3ONBA

Bond breakage and relocation of a covalently bound bromine of idd594 in a complex with har t113a mutant after extensive radiation dose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
311
structure length
311
Chain Sequence
ASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPAGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage reveals promising interaction position
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
total genus 102
structure length 311
sequence length 311
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3onbA00
2HE5A 4GCAA 2R24A 4YU1A 2I16A 4QR6A 3LENA 2DV0A 3LQLA 5HNUA 1AFSA 4GQGA 4JQ4A 2AGTA 4HMNA 4NKCA 2PDBA 3CAQA 4GIEA 4JQAA 2ACSA 3BCJA 2C91A 4FZIA 3S3GA 2IQDA 1SM9A 4LAZA 3UFYA 1HW6A 3D3FA 1AZ1A 3H7RA 4DBWA 1EF3A 2FZ8A 3MB9A 4EXBA 5DANA 4EXAA 4Q7BA 3GHSA 3UG8A 3RX2A 4FA3A 2IKIA 3WBWA 4I5XA 4WEVX 1T41A 1Q5MA 1X97A 3T42A 4JTAA 3QKZA 3R8GA 1LQAA 4XZIA 3LD5A 3O3RA 4Q3MA 3R58A 4XO6A 3GHUA 1LWIA 4WDXA 3GHTA 5M2FX 1EL3A 3ONBA 2FZBA 3R94A 2F2KA 1US0A 4L1XA 4DBSA 2PF8A 2PDMA 4FAMA 3UZYA 2PDNA 4PUWA 2INZA 1ZUAX 2A79A 1YNPA 4FALA 2ISFA 3V0UA 1RY0A 3R7MA 4PUUA 2FZ9A 4YVXA 4IGSA 1S1PA 1QWKA 3WBXA 3H7UA 2IPWA 2DUZA 4LB4A 4PMJA 3EB4A 1XGDA 4LB3A 3C3UA 4JQ2A 4GABA 2BGSA 1ADSA 3M64A 3G5EA 2PDLA 1XF0A 1K8CA 3M0IA 4DZ5A 1MRQA 2FVLA 2IQ0A 1IHIA 1Z3NA 2PDXA 1YE6A 2HDJA 1Z89A 2PDKA 1IEIA 3H4GA 3FX4A 5AZ1A 3R6IA 4XAPA 2NVDA 2BGQA 2PDQA 2FZDA 4GA8A 5LIXX 3Q65A 3UYIA 4H8NA 4XVDA 2R9RA 3LEPA 4YVPA 4YVVA 3LQGA 3N6QA 4JTQA 4GACA 3EB3A 3UZXA 2HE8A 3DN5A 3BUVA 2PDGA 4XO7A 3ONCA 2PD9A 3VXGA 2IPGA 4PR4A 3BURA 3B3DA 3Q67A 3ERPA 3R43A 2HV5A 2NVCA 4JQ3A 5LIYX 1PZ0A 1YE4A 1MZRA 1OG6A 4ZFCA 3WCZA 4PRRA 1VP5A 1HQTA 1MI3A 1PWLA 1Z8AA 1ZQ5A 4QBXA 3M4HA 4QXIA 2J8TA 4XZLX 2PDWA 1Z9AA 2P5NA 3CMFA 2ACUA 1EXBA 2PZNA 1ZSXA 1AH0A 3CV7A 1C9WA 1AH4A 3MC5A 3CASA 4JIHA 5JH2A 3FJNA 2PFHA 1M9HA 1RY8A 2HVNA 3LUTA 4IJCA 1JEZA 1J96A 4WGHA 4LBSA 5C7HA 4OTKA 3V0SA 5AZ0A 3KRBA 1AZ2A 3LZ5A 4WDWA 1GVEA 2INEA 2IPJA 3UP8A 5KETA 4IJRA 2DUXA 1UR3M 4JTCA 4R9OA 3GUGA 1ZGDA 3RX4A 3COTA 1PWMA 3CV6A 3WBYA 4LBRA 2ALRA 4ASTA 1VBJA 3WG6A 2PDUA 2PDIA 3O0KA 1AH3A 3DOPA 4AUBA 2VDGA 3G1RA 4WRHA 2FGBA 1S2CA 2PDCA 2PDHA 4JQ1A 1R38A 1EKOA 1XJBA 4YS1A 3V0TA 5LIKX 2I17A 3F7JA 2PDJA 2F38A 1FRBA 3LZ3A 3BV7A 4L1WA 4ICCX 3P2VA 4XK2A 4WDTA 1T40A 4XZHA 2WZMA 4JTDA 1QRQA 4QX4A 2WZTA 4JTRA 3LBOA 2QXWA 3UZWA 4WDUA 5HNTA 1PZ1A 3NTYA 3V36A 1X98A 2HEJA 4H7CA 1S1RA 4MHBA 3LNMA 2PDPA 2PD5A 2CLPA 4LAUA 2IKGA 1A80A 4HBKA 4F40A 3R8HA 2PDYA 4GQ0A 2IS7A 5HA7A 4JIRA 4XZMX 1S2AA 2IKHA 3UWEA 2PEVA 2ACRA 5JH1A 4XVEA 1X96A 3UZZA 3V35A 3EAUA 3CAVA 3UGRA 2PDFA 2IPFA 2ACQA 5LIWX 1Q13A 1PYFA 3U2CA 4JIIX 3GHRA 3LN3A 1YNQA 2HVOA 3N2TA 3RX3A 4PRTA 5LIUX 4G5DA 1RALA 4DBUA 4RPQA 4XZNX 2BP1A 2IKJA
chains in the Genus database with same CATH superfamily
2R1MA 3IGXA 1CPUA 2QJNA 3IACA 3PP7A 1C29A 4BR1A 1YNYA 2Y88A 4IIGA 2G3NA 3CQIA 2BWGA 3CQHA 4W87A 4WJXA 1JDCA 5TD4A 4NKCA 1C93A 2PDBA 3AYVA 1PBGA 5JQ9A 4GUHA 4C1NA 1SJCA 5GNXA 4E3TA 1L0PA 2D69A 2OQYA 3AHZA 3K5XA 5BOFA 5C9XA 4LAZA 4JTKA 2D3LA 4JTLA 2JKAA 1PSCA 4IUOA 1M5WA 3BW4A 3MUIA 1YMYA 2GJRA 1JPIA 4LRSA 1QK0A 4EXBA 3IK4A 1V8EA 1ME8A 2VX7A 4EXAA 3GHSA 2VC6A 1J79A 1TB3A 1GZJA 2JGQA 4L5ZA 3NYDA 3MZNA 3RYSA 2F2HA 1SZNA 4DI8A 1RQEA 3I4KA 1A5CA 3BSMA 4UB9A 4XZIA 2ZBTA 4Y2WA 2HCVA 2EKCA 5D05A 4YWIA 2BTMA 3CUJA 1ISZA 4K8EA 3FHQA 5TBOA 3O6AA 4FP1A 4KCVA 3R94A 3NDYA 4AFYA 3SUUA 3LCGA 4R9XA 7REQA 3OZYA 3Q2DA 1UR4A 4C7FA 1MYRA 5F2LA 2BVYA 2YA2A 4W9TA 5HDRA 2OLAA 4RDVA 5AECA 1TTPA 1FA2A 2C1GA 1J5SA 5DXXA 3HGSA 1ZBCA 5BU9A 3W1PA 3AYTA 2XSAA 5CH9A 3WEOA 3G1DA 4O54A 2MNRA 3N2XA 3MSYA 3UWVA 3MMTA 3W7KA 1X7FA 2RAGA 1H50A 2VR2A 3GQYA 4RX0A 3AS1A 3VABA 1KO0A 4P8XA 2ANUA 3H12A 3W2LA 3OPSA 3A22A 3O07A 3ELFA 4A21A 1L2QA 2E6AA 1TWWA 3O6CA 3WYZA 2HDJA 1A5MC 1UKTA 4K1WA 4M19A 1D7FA 3DFTA 3W2MA 2ZCGA 1UASA 1DHKA 2VEMA 4OBRA 4Z1YA 2XN1A 3KE0A 2PF0A 1FWAC 1T99A 2A1YA 3OA5A 1HL8A 3C2VA 1BTCA 2Q09A 3FV9A 3Q65A 2G37A 4IMEA 3QMRA 2Q02A 1M7OA 1JJKA 3CBWA 2NW0A 2V81A 5CPMA 1GZGA 3FKKA 2X40A 4IFOA 2CZ5A 1D7KA 1B54A 1Z41A 1PS9A 4GNJA 1HN1A 1J8VA 1YTEA 5FKYA 4IG2B 5A6LA 4BWLA 1IEQA 4M3PA 3DDMA 4XTDA 1O1HA 2R6OA 2WOQA 3PTDA 3TCEA 3N6HA 1SU5A 2FPVA 1TCDA 3M9YA 3S2CA 4A6GA 3NWRA 3L5LA 2RH9A 4PBGA 4DX3A 1VPQA 3PUGA 1EP2A 4WXYA 3T05A 1BG4A 3KZSA 5HQMA 1KFBA 2GDVA 4NYYA 1QNQA 2ZUMA 4O50A 3OGVA 4MGGA 5AYBA 1UP2A 4OBSA 4CNPA 1Q8JA 3AJXA 3NSNA 1Z48A 3PZUA 4TX9A 2BNJA 4X9SA 2A7RA 2CITA 4ZQOA 1NF0A 3AYRA 1R9ZA 1U83A 5D03A 1OFQA 1KXVA 1F6YA 1R2SA 4I8DA 5CJNA 2CIPA 1PV8A 2G3IA 2PWDA 2Z00A 3ANYA 4GX9A 1XCFA 4WDWA 2XUCA 3AMGA 1QNRA 1Q6GA 3OLGA 3S2MA 3E74A 4WX2A 3PG9A 4FNQA 4AC1X 1ZP3A 4FNRA 3CO8A 