  1G0E A;  1KWR A;  4FVN A;  4FVO A;  4LU3 A;  4YHA A;  4R5A A;  3PO6 A;  1UGG A;  2POV A;  3DD0 A;  1DMY A;  1RJ5 A;  5E2S A;  3TVO X;  1YDC A;  3OYS A;  1UGD A;  1I91 A;  3DBU A;  4Q0L A;  1AM6 A;  8CA2 A;  4CNR A;  2NXT A;  2X7T A;  1BZM A;  1BV3 A;  5DSI A;  5FLQ A;  3SBH A;  3P3H A;  3CAJ A;  5DOG A;  4L5V A;  2ZNC A;  3V3J A;  3T83 A;  5IPZ A;  1CVC A;  3RYZ A;  5BRW A;  4KNN A;  4XFW A;  4E3G A;  5E28 A;  3OYQ A;  4PXX A;  2CAB A;  5G01 A;  2NXS A;  5DSQ A;  3R17 B;  2FNN A;  1IF4 A;  2QP6 A;  4Z1K A;  1CVB A;  5EIJ A;  5DRS A;  1G4O A;  3OY0 A;  4L5W A;  4K0S A;  1YDA A;  3P5A A;  5DOH A;  1OKM A;  3MDZ A;  5DSO A;  1CA3 A;  4QIZ A;  2X7U A;  5FDC A;  1I8Z A;  3ML5 A;  1JV0 A;  1G0F A;  1TTM A;  3JXH C;  4JS6 A;  3U3A X;  2HNC A;  3RZ1 B;  4M2W A;  4KUY A;  4IDR X;  4K0Z A;  5JES B;  2NMX A;  5EKH A;  4KV0 A;  1ZSC A;  4QSI A;  1BN3 A;  1HCA A;  1CAI A;  3BL0 A;  1EOU A;  4R5B A;  3W6H A;  2FOU A;  1G45 A;  4WW6 A;  4YYT A;  2HL4 A;  4YX4 A;  3CYU A;  4Q8Y A;  1IF7 A;  1UGC A;  2AX2 A;  3M5E A;  1CNH A;  4MDL A;  1BNM A;  4DZ9 A;  5A6H A;  4Q7S A;  4Z1E A;  3V3G B;  3DD8 A;  1I9Q A;  4YGL A;  2NN7 A;  4E5Q A;  3D8W A;  2ABE A;  4MO8 A;  5EKM A;  4HBA A;  4WL4 A;  5JGS B;  1F2W A;  5FL5 A;  5JGT B;  4CNX A;  4TWM A;  3NJ9 A;  2VVA X;  2EU3 A;  4CNW A;  5SZ1 A;  4TWL A;  5EHE A;  3UYN A;  1KEQ A;  3VBD A;  4XIW A;  1CRA A;  5L6K A;  4RUX A;  4E9O X;  1BNQ A;  1JCZ A;  1YO0 A;  1CAO A;  5FL6 A;  1CNK A;  3F8E A;  3KNE A;  4KAP A;  2WD3 A;  1UGA A;  1ZE8 A;  3DCS A;  3M96 A;  1THK A;  3M1W A;  5E5R A;  3RYJ B;  5CAC A;  4QY3 A;  3DVB A;  3BET A;  3DA2 A;  2GEH A;  3M1K A;  2FMG A;  3KOI A;  5JDV B;  3V2M A;  1LG6 A;  3T5U A;  1BNW A;  1TH9 A;  1UGF A;  3DVC A;  1CVH A;  5AMG A;  3RZ0 B;  2QO8 A;  3P55 A;  1LG5 A;  4QK1 A;  5FNM A;  2QOA A;  5AMD A;  3S77 B;  4XE1 A;  4Z0Q A;  3B1B A;  5G0B A;  5DSN A;  1ZFK A;  3OKU A;  3MHI A;  3DV7 A;  3GZ0 A;  1ZSB A;  3M5T A;  4Q99 A;  3IBI A;  1CVF A;  1FQR A;  3FE4 A;  4YVY A;  3M1Q A;  1KOP A;  3S73 B;  1CNC A;  9CA2 A;  1CNY A;  1IF9 A;  3D0N A;  3ML2 A;  5LMD A;  1I9M A;  1BNV A;  5DSL A;  1CAZ A;  5G0C A;  4MTY A;  3MNH A;  3Q31 A;  3MNI A;  1J9W A;  2Q1B A;  3P4V A;  3S97 A;  