4MPKA 1OK6A 3ARWA 1XBXA 3IIOA 1PWMA 3A64A 4CQDA 3V18A 3TTEA 3G2GA 1JCYA 1W3JA 4DEFA 1W2PA 4U5IA 3OVRA 2DT0A 1J5TA 4XUGA 3UNTA 1X6UA 3WQ8A 3PVFA 1ZAHA 2DSWA 3S5SA 1CLXA 1EA0A 1U1HA 3VILA 3K1GA 1YDOA 3UJRA 4O0KA 1R86A 1MQPA 1IEVA 3UA4A 3TXVA 5IFPA 1NOFA 3MW7A 1H1NA 4GIAA 3DERA 3B8DA 5T8GA 4HU3A 2OYMA 4MJMA 4GXPA 3P60A 3PY2A 2C1IA 2Q6ZA 2XIIA 3UR7A 3EWYA 5I7GA 3D6NA 5CAKA 1V3JA 4I7VA 1EUAA 4J3XA 1JNEA 4MHBA 4PODA 1JDDA 1PTAA 3CWOX 2YCIX 3W7MA 2QNEA 4AYSA 3E9AA 1RV8A 3TP4A 4GQ0A 1K3UA 4J9JA 2J6XA 4GUJA 2D2HA 3OG2A 4M56A 4WGXA 2V67A 1GVFA 4YL2A 3UZZA 3BH4A 4IHCA 1WBJA 4FX7A 2BVTA 5EGRA 4I5UA 2AGKA 2DORA 2Z1VA 2I56A 1E6NA 3IAQA 3WF2A 3AHTA 3RFAA 4CVUA 2VVNA 3CPGA 1PHQA 3M44A 3U2CA 3GHRA 2GK1B 3L7RA 5FEPA 1UWUA 3N2TA 1JZ4A 2OEMA 1KCKA 2XGZA 3P81A 1W5OA 3TR9A 1P6WA 3C0LA 5CPQA 1XLKA 4JN8A 1XLLA 2V38A 3PJTA 4MIMA 3W7JA 2QDDA 3ATYA 1MUCA 1F3WA 3F4WA 4WD0A 4AIUA 2NWRA 1UZDA 2DV0A 5CGQA 3HPSA 4I6KA 3LU2A 2O56A 4AIEA 1E70M 4UFHA 3G8RA 3QBUA 3BCJA 3PPCA 1SSDA 1QI5A 4PZVA 1WUEA 3U2ZA 1BVZA 1UW9A 2E3ZA 1E6ZA 3B8IA 1S5TA 3ZSTA 3PWGA 3MB9A 3PTQA 1FWBC 3E0LA 2BXVA 4Q8VA 1TWDA 3G3DA 2A21A 5XINA 2QCLA 3S46A 2YJQA 4QTGA 1F3EA 4GFIA 2BXZA 4LF1A 3RHGA 3T7VA 3EDDA 2E25A 1I2RA 1WA3A 3GR8A 2ZXBA 4DNMA 3O3RA 4QISA 5G1MA 1CB7B 5C9UA 3HPXA 1EJTC 3TZFA 4DJDD 2OQLA 1TPEA 1GHRA 4N6EA 4F8XA 3RITA 3QHMA 3NQ6A 3UY8A 3WH5A 3O06A 1T6MA 3CL8A 3QR1A 5DEZA 3TN4A 1FP8A 2G5WA 4XQ6A 5FJUA 1IT8A 5G2HA 2EPMX 4QSHA 2ISFA 3QFWA 2BY3A 2WKGA 2C79A 3WELA 1LORA 4KESA 4XKMA 1BF2A 2VL4A 3TMLA 3VNYA 1E9IA 2WVVB 3EOSA 4FR1A 1OY0A 1KR0A 1O5RA 2BOEX 4J3UA 3S47A 2JBMA 2CKSA 2QF8A 3M0KA 1KFJA 4XBKA 2CERA 4N4QA 4DWDA 1ADSA 4NXKA 4O12A 1K8CA 4K2SA 2ZXDA 3NQ8A 1KM5A 2Z1KA 3VD4A 1T96A 5BXPA 3H23A 4CEXC 1XIBA 3L9CA 2PDKA 4NU7A 2E68A 1W37A 2GYIA 4KERA 5HMSA 5A8QA 3WDJA 5AC7A 4JS3A 1XLHA 2YCLB 3MV11 3GH7A 4H8NA 3KFTA 4S3KA 4NNCA 3T08A 2W62A 4CD4A 1L6WA 1HL9A 4DF0A 2CC0A 1UIPA 2JK2A 1W9VA 2JFEX 3TAOA 3ONCA 2PD9A 2HNEA 2IPGA 5KEZA 4O10A 3TTYA 1BPLB 2OTDA 4AWEA 3ITTA 1JDFA 4CUCA 3AIVA 5C0QA 1Z7AA 5C2XA 2FGZA 1OZQA 1PZ0A 3ZT7A 3QR0A 3VIOA 3KS6A 4YTTA 5JBFA 3NOEA 4TUFA 3MUCA 1US3A 4N2YA 3SIZA 1DIEA 2ZIDA 1UD3A 3SFKA 3EOLA 1DV7A 1ZSXA 1AH0A 5BNKA 2JGYA 2YIHA 4JIHA 3FJLA 1Q45A 3TC7A 3W23A 3H24A 4EPBC 3BLLA 5CBIA 3VD9A 4NZ4A 4JKLA 3A5FA 5DXYA 1ZAIA 7A3HA 4LGXA 4IP7A 2DIJA 2PWEA 3PBVA 4MAVA 3SBFA 5CJ5A 2Y89A 1IXQA 1XIGA 1LL6A 1TRDA 3HGRA 3KBJA 2XFYA 4ZO7A 2QF7A 1M7JA 3Q4DA 2BLEA 1VBJA 1XIHA 1OFOA 1NWTA 3WG6A 5JVLA 1WPCA 4M6PA 1JCNA 3O9NA 2GFTA 2W79A 1KGWA 7REQB 4CLMA 2YR1A 4CKQA 1S2CA 2ZZ3A 2WZEA 3REQA 4MDOA 5D9OA 6CGTA 2CHRA 3TQPA 2YXGA 1RR2A 5DT7A 2F38A 2ZVRA 1FRBA 4MNJA 4YHEA 2P8CA 4LYQA 4XK2A 4RNHA 5EMMA 4L65A 2WZMA 2OLHA 1QI0A 2ZA2A 4PCPA 3SFWA 3G1SA 3NM1A 3AJ7A 3CJPA 3IJ9A 2WPGA 1BAGA 1O60A 2WMJA 1WE5A 3S42A 3L5MA 3B0UX 1IR1A 5FF7A 1UA3A 1BWKA 1H60A 1ML1A 4F48A 3M41A 4TXEA 3OBAA 2PTZA 3VM5A 3R8HA 1EP3A 1ENUA 3BV4A 3ANUA 4H01A 2C7FA 4Y9OA 4EOUA 1DP0A 1DJQA 5KZEA 3L2MA 3WQ5A 2I1OA 2IKHA 1JXKA 1FCVA 4RPPA 1QT1A 1R47A 3W7QA 4AZGA 4DF2A 4B15A 2J4GA 1GKRA 3EOUA 2PZ0A 4CEUC 3EAUA 5E9XA 3EMCA 3MUAA 2CESA 1A47A 4NX0A 3WQVA 4J3WA 1DOSA 4ZO6A 2GQAA 2NQJA 3TX9A 1ZBWA 3V3WA 1VBGA 3U5YA 3HQOA 1B30A 4CN1A 4KGLA 1VBHA 4RPQA 4TV6A 5FJPA 3LPPA 3ZFHA 5FL0A 3NQBA 3GU1A 5JU6A 1WZLA 4H83A 4G1NA 3WJXA 5CZJA 5K4XA 4OOUA 2HBXA 4US6A 4WHBA 3VAVA 1HF6A 3ABZA 2WZIA 3N29A 4NAEB 3TYBA 2IQDA 4QDWA 3NZRA 5EBAA 4D2JA 3N9KA 4O1BA 4X60A 2ZRZA 3M0HA 2XWEA 1BYAA 1AZ1A 1YXYA 4QIUA 4WZHA 3GG1A 4RV3A 3ZOAA 3VDGA 3W2NA 2C16A 5DANA 3APYA 1UOKA 4Q7BA 3S9ZA 3TZNA 3N17A 4RW3A 1G1YA 2J13A 3FVMA 1TV5A 1IT7A 4RCXA 3O15A 1B4KA 5HR7A 4LS1A 2J24A 3T42A 3W6LA 2QMJA 1TA3B 1UQZA 3PWIA 4JFUA 3K30A 3N18A 1W31A 1FHLA 3LD5A 2FDMA 2QV5A 1V3IA 2Y85A 3BLIA 3C2RA 2RUSA 3PK7A 4G2DA 2WSPA 3ZM8A 3NDZA 1HG3A 1MW1A 4FI4A 3W07A 4Z1AA 2DT2A 4DBSA 2PF8A 3GUWA 2AOSA 1UP3A 4TVDA 3H2NA 5DX7A 1K02A 3GDTA 3VD7A 1K9FA 4KS0A 1QPRA 2GGJA 3C4UA 1NEYA 4GVHA 3C8NA 2FTWA 1GVYA 4P8WA 4TTGA 2OX1A 1I9CB 3BICA 3W6YA 3TN5A 4UFJA 1SMAA 3H7UA 3SRDA 1JYNA 5GNZA 3JZEA 1K7XA 3WLIA 1OFBA 1F9CA 3MSGA 3BANA 4PMJA 2W3ZA 3KVKA 4LB3A 4UZSA 2VFIA 2VOTA 1ECQA 1VIWA 3L4XA 4W7VA 1KRAC 1FWWA 3M64A 4L56A 1PVNA 4IISA 4XD6A 1L6GA 2PGRA 4MY1A 3AAMA 1GONA 1UMYA 4L1GA 3MBFA 3UG3A 5BMXA 1GVIA 1DEDA 2ISSA 4I9TA 1U1JA 4Z17A 1YE6A 2ZUVA 4PUKA 2PE4A 3CIXA 1IEIA 5T9CE 4UTUA 1DXEA 2PGWA 3W7IA 1NDZA 1JCTA 2ADAA 3SCWA 4HNVA 3S9YA 3VGDA 2RFGA 1ITCA 5LIXX 1V03A 4NILA 3BQ6A 2UBPC 4QAIA 5C5YA 1JAKA 5DCEA 1PKYA 4CCEA 4HB7A 3P7YA 3ITVA 3BUVA 1KRMA 2FHFA 1MUWA 3B06A 4TVUA 1QHPA 4AIBA 3MS8A 3EEZA 2GUYA 1UJQA 3Q67A 4JHZA 2YKKA 2NVCA 4CNNA 1MVYA 3AALA 3QJAA 3ABQA 3RCNA 2D0FA 3QFEA 4AEFA 2E40A 4YMZA 2ZDSA 3RU6A 1GTEA 2UV8G 