5JG5 B;  1Z93 A;  3MHC A;  4N0X B;  2WEO A;  3IAI A;  4QIY A;  1AZM A;  4Q7V A;  4QK2 A;  1ZGE A;  5SZ7 A;  1YO2 A;  2AW1 A;  2CBA A;  4QSA A;  2Q38 A;  3HKU A;  1HCB A;  12CA A;  1BIC A;  4E3F A;  1XEV A;  4KUW A;  4LP6 A;  3HFP A;  1G3Z A;  4RH2 A;  3M14 A;  4KP5 A;  4C3T A;  4CAC A;  1CAN A;  1OQ5 A;  4KUV A;  4MDM A;  5DSR A;  4M2V A;  3P58 A;  1YDB A;  2FOY A;  3HS4 A;  3SAX A;  1IF8 A;  3D93 A;  1RZA A;  4UOV A;  5J8Z A;  1CNI A;  4Q8Z A;  3JXF A;  3V2J A;  4ITO A;  4QJX A;  1RZD A;  1MUA A;  3KS3 A;  3CZV A;  4WUP A;  1G54 A;  4Z1N A;  3HLJ A;  3LXE A;  1XEG A;  3W6I A;  4M2U A;  1TB0 X;  3M67 A;  4ZWZ A;  4Q90 A;  1RAY A;  4Q8X A;  4QJW A;  4Q7W A;  3FFP X;  2H15 A;  1V9I C;  4Q9Y A;  2HOC A;  1H9N A;  3M98 A;  1CAL A;  3M2X A;  1TG3 A;  1ZGF A;  2FOS A;  2FNK A;  3MWO A;  4YGF A;  5JEP B;  3RLD A;  4FPT A;  2WD2 A;  4K1Q A;  3C7P A;  1G52 A;  3M40 A;  3MMF A;  4QSJ A;  3S72 B;  2EZ7 A;  4RIV A;  3OIL A;  1FSN A;  1CAY A;  1HVA A;  2POW A;  3MYQ A;  3OKV A;  2WEG A;  5BYI A;  5FNL A;  4KNI A;  1CNJ A;  4L5U A;  5SZ5 A;  2NWP A;  5FNG A;  3SAP A;  1KOQ A;  1CRM A;  4RUY A;  4JSA A;  1CZM A;  3S9T A;  3P3J A;  5JG3 B;  4DZ7 A;  5AML A;  5JEH B;  5DSP A;  5CA2 A;  4HEZ A;  5SZ2 A;  4KNM A;  3D92 A;  3CA2 A;  4QJO A;  3S8X A;  3M2Z A;  1CAH A;  2O4Z A;  5CJF A;  3RJ7 A;  1TG9 A;  1KWQ A;  3MNU A;  4ZWY A;  2WEH A;  3IBN A;  3KWA A;  5DSK A;  5A25 A;  3FW3 A;  5EOI A;  5E2K A;  4E49 A;  5FLR A;  1RZB A;  5BRV A;  4JSS A;  4Q81 A;  3U45 X;  3RYX B;  5DVX A;  3K7K A;  5FLT A;  4E4A A;  1RZE A;  3M2N A;  3RYV B;  3MHO A;  4ZAO A;  3TMJ A;  2X7S A;  3DVD A;  4HU1 A;  5FNI A;  1ZFQ A;  4LHI A;  4BF6 A;  4ETQ C;  2F14 A;  2OSM A;  1RJ6 A;  4Q07 A;  5SZ0 A;  3R16 A;  4PQ7 A;  1HEC A;  2CBC A;  3T85 A;  4HEY A;  5SZ6 A;  2FMZ A;  4QJ0 A;  4Q09 A;  1G46 A;  1G53 A;  3QYK A;  1YO1 A;  5FDI A;  4G0C A;  3U47 A;  4Q87 A;  5G03 A; 
#chains in the Genus database with same CATH homology