2DVTA 3NVDA 3ARYA 3ZZ1A 3GO2A 2ZICA 3PNUA 1RQHA 3VIHA 2YX0A 1QPQA 3O2LA 2PDWA 5CZTA 4Z2KA 1DJNA 2G0WA 4MB3A 1EB3A 2J88A 4UOJA 1H41A 1UP0A 2VDIA 6TIMA 1AQ0A 6PTDA 3WJSA 4AD3A 1G0CA 3GH4A 2DSKA 1SO4A 1K7EA 2QW5A 2MANA 4Q8MA 4RE3A 5HAOA 3N4FA 2W5FA 5D33A 5C71A 4D6EA 3F4NA 1WZMA 4MJ2A 1XD0A 4KWWA 4JEJA 1WAWA 5A2AA 3GKAA 5GJPA 1ZGDA 3FXGA 2A7NA 4H6EA 3CNYA 5BWFA 4UTWA 5MF5A 2BB0A 4JIEA 1EDGA 1ZL1A 4BF5A 2PCQA 3TVAA 1DHPA 4EWND 4P8UA 1EC7A 4ERAA 1VEPA 3W7PA 4C6EA 4A8NA 3HU7A 2X05A 1DORA 4AUBA 2E9LA 1F6PA 5TF0A 1LJYA 2YB1A 4RK8A 4AISA 2PDCA 1LBFA 4JFVA 2OMAA 1G01A 3JU2A 4EF8A 3OP2A 3TN3A 1RBOB 4J5NA 5LIKX 4AZ7A 1TV7A 4US5A 4OIFA 3TMQA 1LLWA 3S2LA 2FJKA 5KINA 2OO6A 3WLPA 4HTBA 4JPGA 4S3AA 5IOBA 4XZHA 4P7OA 3UXKA 3ARSA 2DZTA 4LOCA 6XIAA 2VR5A 5HNTA 1D3CA 1YDYA 2HXUA 1MQRA 3C52A 2QGYA 3G1XA 4N42A 4HCHA 1HUVA 4AH7A 2HEJA 3LXBA 1AJZA 2YBUA 2YA1A 3LNMA 4IMGA 4PMDA 1Q65A 4DLMA 4XISA 2R1LA 2V30A 2YGYA 2AL1A 2XZ7A 3FSUA 4RL3A 3H4XA 5G2IA 3NUKA 4QG8A 3IIXA 1OD0A 5F1VA 3M16A 2EXOA 1S2AA 4WKFA 3M07A 5GNYA 3WH7A 3FGCA 1RJPA 4N4PA 4WY0F 1DBTA 3EX4A 4S3JA 3TJ4A 2ZX5A 3PF3A 4ZVJA 5PTDA 3V35A 3CWHA 4WR3A 1T5AA 1IEXA 3C5QA 2DGAA 4J4KA 4Q6XA 4M6VA 1EDTA 2CLLA 4ORIA 4C1LA 5A6AA 2HXTA 3BVJA 2X1IA 3P0XA 1YNQA 1HKWA 3MVTA 5G4WA 3U48A 2J9XA 5AFDA 2VQTA 4ADUA 1Z42A 5CGMA 1LG1A 1UH2A 4UOQA 1YXCA 2F9RA 3N11A 4WSHA 1ZP4A 1RJRA 2V2HA 2R24A 3IUDA 1ZAJA 2I16A 3THUA 4QJ3B 1XH1A 3G8EA 3RN6A 2E6FA 2V9DA 1XS2A 3B9AA 3CYJA 4QLJA 2AQOA 3Q45A 2BMBA 2TPSA 1UJPA 2ALDA 3URAA 2WMGA 4H41A 3GBEA 3R4IA 1FHUA 2CLHA 1CGTA 3NGJA 1TJ0A 2GQ9A 1XKJA 1WKYA 5A2CA 4JN6A 4HPNA 1XXXA 3CH9A 1H2JA 4TR9A 1UCWA 4X61A 2J7HA 2OT1A 1EJXC 1BVWA 4NI3A 3JUGA 5ECVA 2G3MA 3UESA 1R7AA 1KGXA 4S3BA 3NM3A 3NZGA 2OEJA 3MT1A 3GR4A 1AG1O 3N13A 4J7RA 4HCDA 3K2GA 1QNPA 2NQZA 2DPEA 1V6VA 1GVQA 1O5KA 3WUEA 4HZ8A 1UUMA 4DPPA 5LNVA 3MCOA 2V5LA 1AUSL 3KVJA 3EA2A 3SUWA 3HMCA 1CXKA 3B9DA 4J3TA 1L8NA 3CUHA 1A5BA 1BHGA 1JI2A 4M8UA 2FPTA 3NQMA 3LHZA 2RDXA 3GVWA 1CGWA 4RE4A 5D04C 2HVMA 1AW1A 3WD1A 1XFBA 1UH4A 4E8GA 1A3XA 3LGEA 2J27A 4C6FA 1BLIA 1I1XA 3U2OA 5K9XA 2GGGA 4H8HA 4GI9A 3KTCA 2B7OA 3VNMA 2FZ9A 1S1PA 2VOMA 1P48A 1BXBA 1HJXA 4MOZA 4J2MA 1XSKA 3OGRA 3N2MA 4QDPA 4GNKB 1JZ6A 1OX4B 2PTXA 3TUUA 3QZEA 1UR8A 3B8VA 2A0NA 4DJDA 2WNZA 5DCBA 2NX1A 1IGWA 5U4NA 3VZZA 4S23A 3KL0A 1FWNA 3CTLA 2QIWA 3T0TA 5GJMA 4FNUA 7ODCA 3IJLA 2YZ5A 1FQ0A 3UR8A 5CSYA 1P0NA 5EMLA 1TPWA 1ZLPA 4RE0A 5M03A 1IHIA 3GTXA 4P7RA 3OODA 4JFTA 1DQWA 1JZ7A 4GGBA 3CZEA 2ZRVA 3NZQA 4R7OA 1XIJA 2WB5A 1XRFA 2WNNA 2FZDA 2V2DA 3VIKA 4IT1A 1KR1A 4PYSA 2I7GA 3EGJA 2R9RA 3LEPA 4ROQA 3D0CA 2WW5A 4H9ZA 1W3NA 3W85A 3LQGA 1ONEA 1JCXA 3CQJA 3SCSA 4YPJA 4L4MA 4LAOA 1W3TA 2HE8A 1IR2A 2DZAA 3UXDA 3RPDA 3VUSA 2VRQA 2ZUUA 3M5ZA 1XG4A 2PDGA 5E0FA 5D32A 1XRSA 2R1NA 1YKWA 4DWSA 2NX3A 1WX0A 3PWAA 1EJ7L 2XM1A 3FS2A 5A95A 3ERPA 3VNIA 2D0GA 1KV8A 3SJNA 2B31A 1JF5A 4LSBA 1ZZMA 3G77A 4R3UA 3OW1A 2YXOA 3FYOA 2W66A 4PL2A 2OSWA 1LF1A 2PWHA 6REQA 4AAJA 1QO5A 1NSJA 1TV8A 4CD8A 2FMNA 3G1FA 1HX0A 3RM9A 3PN8A 4KWSA 1V4YA 3VUPA 1GWJA 1VBUA 1WNOA 5IBXC 1RY8A 4U3AA 1BGAA 4AY1A 4MF4A 2ZC8A 4H00A 2Y8KA 4AVFA 1I2NA 5AZ0A 3NL3A 3UR5A 3UW6A 1OB0A 2QDGA 3PZMA 4ZOEA 3F2CA 1I2OA 1QOQA 3OQEA 2INEA 2W6RA 1QU4A 5DLCA 1OIMA 3NNTA 1W3HA 3L5AA 1BWVA 1CI1A 5HWNA 1CGUA 1S2UA 4NJHA 1AW5A 3OVQA 3WQ6A 4LRTA 1OSEA 3S6OA 1M7XA 3QMTA 2FLIA 5A8PA 2PDUA 4RUBA 1NU5A 4GC4A 3EPNA 1OZMA 1TRIA 5ENLA 1Q66A 3LLFA 4W86A 2J25A 3QV6A 4KRTA 2WKLA 1R2TA 1B9ZA 1FHVA 1ZCCA 1LL7A 2J75A 1EUNA 3I10A 2GUBA 4YS1A 4Y9NA 1DL3A 2EPHA 2J66A 2VI0A 3OO2A 4F2BA 1P7TB 4L1WA 3WO8A 2ZKMX 1IE7C 3W1LA 1XFCA 1HXJA 2VUYA 3VC6A 4KKXA 1I0DA 2J74A 3QQ1A 4LS0A 1NFPA 3UJEA 4Q4PA 1IZJA 2A4AA 4HNUA 1Q85A 2QGHA 1CX9A 3PS7A 4ZTYA 5EL1A 1Y7VA 1B3XA 1MUMA 1FY6A 4H7VA 1H61A 3PR2A 1A80A 4RR4A 1UUOA 1NWUA 1KFLA 1ZALA 1HGYA 4UQBA 3RCYA 3DESA 5LXXA 2OSXA 3AUOA 5LNUA 3HO8A 3KBWA 2R8WA 1VENA 3GBDA 5HR6A 3TYAA 4LH8A 2VKZG 3VIGA 3V16A 4UTKA 1TELA 4Q4MA 3ZLGA 1E9YB 5AHIA 4Q8WA 3MUXA 1VF8A 2VEGA 2IPFA 2NZLA 4UFLA 4M7TA 8RUCA 3WD0A 1HTIA 4QGCA 2FPYA 3W72A 2NQHA 5TNVA 2YYUA 1ISWA 1E3ZA 2GVLA 4ADTA 1JRCA 1WBHA 4GBUA 1PKNA 5E6ZA 4W88A 2WSKA 2GVYA 1UD2A 1TPB1 1J0JA 3AIBA 2ISDA 3HZ3A 5A3HA 3NIYA 1TX2A 4EPEC 4W8AA 1XBZA 5FAJA 1QUMA 3LI0A 3IK2A 2Z24A 3DG6A 2OELA 3I4EA 3EX6A 4ZO9A 1CDGA 5F2IA 4NASA 2OOFA 4ZXLA 1DJGA 1EWDA 1M03A 1ELSA 2PTWA 4QAWA 3USZA 4DPQA 2W0UA 3EX2A 2IQTA 3TTOA 1W8GA 3WQOA 2FTYA 2C91A 2VWSA 1C8XA 4QFUA 4I5RA 3LG3A 3ZJ8A 1KXHA 5FAGA 5CZSA 4QP0A 5KZMA 3KCOA 3R89A 1FWEC 3VFLA 2Q3RA 3D3FA 3SCOA 3WH6A 1GHSA 2QVHA 2P76A 3IJIA 3BWWA 3LV6A 3M7WA 2XTKA 2QEZA 3WN6A 3ICJA 1FTXA 2PMQA 3NYZA 3S6DA 1Q5MA 2EPOA 4RLIA 2IW0A 1AQMA 4C65A 5AHFA 2ZZ6A 1KV5A 1QW8A 2YCEA 4S3EA 4Y96A 1PX3A 3O6YX 2VFHA 2GSEA 3VCCA 2GSJA 3OVPA 4RE2A 2I14A 3WNLA 1SJBA 2FZBA 1PIIA 1UKSA 3MYPA 4I7WA 4NRSA 1D2KA 1JUKA 5J5DA 3KTSA 4ERIA 3WH8A 3MO4A 1FCUA 3LK6A 4E4FA 2JE8A 4JDYA 2QCMA 2CZEA 3V0UA 5E0CA 3H2EA 1ZHAA 3POCA 4K38A 3NSMA 5AYXA 4NT0A 4A22A 3IAPA 3M43A 5T91A 3U6WA 3EB4A 4B5XA 1NVMA 2VZUA 4DYJA 2EG7A 2QJJA 2R1KA 2NLYA 4GABA 1H5YA 2DIKA 1EIXA 1J0KA 1EGVA 3BCFA 1U5JA 1EQPA 1XLGA 5LGZA 3THCA 1QHZA 3IRSA 1X6LA 3SY8A 4CN4A 1TR1A 4MWAC 4F4RA 4LS2A 2Q8XA 4OV9A 1YPXA 1O68A 4OWGA 3U0HA 1ISXA 2PS2A 4BHYA 5KTLA 4PUJA 3M0LA 5M5DA 1GK8A 2VEPA 2V5BA 3WL1A 7TIMA 2X42A 1EGMA 1A0CA 1V08A 2Q8LA 3WD3A 1J01A 4GYKA 1RK5A 3RR4A 1SQ7A 1PB0A 2X7VA 4FXSA 1PKLA 4HHMA 1SVDA 1YEYA 2VEFA 3S9IA 4R88A 5BMWA 4O53A 5J5RA 4EVZA 1ZY9A 2Z2UA 3PJWA 4GVIA 3R43A 4J3ZA 4DQWA 1NDVA 1JRBA 3DFOA 4JQ3A 2ODOA 4GY7A 3GAYA 4H7ZA 2PBOA 4MTVA 1E55A 5MHBA 1YE4A 1H62A 3N15A 2VZTA 4QSFA 2BG5A 4FOKA 3SAZA 2JIWA 5CEWA 1AD1A 3GAKA 5M17A 3AUJA 3WF4A 1XYZA 5F2GA 3TW7A 4JBRA 3VDCA 3B0PA 2ACUA 3MP3A 4JTFA 3MHGA 2WV8A 3PZ9A 3GXIA 2Z7GA 2WWDA 3HQ1A 2PFHA 3QKEA 4UNKA 5G1TA 4J3VA 5JUVA 1JEZA 4B91A 4ORMA 4ADSA 2QYGA 1CECA 5REQA 3GNNA 3A4JA 1MNSA 2ZA1A 1BTMA 3AMLA 5C70A 3UP8A 4O57A 2DUXA 3DG3A 1G4SA 4UTLA 1PEZA 1BYDA 1IF2A 4A35A 4OU1A 3M0XA 2J7GA 3HPFA 2C0AA 3GUGA 3CQKA 4QROA 3BAIA 3H22A 4FSAA 1VIZA 1W9DM 4EWJA 1LOSA 3C0JA 4AYGA 1X6NA 3CK5A 2PDIA 3L2LA 1XLEA 3AZRA 1FXPA 4WF7A 1JZ2A 3L0KA 1UHVA 5BRBA 1YDVA 4LX4A 1NDYA 1OD8A 1RSCA 1TPC1 4L6OA 2YA0A 2FKPA 3D5HA 1R3WA 2ZUNA 1F07A 1SJAA 3CO4A 3VIJA 4UMBA 4LUYA 3CB8A 5HJXA 4GI4A 3NO1A 1LZOA 5B7YA 4O28A 3BZJA 5BXTA 3QH2A 2E9BA 3F5LA 1FH7A 4D71A 2Y0FA 2PDJA 1QPKA 1XBVA 4E5TA 2QUTA 3LZ3A 2HZGA 2W4XA 2Z4GA 4ICCX 3WUGA 4B4FA 1YIXA 1E5JA 2GGIA 4O0ZA 1KWGA 1YXDA 3NAVA 3IUIA 2VX4A 4AY8A 1NTHA 3V36A 2GK1A 2J62A 2IXVA 5D30A 2I9EA 1XLIA 3CB3A 4QEEA 3BGAA 2CU0A 1XIFA 4O13A 5FF3A 3RLHA 2PRLA 4UTFA 1RA0A 5A6SA 3WNPA 3VZXA 1A5AA 2W67A 2EQDA 3L4TA 3A6OA 3W37A 3QRHA 3SRKA 2HK0A 4XZMX 2E8ZA 1LTDA 3S1WA 3WENA 2XVPA 4AY7A 1UIOA 3UT0A 1CW2A 3QC3A 2RGLA 1ME7A 1IXNA 2ACRA 4NF7A 1X96A 3ARRA 5D2VA 3A3XA 2XISA 3AISA 2V8ZA 3GFZA 1GJPA 3UWZA 4IG2A 4V1XA 2DH2A 2JF6A 3AMDA 1KBIA 1TUXA 4JIIX 3VDBA 1HKMA 2ZUTA 3LERA 4AXNA 4ZR8A 4FXRA 1FWSA 3W2JA 2CBIA 4YTSA 1XLDA 4DBUA 1CCWB 1EF2A 4TIMA 3N73A 1J4EA 1I1WA 4ATLA 3O63A 1FOBA 3P5ZA 2W27A 4W89A 3QHNA 3WNNA 4Q33A 5AKQA 4MAZA 4GI6A 3WQ4A 5C2CA 4M7SA 4DAFA 1PAMA 2RGMA 3RLGA 2D23A 2ZXQA 3GG0A 2VELA 5F4SA 4J1OA 4D1JA 3UGVA 4BY3A 1IIHA 4RNFA 3BL3A 1P1XA 3CYVA 3CV1A 1AJ0A 3W22A 1HW6A 1WDRA 1I2QA 4NJJA 5DBUA 2FZ8A 4F2TA 3NQ7A 2PLCA 1EX5A 1CGYA 2O7QA 2CZVA 1C8YA 3OLEA 5CQ1A 2HS8A 1Q6FA 3E0VA 3LSCA 1FKXA 3QGVA 1KM3A 5A6TC 1GORA 1Z6KA 3TWAA 3N2CA 4KWUA 1MZHA 1KGUA 1O7AA 4I9JA 3KBNA 4UFMA 1HVQA 3EEGA 3VIPA 1AW2A 3I68A 3MSDA 2GJNA 3SUSA 4PE8A 2V0TA 1UA7A 3KOWA 4Y9MA 3NPVA 3AROA 2A85A 3S5YA 2O55A 3TYZA 5CBBA 3EPMA 2W9MA 5EY5A 3LM7A 1VYRA 2PLKA 5D8WA 1C90A 4AEOA 1G69A 4H6QA 4AHPA 2VC7A 4RKAA 4PFHA 3SR7A 2C6QA 4KT2A 3VGHA 4UC5A 3MPGA 5DO8A 4IMAA 3U9IA 1VD6A 4K68A 4JXCA 2NV1A 1UBSA 5CC7A 1QFEA 3R2GA 4IMDA 1QATA 2WC7A 2OYLA 3W1RA 2DSZA 3TSBA 2NT1A 4JQ2A 1XP3A 4HU0A 4ALDA 2WHMA 4HZMA 4NJIA 4FMVA 1TQXA 2DH3A 1G5AA 3W9ZA 3STFA 1WYIA 3PHAA 3E96A 4U5KA 1JQXA 4MWAE 1CZ1A 4GKTA 3BSHA 1KXTA 4FHAA 4XB3A 4LV9A 3ZVHB 2R91A 1A5NC 1M01A 4B5WA 2HJPA 1DWHM 3CMJA 6A3HA 3R6IA 4YLWA 3MMUA 2ZX7A 1R2RA 2JF7A 3KLKA 4I90A 4AWUA 2O9TA 3EWXA 3L4WA 2ZWYA 5TIMA 2BODX 4O11A 2ESCA 4AWTA 1VJIA 4YVPA 4YVVA 4ML4A 3GS6A 4GYJA 1YYAA 4ZQCA 3P8IA 1QBAA 3A24A 2WLZA 4FNSA 2VFGA 1RAKA 1A5UA 3APTA 2XHYA 2OCZA 1EZWA 3EXSA 2X0HA 4K36A 2BV9A 1HJWA 4IMCA 4Z2HA 1AQHA 5G4HC 4ZMGA 3L4VA 1C9DA 1CXIA 1F8IA 5ECUA 4F9DA 3IIPA 2VGFA 4GRSA 2CHNA 2OG9A 3FY1A 4QRNA 5C8BB 3HOJA 3DYOA 1ZJAA 1BSLA 2OSYA 4QXIA 3QV9A 2QCDB 2BVDA 4MB4A 1NOWA 1FX6A 1GQIA 1J0ZA 1TA3A 1H7XA 3TYDA 2C3ZA 5JH2A 4Z1CA 1CXFA 1M9HA 3EXRA 3L0NA 4HOXA 1TZ7A 4R27A 1W9PA 3AMKA 3DG7A 1F4HA 5K9DA 3WFLA 4UTMA 4WGHA 5CC3A 3FDGA 2WSRA 4H6KA 3VIFA 2QJGA 1SUXA 5K4ZA 2H9AB 2DJXA 3S2NA 8XIAA 3GFYA 4XBJA 3AS2A 4TTUA 3I6RA 3CTTA 4XX6A 3MHFA 1YLVA 3GLCA 3LTPA 2YLAA 3EYPA 1G67A 1GEHA 3BGGA 3J7HA 1CENA 3OYZA 4LNCA 1I45A 4HJFA 3LTYA 1X39A 3RAOA 3G1VA 3EZ4A 3QSTA 4AG0A 2EBNA 4R7JA 1I4NA 2B7QA 3CIWA 4JYFA 5D9MA 4AMCA 2WKJA 3OLDA 3SI9A 4DO7A 1A5KC 1P5BA 4M6QA 3GIYA 1V7YA 2PDHA 3IV8A 4IL2A 2J7FA 3CIVA 4FS9A 4ZB2A 2BXYA 3M46A 2WC3A 4PSPA 3KAOA 4IPJA 5D8ZA 1W2VA 3TWBA 4XAYA 1QOPA 2CBVA 2WZTA 1I75A 4W7WA 3GY1A 1E6QM 3IANA 3FEMA 1RPKA 2ZX6A 3BJTA 2WC4A 3WKZA 4NAEA 4H7CA 5F4WA 1H7WA 4P2VA 1V6XA 3O8AA 1EBGA 1FFRA 3R10A 3P80A 1SO6A 4MSSA 2WQDA 1SJDA 4HA0A 1BKHA 2G95A 4BI5A 1TX0A 3R5EA 1IZKA 1GOQA 3RRAA 4PL1A 5I03A 3QW3A 4GJ1A 3LHVA 1M3UA 4LCSA 1G6CA 4L7ZA 