 4QK3 A;  3DCC A;  2POU A;  4HEW A;  5EHW A;  1XPZ A;  4KP8 A;  5FLS A;  3RZ7 A;  3HKN A;  1DCB A;  1ZNC A;  3HKT A;  1CIL A;  2GD8 A;  3D9Z A;  1FQL A;  3JXG A;  5JQT A;  1ZH9 A;  3V3H B;  1LZV A;  4CA2 A;  3P5L A;  1CCT A;  1OKL A;  3RG4 A;  4RIU A;  1CIN A;  1CAM A;  3DAZ A;  1BNT A;  3P44 A;  1H9Q A;  1IF6 A;  1URT A;  3PJJ A;  3MZC A;  4WUQ A;  5DSM A;  4MDG A;  1AVN A;  3U7C A;  1OKN A;  3L14 A;  3M04 A;  5FNH A;  1CNW A;  2CA2 A;  4N16 A;  3K34 A;  5SZ3 A;  3N2P A;  4CQ0 A;  3K2F A;  3RYY A;  3V7X A;  4Q7P A;  1RAZ A;  3F4X A;  3N3J A;  5FLO A;  2CBE A;  5EH7 A;  1XQ0 A;  1TEQ X;  4FIK A;  4XZ5 A;  2EU2 A;  1FSR A;  1LGD A;  3IBU A;  4BCW A;  3DC3 A;  3OIK A;  4YXI A;  4GL1 X;  4YXO A;  4Q83 A;  1I9P A;  1CAK A;  3RG3 A;  4QEF A;  4COQ A;  1CA2 A;  3RZ8 A;  1FR7 A;  3IBL A;  1BNN A;  1UGE A;  1DCA A;  4RN4 A;  4FU5 A;  4PYY A;  1ZSA A;  4HF3 A;  2NNG A;  1LUG A;  1TEU X;  3BL1 A;  1TE3 X;  1CCU A;  5JEG B;  5BRU A;  1HEA A;  3S75 B;  1FR4 A;  1HUH A;  3T82 A;  4E3H A;  4Q6E A;  2WEJ A;  3MNK A;  4FRC A;  4Q06 A;  3NI5 A;  1BN4 A;  3OIM A;  2FOV A;  3MHL A;  4RUZ A;  3V3I B;  4YWP A;  2H4N A;  3M2Y A;  2OSF A;  4YGN A;  3MNA A;  4K0T A;  1CVD A;  4JSZ A;  1T9N A;  1TBT X;  2NNS A;  4Q08 A;  2CBD A;  2HFW A;  2HD6 A;  3KON A;  4Z1J A;  3KKX A;  4PYX A;  1H4N A;  4ZWX A;  2ILI A;  4FL7 A;  1CNX A;  3UYQ A;  4HT2 A;  1V9E A;  5FL4 A;  4CNV A;  2NN1 A;  3M3X A;  2VVB X;  3NB5 A;  1CIM A;  1I90 A;  3F7B A;  1HUG A;  5CLU A;  4YGK A;  5FNJ A;  3S76 A;  3V3F A;  1Z97 A;  4PZH A;  3T5Z A;  1YDD A;  3HKQ A;  4YXU A;  3M1J A;  5SZ4 A;  1G4J A;  3IGP A;  6CA2 A;  4HT0 A;  4K13 A;  1G48 A;  3ZNC A;  4X5S A;  1Z9Y A;  1CVA A;  1FSQ A;  4Q6D A;  3S78 B;  1FLJ A;  1Y7W A;  4G7A A;  1A42 A;  4IWZ A;  2W2J A;  3EFT A;  3M5S A;  3S71 B;  3N0N A;  2FOQ A;  4RFC A;  4RFD A;  5EHV A;  3RZ5 A;  1FQM A;  3N4B A;  4QTL A;  1HED A;  4YGJ A;  3DCW A;  5HPJ A;  3F7U A;  3DC9 A;  5FLP A;  5E2N A;  4WR7 A;  3V5G A;  1BNU A;  3B4F A;  5DSJ A;  1CVE A;  4QJP A;  7CA2 A;  1CCS A;  3KLD B;  1DMX A;  2Q1Q A;  1FQN A;  1I9L A;  5C8I A;  4R59 A;  1G6V A;  2FNM A;  5JQ0 A;  2FW4 A;  1CNB A;  4WW8 A;  1RZC A;  3MHM A;  3SBI A;  2IT4 A;  4XIX A;  4QJM A;  1BCD A;  3S74 B;  4KNJ A;  5EKJ A;  4E3D A;  5BNL A;  1JD0 A;  1UGB A;  5EH5 A;  2NNO A;  4QSB A;  3PYK A;  2NWZ A;  3EFI A;  1I9N A;  2CBB A;  2NNV A;  2NXR A;  5E2R A;  3ZP9 A;  2HKK A;  5L3O A;  3TVN X;  1HEB A;  3T84 A;  4M2R A;  5E5U A;  3MNJ A;  