2WCAA 1TPDA 4B9ZA 2F6KA 4NL1A 3BZGA 1GQKA 4H9VA 1KFEA 3E2QA 1LRTA 2HS6A 4A8IA 3O1NA 2NUXA 1RLCL 1XL9A 3DIPA 4FLSA 4S39A 5XIAA 1PYFA 2PC4A 3LN3A 2Z26A 2HVOA 2UY4A 3S1XA 4KEVA 4PRTA 4BI7A 4C6DA 2F8QA 2QZRA 3RK8A 3B8TA 3D3AA 4GXMA 1VBRA 4Y8EA 4XG1A 2VEKA 2ZRWA 4URIA 4IP5A 6TAAA 1K8XA 4HTYA 1T8QA 2ZZ1A 3LXCA 3W82A 1JD9A 4P7QA 4P8VA 4OECA 4M24A 1OC5A 4A4AA 2I5IA 2Z1WA 3C86A 1TJPA 1ISVA 4UZUA 2AGTA 4I9MA 2P1FA 3GR7A 3FJ6A 5FL1A 5DT5A 4KRZA 2WMKA 5AY7A 1O1ZA 3HG4A 2VCBA 3VGEA 4NX5A 4LEQA 4GJIA 2OKOA 3PBUA 2C15A 3K13A 1VJSA 4PTMA 1XLCA 1NM9A 2WMIA 5LNRA 3S8HA 3WQCA 5F1UA 7PTDA 4MWAA 1IXPA 3INPA 4GK8A 4KCWA 2Z7KA 3DFYA 3H4WA 2DVUA 2IKIA 3H2CA 4BK9A 4WEVX 3WNMA 4J3SA 2QS8A 1X97A 1CNVA 3W1XA 1I8JA 3A23A 3LCWA 3QPYA 3IRDA 4IIDA 1JR1A 1GOWA 3PPFA 4Z2GA 4E3VA 3VX1A 3GHTA 4JNZA 1FWHC 1WXYA 3M0YA 4RDZA 4DBEA 4GX8A 1L9WA 3UJFA 3APGA 1FFQA 1AMKA 5K7JA 3VOGA 5CSUA 5LKYA 2FMOA 2A79A 3AS0A 1I0BA 3ARXA 3CZJA 3MY9A 3LRMA 3F4CA 3URBA 1RVGA 1TWZA 3BW2A 3PB0A 3VNDA 5AYYA 4Q8TA 5JMUA 4GY0A 4BZYA 2ZRYA 4FNPA 3V5OA 1TWIA 3WQWA 2EKGA 3N04A 3P0WA 2DUZA 4D8AA 1W8SA 4RNIA 4UQEA 2ZZ4A 2Z6IA 5EFFA 2BGSA 1MW2A 1LG2A 1FCQA 1JZ3A 4DJFA 3C2OA 1UKPA 3M0IA 4PCNA 5K3VA 1MRQA 3LHWA 1FWIC 4QS5A 5FOOA 3WY1A 3REQB 2Y5SA 1DXFA 4XD3A 3CV2A 1FVPA 1K70A 1VFTA 2DT1A 1OC6A 4EF9A 5I3HA 3FYYA 3CHEA 1UQYA 5BXRA 5LGXA 2NXHA 3GVRA 5DBTA 1DJHA 2X09A 4MLRA 2GGHA 1UR9A 2V3EA 1XYBA 2NXGA 1W1IE 3HPZA 2O4QA 1IWAA 3OZMA 3H2OA 4GUIA 3RPTA 4KEZA 5FJRA 4YYFA 1V7AA 2PAJA 1ZJHA 3GDRA 2Y8VA 3NZ1A 4MM1A 1SYTA 2HBVA 4PR4A 2XZ9A 3ZR6A 1EWEA 2BGNE 3FW6A 3ZLFA 3WK3A 2WAGA 2QJIA 4JTIA 2WLYA 2KZHA 2GJXB 4IFKB 1MZRA 3CHCA 4H8VA 4R85A 1EJSC 2QVNA 1VC4A 2OGYA 2Y7EA 3M5VA 3TQVA 4UMCA 1QNSA 4AZIA 4O52A 3MUZ1 3ZJKA 2P5NA 4AZ6A 4LYKA 5HATA 4DYEA 2XWDA 4DWSB 5I0DA 2HSAA 5I3KA 3UCQA 4IICA 3LUTA 4HGXA 4MKVA 4B5TA 1LOQA 2RDTA 3B05A 3B0XA 3W86A 2D3NA 1JNDA 4OOZA 4LALA 3V4BA 4ZOCA 2VM8A 1V3LA 3UG5A 1CXHA 3AZSA 4UMAA 2G50A 3W7RA 4GXWA 2AKMA 4R9OA 1FHDA 4ZQMA 1YTDA 3H2FA 4OBTA 1EC9A 2Y61A 3K4DA 4HNCA 3ISIX 3QPEA 3WSUA 1QJWA 2VGGA 3W84A 3EDJA 1HO1A 2QMKA 2VZVA 2VVSA 1IZCA 4DJFC 1PCKA 1XICA 1UC5A 1W0MA 1F74A 1B90A 3QMSA 3L66A 3W1TA 1R38A 4E6MA 2GVEA 3ME3A 3SO7A 3TJLA 3LI1A 3SCNA 1VAHA 5AVNA 4CCZA 2O9PA 1M6JA 3PBWA 4JTRA 4JTUA 1PZ1A 3UG4A 2VMFA 1H7PA 4HMCA 4UNIA 5M1TA 1R5YA 5LZLA 4W5ZA 3QQ0A 1G4TA 3IJDA 4Z0JA 4PMXA 1QTWA 2CLPA 4NXSA 1SPQA 4K3ZA 2DT3A 4LF2A 4HBKA 4ZODA 2X2GA 1CEOA 4MZYA 4ERGA 3B04A 4GKLA 3WFAA 4JIRA 1W1PA 1CB2A 4X0VA 1B57A 1XYMA 3KBMA 4PGLA 4Z2IA 1RBAA 1VZWA 4JY9A 3KP0A 4C1NB 3TN6A 1J0HA 4L9YA 3URNA 4NZ3A 3TQKA 3A4WA 1R3YA 1UD6A 3GXNA 2PP3A 1REQB 2GOKA 4Q4KA 3PBMA 1VB9A 3VYLA 4NYUA 4F2UA 1S5VA 4MLJA 3LV5A 1LQ0A 4G5DA 4OFCA 3GH5A 4KWVA 4CQCA 4DO4A 1WOBA 3R0UA 5BRQA 3RRXA 3T09A 4B5UA 3V75A 3HGOA 1LOLA 1MEWA 4K39A 4AIOA 1O66A 4MYXA 5BXSA 1JAEA 5A2BA 4FO4A 3MP4A 3VNZA 3T0DA 2WM0A 4IPLA 5EMJA 3IJQA 3G22A 2P0OA 4H6RA 2ACSA 4C6MA 2CLOA 4W5UA 1VFHA 3KVLA 3W7OA 1TMHA 4U10A 3A12A 3GNDA 1EF3A 2DSUA 4PTVA 2XVKA 4ACZB 4DO6A 5LNSA 4WKAA 2DZPA 2DW6A 3JR2A 3GSMA 1DJYA 4YNGA 5EKYA 5EPDA 3SQMA 2WJEA 1U22A 4U3CA 3A4XA 2J9ZA 1A5SA 1HJQA 4DLFA 2Y1HA 1PZ2A 3R8GA 5I3FA 1JZ5A 1TPVA 3GTHA 4FLRA 2DFAA 5M2FX 2ZYFA 3G1YA 3ONBA 3VMOA 1UWQA 2AAAA 2F2KA 2PDMA 1S5WA 1AL8A 2FFIA 4CD5A 2REQA 2VP8A 3KHJA 3DECA 4O1DA 3WMCA 3MA8A 3OJGA 1BYBA 1RY0A 2J47A 4AHOA 5DELA 4RXGA 4OJYA 1GG1A 4N9BA 1ZU8A 2A6LA 2VYOA 4L6DA 2CKRA 2OT0A 4ICNA 4D72A 3CXOA 5KZ6A 3C2FA 1EEXA 4LT9A 2PURA 4IGHA 3LHTA 3LRLA 3T4WA 4HSHA 4Q8OA 1ECEA 4GG9A 3LCFA 4MNMA 2D2OA 3RXZA 3XIMA 1XDLA 1FBAA 1XM3A 4ENLA 3SUVA 3PNZA 3SGZA 4JNYA 2E67A 3BLPX 3VPLA 3HQPA 3BK0A 4X63A 1AJ2A 4DUXA 1UR1A 2GUUA 4TV5A 1RD6A 1KWKA 1RP8A 1KBLA 4Q7IA 1TV3A 4XIMA 3GDKA 3LNPA 1NARA 4DJEA 1GT8A 1SO5A 1X8CA 3N6JA 3TC3A 4CNSA 4HU4A 3BURA 3B4UA 3W7HA 3G6MA 3QTGA 2BX7A 5FF0A 1Q6RA 4GPNA 1XINA 2HV5A 4WSJA 2C0HA 4GZEA 3MDUA 3UA3A 1FWRA 4HPHA 3WDRA 4W4QA 5HULA 3EWZA 1WZKA 1TQJA 4LYPA 1L6SA 4TX8A 1HP4A 2J78A 1G94A 3SZ8A 3LRKA 3RLUA 3W38A 3PZOA 4DY1A 4O1FA 3GK0A 4NZFA 1EPXA 4O8RA 4W7UA 3GVQA 2QHAA 2J8TA 1C91A 1KB3A 3EOOA 4IF2A 4C6BA 3KOXA 1XR2A 4ZOBA 3WLQA 3LXAA 4GINA 4QEHA 1MEHA 4LW7A 4LU0A 4C91A 1ONXA 3NL6A 4GZ7A 2XFRA 3ABSA 5L9FA 4X3ZA 3EKLA 3KOZA 5C54A 9XIMA 4KWOA 3W00A 4QCEA 2XIQA 5ABHA 1KNWA 1XH2A 4DXKA 2NUWA 4IPNB 3VE9A 4D6FA 4RDYA 4ILSA 3JW7A 2P0IA 3EMZA 3SB0A 4BA0A 4ASTA 4KCUA 3A3WA 3B8UA 4JTTA 3GNXA 1W1A1 2W63A 2XDFA 1JGMA 4OKDA 4JYEA 1H7OA 3G0SA 4HQVA 1F4AA 3A9IA 4IH3A 4N02A 4V1YA 3KTXA 4JL1A 5I09A 3H2AA 4FF5A 4OHQA 4TMCA 1GVSA 4GCXA 3STCA 3MYOA 1RBLA 1TSIA 3SDOA 5ABGA 1XJBA 3GZ3A 3AHXA 4E0CA 3PULA 1KTCA 3BAWA 1XLFA 4IUGA 3UETA 5HOSA 1JF6A 3AIRA 2YL5A 3OZOA 2W91A 1EOKA 3MDWA 3M5XA 1XYCA 3WQGA 4JTDA 3ZJ7A 