4Q78 A;  1CAJ A;  3KIG A;  1BN1 A;  4MLT A;  3RGE A;  4JSW A;  2NWO A;  4ILX A;  4ZX1 A;  5E2M A;  4MLX A;  4BF1 A;  1I9O A;  1MOO A;  1CNG A;  5FNK A;  4ZWI A;  1IF5 A;  3KOK A;  4Y0J A;  3IEO A;  4ZX0 A;  4ITP A;  4Q49 A;  5EZT X;  5EH8 A;  2NWY A;  1G1D A;  1G0E A;  1KWR A;  4FVN A;  4FVO A;  4LU3 A;  4YHA A;  4R5A A;  3PO6 A;  1UGG A;  2POV A;  3DD0 A;  1DMY A;  1RJ5 A;  5E2S A;  3TVO X;  1YDC A;  3OYS A;  1UGD A;  1I91 A;  3DBU A;  4Q0L A;  1AM6 A;  8CA2 A;  4CNR A;  2NXT A;  2X7T A;  1BZM A;  1BV3 A;  5DSI A;  5FLQ A;  3SBH A;  3P3H A;  3CAJ A;  5DOG A;  4L5V A;  2ZNC A;  3V3J A;  3T83 A;  5IPZ A;  1CVC A;  3RYZ A;  5BRW A;  4KNN A;  4XFW A;  4E3G A;  5E28 A;  3OYQ A;  4PXX A;  2CAB A;  5G01 A;  2NXS A;  5DSQ A;  3R17 B;  2FNN A;  1IF4 A;  2QP6 A;  4Z1K A;  1CVB A;  5EIJ A;  5DRS A;  1G4O A;  3OY0 A;  4L5W A;  4K0S A;  1YDA A;  3P5A A;  5DOH A;  1OKM A;  3MDZ A;  5DSO A;  1CA3 A;  4QIZ A;  2X7U A;  5FDC A;  1I8Z A;  3ML5 A;  1JV0 A;  1G0F A;  1TTM A;  3JXH C;  4JS6 A;  3U3A X;  2HNC A;  3RZ1 B;  4M2W A;  4KUY A;  4IDR X;  4K0Z A;  5JES B;  2NMX A;  5EKH A;  4KV0 A;  1ZSC A;  4QSI A;  1BN3 A;  1HCA A;  1CAI A;  3BL0 A;  1EOU A;  4R5B A;  3W6H A;  2FOU A;  1G45 A;  4WW6 A;  4YYT A;  2HL4 A;  4YX4 A;  3CYU A;  4Q8Y A;  1IF7 A;  1UGC A;  2AX2 A;  3M5E A;  1CNH A;  4MDL A;  1BNM A;  4DZ9 A;  5A6H A;  4Q7S A;  4Z1E A;  3V3G B;  3DD8 A;  1I9Q A;  4YGL A;  2NN7 A;  4E5Q A;  3D8W A;  2ABE A;  4MO8 A;  5EKM A;  4HBA A;  4WL4 A;  5JGS B;  1F2W A;  5FL5 A;  5JGT B;  4CNX A;  4TWM A;  3NJ9 A;  2VVA X;  2EU3 A;  4CNW A;  5SZ1 A;  4TWL A;  5EHE A;  3UYN A;  1KEQ A;  3VBD A;  4XIW A;  1CRA A;  5L6K A;  4RUX A;  4E9O X;  1BNQ A;  1JCZ A;  1YO0 A;  1CAO A;  5FL6 A;  1CNK A;  3F8E A;  3KNE A;  4KAP A;  2WD3 A;  1UGA A;  1ZE8 A;  3DCS A;  3M96 A;  1THK A;  3M1W A;  5E5R A;  3RYJ B;  5CAC A;  4QY3 A;  3DVB A;  3BET A;  3DA2 A;  2GEH A;  3M1K A;  2FMG A;  3KOI A;  5JDV B;  3V2M A;  1LG6 A;  3T5U A;  1BNW A;  1TH9 A;  1UGF A;  3DVC A;  1CVH A;  5AMG A;  3RZ0 B;  2QO8 A;  3P55 A;  1LG5 A;  4QK1 A;  5FNM A;  2QOA A;  5AMD A;  3S77 B;  4XE1 A;  4Z0Q A;  3B1B A;  5G0B A;  5DSN A;  1ZFK A;  3OKU A;  3MHI A;  3DV7 A;  3GZ0 A;  1ZSB A;  3M5T A;  4Q99 