5BOEA 1HKIA 1EGZA 1QASA 1WDSA 4OVXA 1RCXB 3F5KA 3TV8A 2DZSA 1R3SA 1N55A 1ZRQA 1QI4A 1OK4A 2XGBA 3NPUA 1W5MA 4PB4A 4B5VA 1LRNA 4F0KA 1M04A 3GW3A 2XPKA 1PIFA 5E1QA 2O4MA 3S5NA 2PD5A 1Q2SA 3UWQA 4DUWA 4S3DA 1V3MA 2IKGA 1OIFA 3EWUA 2XSBA 2HPMA 3IVSA 3GX9A 1PX8A 2VFEA 4M81A 1NY1A 4JTEA 3UCCA 3G24A 3KBSA 3FFSA 4W8LA 1JPKA 3DI0A 3PZGA 2AQVA 3AIWA 1JCLA 4C6LA 2P3ZA 2I5GA 1TCMA 3OBEA 5J04A 2GJLA 5B80A 5H8PA 1H7NA 1SSGA 1MDRA 3ATZA 5DRCA 8XIMA 4B3KA 5HK4A 1XIMA 3CUFA 3VNLA 1CTNA 3OGSA 3KP1A 3ARTA 3TE9A 3MO7A 5AC6A 2FB3A 4KRUA 5DMMA 3UY7A 2XIOA 2VUNA 3T44A 4MWAB 5D38A 4HZ6A 4LY8A 1EJUC 3TCSA 2OFJA 5LA1A 1ADOA 4N9CA 3DUGA 4HMNA 4EP8C 3U8GA 3BO9A 7CGTA 5BU6A 5LA0A 3SY5A 3IUHA 1S38A 2WVTA 1XD1A 3GFXA 4GWEA 3B03A 2QULA 3V1HA 2Q71A 2QKFA 3ZWTA 2GWNA 2ON3A 4DB7A 4Z08A 2XH0A 3WDPP 3WUBA 4PTXA 5LXEA 2XYLA 2G3JA 1W9XA 4UTTA 3DFSA 1JDAA 3KHDA 2Q8ZA 3LPOA 3ARQA 1A0EA 5EB8A 4JKMA 1PX4A 1F8MA 1S2WA 3P8JA 2FIQA 5CLTA 3UR2A 4FB7A 1DIKA 1YBQA 3TJIA 3WLOA 3L21A 2B0MA 1C8QA 2WYSA 4I9AA 2R1PA 5A8MA 2VGIA 3GDLA 3USBA 3CHVA 4IGMA 1H4PA 5BRPA 4AD5A 1W5PA 3M1ZA 2X1RA 4Y7EA 1ZUAX 4JNMA 1HL2A 4LVFA 4FALA 1DPMA 3GTNA 3R7MA 4YVXA 1FWGC 1QWKA 1R87A 3NDOA 3W1QA 2UWFA 3OHIA 3W73A 5CC6A 2QUMA 1YW1A 1GJWA 2CXGA 3FSTA 1E0VA 2ZADA 4YWSA 2QCCA 1E43A 3BG9A 4EANA 4F79A 2QPXA 3VX0A 1V6WA 4W84A 3HJEA 3NQ2A 5C7VA 4PBEA 3VMNA 4RJEA 3R25A 1GQLA 4P61A 5I79A 3KLLA 4JZ5A 4EXQA 3VTRA 5I3IA 1Q63A 4IXHA 5HMFA 2OX4A 1JPHA 2GGEA 1UD4A 2NSOA 3HMJG 2GOUA 3NQCA 2RJGA 4B92A 4FXJA 3UWUA 3FJ4A 2OOGA 5L6UA 1E0XA 5LHEA 2Q3OA 3BXWA 2NSXA 3SURA 1OX6A 2Z0IA 3SUTA 1OFAA 2VJXA 1R7OA 1DTUA 3UZXA 1H51A 2OWXA 5HPOA 4PMVA 3UBPC 3NQGA 1E1CA 2C14A 5T26A 1H1YA 4PMRA 4IM4A 3TA9A 1VYSX 3BSGA 8A3HA 1EP1A 4IQJA 4C6QA 2WSYA 1QR7A 3HV9A 3W0KA 2LLEA 4PCSA 3TA6A 1OG6A 3EB2A 1WDPA 1TVNA 4KFOA 2CNCA 3LMYA 5HNNA 3VIMA 5IBXA 1QNVA 3N4AA 1W1YA 4GJJA 3NQVA 3VGGA 4GISA 2QCDA 2JALA 5D4YA 3FGCB 4UXDA 5A94A 4UFKA 2V5CA 2FZNA 2PZNA 1BRLB 3PUEA 1AH4A 3CASA 2P8BA 1JVNA 3S2JA 2HVNA 1JPMA 1OHLA 3PBYA 3EDFA 4LWWA 5C7HA 1XLAA 1WDWA 3KRBA 4AZCA 3V7PA 3UZJA 3C0SA 4K7YA 2YBTA 2WHKA 1P4CA 5KETA 4D8ZA 4NHVA 2PP1A 1UR3M 3W53A 1O95A 4W93A 2VX6A 3T8LA 3W88A 4REQA 1EBHA 5IRPA 3ARVA 3LOTA 1X1OA 1MW0A 2ZZ7A 2KX9A 4GYFA 3DBNA 2Y5EA 1J0IA 4MFDA 4M51A 1CWYA 5H91A 3T81A 3ZT6A 1VCVA 1W5NA 4JQ1A 3TJXA 2OZTA 3DGRA 1VPXA 3RF9A 1XV8A 3HG2A 4S1FA 1UWTA 5DRIA 4A2RA 1GOOA 1ZCOA 4C6OA 3IGUA 1VQTA 1W9BM 4MWAD 1XIDA 1E6SM 3A5VA 4C6KA 3KL3A 4XZ9A 2YDSA 3M0MA 5HWMA 3STGA 2JKEA 2XH7A 1S3TC 4CD7A 3LPFA 1F2JA 1CLKA 4ZCWA 5A69A 1X98A 1V3KA 4DF1A 1JDEA 3R1ZA 3E0WA 1K6WA 4RZ5A 3OQ8A 3E02A 1HJVA 4L9XA 2PGEA 2HRWA 4WUIA 1HGWA 1V6TA 1B3YA 1VEOA 4UCFA 1T0OA 5AC8A 4PBFA 2PLJA 4HYVA 1YRRA 4O4WA 4Z2LA 4Q32A 3ZSSA 1TE6A 1R46A 2ABAA 4UQCA 1IIGA 2VRKA 3FOKA 1H0IA 3W7LA 4U28A 4TX6A 2PEVA 3MJMA 2VRJA 5HANA 5FESA 1U33A 2BFGA 1QMLA 1NFBA 2XU2A 1ALDA 3W75A 3AZTA 2VCAA 4A3QA 3KCLA 3UGRA 3NQEA 2ACQA 3AS3A 2AMGA 4EAMA 4AVNA 4DZHA 4R53A 1RVKA 4LYRA 5CPOA 1VFUA 4IX0A 3T07A 1ZNNA 4C7DA 3QYQA 4KEUA 4DELA 1RALA 4QM1A 4XZNX 2FDSA 2HPIA 2YZRA 3OLIA 1JULA 2Y2WA 1R30A 1H5VA 1LP6A 4GQGA 1OX4A 2ZOXA 1H0GA 5MKGA 5EFDA 3PTMA 4GVFA 1GYMA 1K7FA 4H9TA 3JS3A 3W70A 2NQ9A 1EFZA 4H04A 5SWUA 4GIYA 3WMLA 3ECQA 3TAKA 1BXNA 2PWUA 1GYLA 3MUY1 3VGFA 3SQSA 3H7VA 1A49A 2VO5A 1JCJA 1WZAA 5REQB 1S3HA 3YPIA 3JRKA 2V2CA 1P1MA 4AD2A 4PA8A 3C0QA 1BSIA 1WAUA 2A3AA 1UB3A 3DHUA 2REQB 1H11A 2XJ7A 3PC0A 2Z29A 3C6CA 2OPJA 4HP5A 4Z2JA 4GZJA 2OJPA 2CLMA 1K4GA 3CQ0A 4JTSA 3FEQA 1NELA 1POJA 2EPKX 3PZIA 4UFIA 4DHGA 1LWIA 3B8WA 4NUWA 2NVAA 3V5CA 4D6CA 2SFPA 3SY1A 1XC4A 5A6BA 5AC4A 3Q58A 1KM0A 4W8BA 3WF3A 3VDHA 3E38A 1X1NA 4NNBA 4PUWA 3DHPA 4XAGA 1OGBA 1TG7A 4ZTXA 2Y8UA 1UKOA 4IMFA 4OE7A 5A1AA 1U5VA 2XSXA 3UEQA 2FTPA 3BW3A 4DZIA 3U4FA 3HG5A 3WBXA 4RZBA 3THDA 3CUIA 1PHWA 1RH9A 4B4HA 1K9DA 4BWLC 3C61A 4LB4A 4FPSA 1YX1A 2DSVA 1B5TA 3WK0A 4H9MA 3GDBA 4MKNA 2GVJA 2E77A 1H63A 1XLMA 4MDPA 1UWRA 4UTIA 4HZ7A 3T2OA 1Q3NA 3M0VA 1MXSA 3BMVA 2PODA 3LYEA 3H8AA 3ABXA 3BLFA 4NNAA 1Q8AA 2PDLA 1KXQA 2PUZA 1R0MA 4E4UA 2WVSA 3GWQA 1S2VA 2IQ0A 5A5WA 4TMBA 1EHNA 3ZO9A 1BF6A 4Z1DA 2WWCA 1YHTA 3H6OA 3A4AA 2A3EA 2Y5JA 3NEVA 1A5LC 2XVLA 3WLHA 4QQUA 4Q6JA 4ZL1A 2QAFA 3T4CA 2PWVA 3IVUA 3DHFA 2CEQA 4PULA 3QLLA 4IGNA 4X2PA 1DWFM 1YDNA 2O0TA 1KLZA 4I8YA 1I2PA 2X2YA 1SW3A 3UPBA 2Z2BA 1XHGA 3R12A 3MWCA 1ZTVA 2NV9A 1V6UA 3PFMA 4XSLA 3K4AA 1O12A 2YCKX 1BQCA 3M5YA 2H9AA 2F61A 3VOFA 2OZ8A 3NPXA 4ZGYA 5FJOA 4UR7A 3VOIA 3DENA 5DN1A 2L5HA 5DMNA 3B0VC 4A8RA 3WCZA 4PRRA 1FWJC 1IQ8A 5D2TA 5HQEA 3K1DA 1MI3A 5CC5A 1BYCA 2BOFX 1V02A 4JFSA 2GLKA 4I3GA 4TU1A 1BKSA 1P0KA 1POKA 1GOXA 1EXBA 3IJ8A 3EKGA 5GJNA 2H6RA 1XISA 2QQ6A 2V3FA 1OCJA 2ONEA 3UF9A 1JIBA 4Q4QA 5C6MA 3CZGA 2WK2A 