A;  3IBI A;  1CVF A;  1FQR A;  3FE4 A;  4YVY A;  3M1Q A;  1KOP A;  3S73 B;  1CNC A;  9CA2 A;  1CNY A;  1IF9 A;  3D0N A;  3ML2 A;  5LMD A;  1I9M A;  1BNV A;  5DSL A;  1CAZ A;  5G0C A;  4MTY A;  3MNH A;  3Q31 A;  3MNI A;  1J9W A;  2Q1B A;  3P4V A;  3S97 A;  5JG5 B;  1Z93 A;  3MHC A;  4N0X B;  2WEO A;  3IAI A;  4QIY A;  1AZM A;  4Q7V A;  4QK2 A;  1ZGE A;  5SZ7 A;  1YO2 A;  2AW1 A;  2CBA A;  4QSA A;  2Q38 A;  3HKU A;  1HCB A;  12CA A;  1BIC A;  4E3F A;  1XEV A;  4KUW A;  4LP6 A;  3HFP A;  1G3Z A;  4RH2 A;  3M14 A;  4KP5 A;  4C3T A;  4CAC A;  1CAN A;  1OQ5 A;  4KUV A;  4MDM A;  5DSR A;  4M2V A;  3P58 A;  1YDB A;  2FOY A;  3HS4 A;  3SAX A;  1IF8 A;  3D93 A;  1RZA A;  4UOV A;  5J8Z A;  1CNI A;  4Q8Z A;  3JXF A;  3V2J A;  4ITO A;  4QJX A;  1RZD A;  1MUA A;  3KS3 A;  3CZV A;  4WUP A;  1G54 A;  4Z1N A;  3HLJ A;  3LXE A;  1XEG A;  3W6I A;  4M2U A;  1TB0 X;  3M67 A;  4ZWZ A;  4Q90 A;  1RAY A;  4Q8X A;  4QJW A;  4Q7W A;  3FFP X;  2H15 A;  1V9I C;  4Q9Y A;  2HOC A;  1H9N A;  3M98 A;  1CAL A;  3M2X A;  1TG3 A;  1ZGF A;  2FOS A;  2FNK A;  3MWO A;  4YGF A;  5JEP B;  3RLD A;  4FPT A;  2WD2 A;  4K1Q A;  3C7P A;  1G52 A;  3M40 A;  3MMF A;  4QSJ A;  3S72 B;  2EZ7 A;  4RIV A;  3OIL A;  1FSN A;  1CAY A;  1HVA A;  2POW A;  3MYQ A;  3OKV A;  2WEG A;  5BYI A;  5FNL A;  4KNI A;  1CNJ A;  4L5U A;  5SZ5 A;  2NWP A;  5FNG A;  3SAP A;  1KOQ A;  1CRM A;  4RUY A;  4JSA A;  1CZM A;  3S9T A;  3P3J A;  5JG3 B;  4DZ7 A;  5AML A;  5JEH B;  5DSP A;  5CA2 A;  4HEZ A;  5SZ2 A;  4KNM A;  3D92 A;  3CA2 A;  4QJO A;  3S8X A;  3M2Z A;  1CAH A;  2O4Z A;  5CJF A;  3RJ7 A;  1TG9 A;  1KWQ A;  3MNU A;  4ZWY A;  2WEH A;  3IBN A;  3KWA A;  5DSK A;  5A25 A;  3FW3 A;  5EOI A;  5E2K A;  4E49 A;  5FLR A;  1RZB A;  5BRV A;  4JSS A;  4Q81 A;  3U45 X;  3RYX B;  5DVX A;  3K7K A;  5FLT A;  4E4A A;  1RZE A;  3M2N A;  3RYV B;  3MHO A;  4ZAO A;  3TMJ A;  2X7S A;  3DVD A;  4HU1 A;  5FNI A;  1ZFQ A;  4LHI A;  4BF6 A;  4ETQ C;  2F14 A;  2OSM A;  1RJ6 A;  4Q07 A;  5SZ0 A;  3R16 A;  4PQ7 A;  1HEC A;  2CBC A;  3T85 A;  4HEY A;  5SZ6 A;  2FMZ A;  4QJ0 A;  4Q09 A;  1G46 A;  1G53 A;  3QYK A;  1YO1 A;  5FDI A;  4G0C A;  3U47 A;  4Q87 A;  5G03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...