4OUIA 4XD5A 3ZS4A 1QXLA 2C13A 3WJYA 3UERA 3TTQA 1OFRA 1TFVA 4NP7A 4AWSA 1R85A 5FI8A 1FDZA 4Z42C 3AOFA 2ZUWA 3COTA 1R6WA 1OADA 2ALRA 4X0NA 4DAIA 1J12A 2X0SA 2A3HA 2F84A 3MQTA 2WZHA 1UBPC 3VU2A 3IV3A 3LY0A 1F05A 4BQ2A 3B4YA 5DMYA 3W71A 1LT7A 4DXVA 1EPVA 4L4OA 3G1RA 1DJXA 2EO7A 2ZC1A 3O7UA 3RM4A 2G3FA 4JY8A 4MNKA 4W85A 2W61A 4JIPA 5JBEA 4GFSA 4O0QA 3AMCA 4MYAA 4D6IA 4NSBA 2I9UA 2GQ3A 4Y90A 1BGGA 1YADA 1KM4A 2I17A 3M7SA 1UZ4A 4UOZA 4AVOA 4XTIA 2JQXA 3PAOA 2HTMA 4ACZA 3P2VA 1NDWA 3N4EA 3DFQA 2WM1A 3Q94A 2ISWA 2IUZA 1KFWA 3P61A 3K8LA 1OC7A 3OYXA 2QXWA 1ITXA 4L9ZA 1AMYA 3GXDA 4DWSD 3UQNA 4DO5A 3PUOA 2Y7FA 1E40A 3DYMA 4L64A 3BLKA 3TW9A 1GOMA 1LBLA 4QJ4B 3MJYA 1HZYA 3LHYA 1ONWA 2E5BA 1V0NA 3N9SA 4DN1A 2A3BA 4X22A 1V0MA 4IQLA 3BTNA 1US2A 1BXCA 3W7NA 2JKPA 2NXIA 2BDQA 3DGBA 2PGFA 3WNKA 4ZQPA 4JEQA 4XSMA 5HXMA 1WKDA 2I57A 4M80A 3TNBA 3ORWA 4JR5A 1M65A 3ZJ6A 5HMDA 1XQLA 3OIXA 3MMWA 5JXQA 4H8UA 1HJUA 4K37A 4ECLA 2FH6A 3CAVA 2FYMA 2UY3A 7TAAA 3WIJA 4XKYA 1E51A 3BDKA 3FKRA 1LL4A 3FDKA 4M6UA 3VIIA 1ZJBA 3TLQA 2VURA 4ZE5A 1W32A 2D2JA 2NQLA 3VCNA 5C9RA 4ES4A 1V51A 2CLEA 4O1CA 4RZ6A 4PUDA 4XAFA 3TYEA 2J8GA 1GPFA 5B7ZA 1MRAA 1WDDA 3E49A 1J93A 5K9CA 1TZ9A 3P6LA 3H54A 3CUGA 1MW3A 4GCAA 1W17A 1LLZA 3F2BA 4QR6A 4UNLA 1SO3A 3LENA 5H1WA 1K1DA 3AYSA 4Q4OA 1PYMA 1EC8A 2D1ZA 4GIEA 4JTGA 4O19A 1QHOA 3PFRA 2VDHA 1WV2A 2R14A 1RPXA 3GB6A 5E5CA 4GQRA 4G7EB 5AHLA 4EK7A 2EG6A 4DM1A 2TMDA 5E09A 4E2OA 2OODA 2Z28A 3GVVA 1QW9A 4DYKA 2E1DA 1P6CA 2P53A 4FA3A 4MZ8A 2BVWA 5AOUA 2XVGA 3WBWA 5I2UA 3TH6A 1T41A 5E70A 3CM4A 4LUTB 3W7EA 2YCLA 1JD7A 1TPUA 1KBJA 4OGZA 4Q8UA 4ZENA 2WHJA 3S5ZA 3UXLA 4KFNA 4Q3MA 3R58A 8TIMA 4DZAA 3E0IA 6ENLA 3NXLA 3RIKA 3G0UA 4Q4RA 3GTIA 1Y0EA 3EPOA 3T78A 3MTWA 1TJ2A 2BSLA 1RP9A 1GPWA 1C7TA 1YPFA 3MZ2A 3FVDA 3ZLHA 3G18A 1R8LA 1FWCC 2Z1SA 3OZPA 4WOZA 2OYKA 1SZRA 2ZX8A 4PMOA 4IWWA 2VGBA 2XINA 4CCCA 3F2DA 3P93A 3W29A 3WLLA 4NAFA 1XSIA 1EIBA 4HU8A 1DXIA 3DI1A 2Y7GA 1XGEA 3FXYA 2WXDM 3F1QA 3QVQA 3CEPA 4G9PA 4HYRA 4CQ9A 3EA1A 1GKPA 1XF0A 2DP3A 3U4AA 3W1NA 3SN4A 4C5YA 4LFYA 2YPIA 3B9OA 3NJ3A 3BPWA 2E28A 1E6XM 2WCGA 3GTFA 1J9YA 4Y6GA 1OFPA 1LCOA 3UJ2A 3N3MA 2YYTA 1W5QA 3H4GA 4F0MA 5AZ1A 5FJTA 3EX1A 3VO0A 3AXIA 2CHOA 3PJUA 3W2UA 4BS0A 4GC3A 1HT6A 5FACA 1B9BA 2PDQA 3LHUA 2CPUA 1F5ZA 3L68A 5AC5A 4J40A 1FCBA 1VFSA 1FH8A 5DF0A 4F0HA 4EKJA 1VRDA 1DWAM 3QYSA 4XVDA 1E9LA 1BG9A 3TYCA 4DWSC 3E2RA 4QQ3A 1V0KA 1G7VA 2XIMA 4K6AA 2QAPA 4HA3A 1RCOB 1RD5A 1SFSA 5D2WA 3VXGA 1IT0A 1DYSA 1UUQA 1C7SA 2DUAA 3PJXA 1XPGA 5H6HA 2V6AA 3SECA 3MBDA 5E9AA 1RA5A 4H9YA 2WNQA 3IIZA 3PZTA 3FK4A 4NZ5A 1XSJA 1YQ2A 2RJHA 4C1KA 4X9YA 1P43A 4U31A 1OCBA 4ZFCA 1VP5A 1Y65A 1GG0A 2QUNA 1GVRA 1FKWA 1KBBA 5EU9A 4B5NA 3CHDA 4ZQNA 1UMLA 3DKJA 1RZMA 2VCCA 1B3VA 1OWQA 1JXJA 1W3IA 2VQUA 3CC1A 3ID7A 1H3GA 1M1BA 5HJYA 1QI3A 4GGHA 3S1UA 1R3VA 3TK7A 1O5XA 3GC4A 3WBAA 4LAKA 1B3WA 1J2BA 4F3HA 1UC4A 1HFBA 5CPTA 5I02A 4IJBA 4F0LA 3VKJA 5DMLA 4KBXA 5BYWA 3TROA 1AZ2A 1BWLA 1Y8BA 2IPJA 5BCAA 2UZ9A 3HGJA 3WH9A 2DZUA 3NSXA 2O7SA 2EAWA 4AF0A 4IIHA 3GC5A 2A2IA 5IDZA 2XH4A 1GQJA 4MZ1A 1GQNA 4RNJA 2A6NA 3UPWA 5E6YA 3EWBX 1OT1A 4MB1A 1UPPA 3L67A 4OV4A 2VNCA 5JIPA 2CCRA 4UQAA 4GIRA 3O0KA 1AH3A 3H53A 3II1A 3AO0A 1FXQA 2YB4A 2DZXA 2QCGA 1S5MA 1SW7A 3JZUA 3BAJA 2BY0A 4WRHA 1JUEA 1A0DA 4TQTA 3RJYA 3PM6A 4HNOA 4GBDA 3ABRA 1TMLA 5D9NA 3TSDA 4RXFA 4AMAA 4KFPA 1P0DA 1XW8A 4UTTC 4HD5A 1Q2RA 3MANA 2EHHA 2VD8A 3KOYA 3HV8A 2X16A 1OEPA 2WQPA 4P7NA 1E73M 2ZZ5A 1VEMA 3QY8A 4PEEA 4WDTA 1T40A 2X30A 1MEIA 2C8NA 3RM8A 1W56A 2BHZA 4UQDA 3OB8A 3LLXA 1H7RA 4WDUA 3E5BA 3NTYA 3B9NA 2J8FA 1REQA 2QPSA 4DJFD 4CNUA 4X2RA 1ODUA 2CWXA 1S1RA 5A8NA 1PL9A 4HHLA 4E2DA 4Q8NA 4D6DA 1AVAA 5CZ0A 5HPCA 2FHBA 3SN1A 5CPNA 3ITOA 1N82A 4HCLA 1OF6A 4A29A 4WY0A 2E5CA 1AODA 2GWGA 3GNOA 1LBMA 4FX6M 2PA6A 3SCUA 1IYXA 2B7NA 1EJRC 4HPJA 3BJSA 1M53A 2JEQA 4HNLA 3QR3A 3VKAA 2DZVA 4KIEA 4E4PA 3AFBA 3DC8A 3DFNA 4LUJA 3GVGA 4LVDA 4HOZA 3GZAA 3VC5A 3NL2A 2V63A 1C3FA 1PDYA 1IWPA 2PDFA 2BBFA 2NX9A 4NY2A 3ZXWA 4J2PA 1DWGM 3N9RA 1N2VA 4C5ZA 1QW7A 5C2GA 1NQKA 3STPA 2E6DA 3DZ1A 2J7BA 5LIUX 1XG3A 4WSKA 2PI6A 4AX6A 3KDOA 1DQXA 3MI3A 2DEPA 2E0PA 3UYCA 3WJZA 5I78A 4WQ6A 5FF4A 3TKFA 2VZOA 2WNWA 2X41A 1XKYA 1W3KA 5A8GA 4ZB0A 4B90A 3B40A 4NI8A 3L23A 4LJ3A 4JAWA 4S3FA 1EEPA 4FZIA 3TR2A 3BMXA 5IHRA 2ZA3A 4EPDC 5EMUA 4HJWA 4QDMA 3L0GA 4PB3A 4ZE4A 4HK6A 2XFWA 1Q6DA 2VFFA 4XKYB 4B2DA 4NZ1A 3MV01 4WK9A 3P74A 3QGKC 2F6UA 4YCOA 3FLUA 3RX2A 1K03A 3BLDA 4GO8A 3KEHA 4IOTA 3W1MA 3C56A 4ZFMA 1GTHA 4JTAA 3GG7A 1LQAA 3SGUA 4LC6A 4BQ5A 1QAPA 1HP5A 5BZAA 4WDXA 3TTSA 2WVVA 4B3ZA 1E4IA 3SSZA 1Q7MA 1US0A 4XIAA 1R3TA 5D2YA 2B81A 3QF0A 3SGGA 5KSWA 1EX1A 4GNVA 3R8RA 3TYUA 3NA8A 2V82A 1K77A 1TPH1 3KXQA 3I7SA 3ES7A 1U2YA 1TIWA 4GH3A 2ABBA 3HFYA 5CG0A 3L12A 4HNNA 4F0RA 1EH9A 2PRMA 2DW7A 2HNHA 4PFMA 3RU8X 2PTYA 2XN0A 3W7DA 3R13A 2J7CA 5HMEA 1F7BA 3T2PA 1FP9A 1MNZA 1TVLA 3WQDA 2ZQ0A 3UD6A 3ZMRA 5A6BD 2WO5A 4AZHA 4LUSA 2OQHA 4G1KA 4JDBA 1OX5A 2CLFA 3LB0A 3ITGA 2TYSA 4HIBA 1A4MA 1KQZA 2POTA 3RPMA 1OYAA 3QGAC 2G8ZA 4IIFA 2PU0A 3OTRA 2GVGA 4V2XA 1W3LA 2ZTKA 2R94A 4AF0B 2BGQA 3TC6A 3P5YA 1ZBKA 2GJXA 1UWSA 3C8FA 3H21A 4LCQA 4U2ZA 4K8HA 4Y9PA 1OCNA 3PB2A 3DXIA 3CWNA 4H4IA 4UUIA 1QBBA 3QEZA 2H3DA 3CUXA 4HMDA 3R79A 3HQNA 2QUUA 4ATDA 4AXKA 3KRSA 1DE6A 3HBLA 4UWMA 3WNOA 1E3XA 1E6RA 4LVGA 1S39A 5C9ZA 4IIEA 4L80A 2FGLA 4FX8A 3W7GA 1EHAA 3B97A 2UY5A 1KD0A 1UG6A 4AD1A 4JFWA 4I6VA 3VOCA 3ANVA 3DX5A 1HQTA 1KRCC 1K8ZA 3ALFA 1ZQ5A 2Y62A 3ITYA 4CVWA 4WKHA 2QCFA 4CU8A 3CMFA 2PTDA 1IV8A 3LGGA 2C19A 1PXGA 3LM3A 4EACA 3MP5A 1BRLA 1XLJA 5I07A 1Y5VA 1LT8A 3SCPA 4F66A 1DJWA 4O1EA 4FIRA 2QDHA 5FSEC 4DIAA 4JTJA 3VKCA 2FZMA 1OM0A 2YL6A 2F6XA 4NJGA 4BQ4A 2EPNA 1XBYA 3LLDA 4IP4A 1GVEA 1VFOA 5GQBA 1B31A 4A2SA 2Z1XA 3PZQA 1RXOB 2FHCA 3KDNA 1G7UA 1EZ2A 3DYPA 1GUVA 3WBYA 2G96A 5JBDA 1NF7A 2PC8A 5XIMA 3BOXA 3DC0A 3WMSA 3NZPA 3I6EA 4KIRA 3RG6A 3TLLA 3ZVIA 1WKEA 3DOPA 4ZZ9A 4RW5A 1UPMB 4DRSA 1OGSA 1TR9A 1RCQA 2GPTA 3C2YA 3A47A 2OO0A 3BQ5A 2WJDA 1G4EA 2VHLA 3F4DA 3WK1A 1EJWC 1U5HA 2FGBA 2IMRA 1Y5XA 4JGDA 4LUIA 3V0TA 3GYEA 4FNTA 1M7PA 5C9WA 5DQPA 3F7JA 4DXXA 4HSOA 3S0CA 4QHRA 9XIAA 2D2GA 4R7WA 3STEA 5BROA 4MB5A 3M6YA 3RILA 3JVAA 5A8OA 1U1UA 3AXHA 3CZ8A 4NVTA 3KCJA 1KTBA 2G4FA 3B8SA 1NWRA 1V5XA 3LX9A 3GU9A 4GD0A 1VRXA 1A50A 1KRBC 4K7VA 5H8UA 1TV4A 2WMIB 4CN6A 5CBJA 3P67A 2YBVA 4HN4A 3FA4A 1F76A 3HM7A 1RQBA 3W1AA 2HISA 3T8QA 4YXGA 2RDUA 2OEKA 3IEBA 3GYCA 3GRIA 3IVTA 4GO9A 3M0ZA 3IGHX 2VTFA 5I3JA 1CT5A 1QI2A 2WMHA 3NQDA 2JIEA 3PSWA 4PMYA 1R9YA 1J6OA 1XYFA 2QR6A 2X1SA 1KM6A 1UR2A 3NQFA 4PMNA 2P50A 1CGVA 3DH7A 4IL0A 3I3DA 3E5PA 2PLMA 4PTDA 5HINA 2YXXA 3W4RA 1VPYA 5ABTA 3HN3A 3WLSA 2D20A 3EWDA 3PSVA 2KAUC 3NO5A 3TFXA 2GJPA 4YU1A 1N7KA 3WD4A 1UH3A 3QOKA 7ENLA 2UY2A 3E0FA 1TUFA 3CAQA 3HF3A 4JQAA 5H8MA 1K9EA 1NQ6A 3I3BA 5A6MA 4WVXA 1V02E 5CCZA 1SM9A 1S2TA 3GE7A 3NVTA 5I06A 3TONA 4H9UA 1B1YA 4J35A 3R0DA 2E6YA 3S1VA 3QOMA 1MFUA 3BG3A 4ZXOA 3IJ6A 5I23A 2OKTA 4HT3A 3UG8A 3GW0A 5HWJA 2QDEA 1VHCA 1JUBA 1VH7A 1OFEA 1TKKA 5AYIA 4M1RA 1J2WA 1SGJA 5AHMA 3QKZA 3WDIA 3SQLA 4UCGA 2WJZA 2QT3A 3BCDA 2BHUA 2P10A 4H3DA 1VFMA 1JCMP 3WF1A 5FEXA 4HPGA 1GCYA 4YJ5A 3UVAA 3I65A 2V69A 4L1XA 1E1CB 2V3DA 2WBKA 3TEVA 4PRWA 5BWAA 4N9DA 4UIOA 3T55A 1ONRA 2PDNA 2XG9A 3NR0A 2INZA 1QDSA 1NIUA 5FJIA 3EA3A 1YNPA 1PUDA 4BF7A 1DWJM 3T0CA 1TV2A 1TMQA 4OQVA 1KFKA 3GDMA 4PUUA 1J11A 5G5IA 4C60A 4IGSA 4LY4A 3URQA 3W24A 2ICSA 3N2BA 4INFA 3IWPA 3W28A 1X8FA 4NQ1A 4FLOA 2ZZ2A 2CETA 4CNTA 2QJMA 3NL5A 3AWNA 2ZRUA 3U2EA 3PUDA 4YIWA 1R3RA 2J7EA 3QZ6A 2TSYA 4DZ5A 5EMKA 4ACYA 2FVLA 4HKPA 5D2XA 4F0SA 1Q6OA 5D02A 1AL7A 1T7LA 3S4TA 2FH8A 2YL9A 4PTNA 1ZBVA 5CG7A 2H8ZA 2NVDA 4UBPC 3C3NA 3NCOA 1E71M 3F5JA 3NFUA 3MCMA 3UYIA 1THFD 3I7RA 5GPRA 4MY8A 3CH0A 3NO3A 3QY6A 1E0WA 3S1GA 2Z6JA 1EO7A 3OU8A 5LNWA 3VK5A 5IFTA 4GUFA 1EYEA 2W92A 1O6IA 2XM2A 4DJEC 3LDVA 4XO7A 1XUZA 5DY3A 1FDYA 2ZX9A 3V5FA 4FLQA 1WDQA 2YSWA 3UVIA 1XRTA 1J0YA 4UTJA 5CXPA 2A7PA 2ZXAA 3PG8A 3KOFA 2DZWA 4CD6A 3QV8A 3WZ0E 2YW3A 2ATMA 3MKVA 1CXEA 3TOPA 2QJHA 4C6CA 2EGZA 1PWLA 3AU6A 1EOMA 4AQLA 2QCNA 2Z1BA 3R11A 1Z9AA 5MKGB 3VNJA 1P0EA 4B5SA 1GOIA 3MKKA 1X7IA 4UTHA 4PCFA 2XGIA 3WLRA 4BEQA 5EA9A 1W91A 4E38A 4CNOA 3KWXA 1B0IA 3CU2A 1I60A 4MVAA 4OTKA 2VFDA 1SW0A 3HFTA 4RDWA 3E12A 3N25A 5HUOA 3LZ5A 4KPLA 4O4VA 2OZ3A 3UZ5A 3F03K 4AD4A 4PTWA 4MMWA 4KCTA 4DUOA 1JL8A 3K4WA 2CBJA 2BASA 4C90A 1XC6A 4LANA 4A3HA 2D24A 1TTQA 4F9JA 4LV4A 3RX4A 1O4UA 2ZVIA 5A6KA 3DHDA 5CZKA 3CV6A 1VLIA 4LBRA 3WQPA 3SCRA 4PB5A 3VKDA 3WK2A 6REQB 3SRHA 1OYBA 1XYLA 4Y9AA 4PUEA 2YOCA 1OBAA 3GG8A 3VE7A 2E1WA 2VDGA 1KA9F 3ES8A 3FA3A 4BJHA 1JG9A 2V3GA 2XH2A 3UNDA 2ISVA 3QPZA 2CXEA 5EMYA 4FF7A 1E4MM 5F7UA 3CEUA 4LTSA 2DJLA 1QPNA 1Z44A 5G1YA 3W87A 3GU2A 5I3DA 3P3BA 1MQQA 3HIJA 1SFLA 1M68A 4WCJA 5LA2A 3PTKA 3ZR5A 1ZENA 2GZXA 3CAWA 3AWOA 1V93A 3BC9A 4IIBA 2R82A 1XRVA 4ZSUA 4HYWA 3W3OA 2E5DA 4HPXA 3UCDA 2WSQA 4XAZA 3NGFA 3W81A 4R34A 4QNWA 3UXIA 3AXKA 3W25A 4LAUA 1HJSA 2ZE3A 3KWSA 1E6PA 4POCA 1LQ2A 2PDYA 4E2VA 2H3BA 2OGJA 1JFXA 4JX5A 3UWYA 1VKFA 2OLSA 1JGIA 4ZOAA 3IPWA 4NG3A 4MKSA 1BFNA 4YTQA 4MY9A 5D09A 1E15A 4GMEA 3BLOA 3ALGA 3VKKA 3W02A 1Q6EA 1B3ZA 2YCJA 1QO2A 4M29A 5LIWX 3AXMA 3CZLA 3TOYA 1Q13A 1UD8A 1O5QA 3EWCA 1LRQA 3QY7A 3BG5A 4JYDA 5AHEA 1FWDC 1WUFA 5K2ZA 2DQWA 4LVBA 1Z32X 2OR2A 2VEIA 3OA3A 1XPYA 3C2EA 3H26A 2BP1A 2IKJA 2J6VA 3HB9A 1TTIA 1LM1A 3OG3A 4O18A 4PCTA 3RMJA 8CGTA 2E8YA 4QG6A 3RR1A 1D8CA 1AFSA 4JQ4A 2TODA 1TWSA 2ZFAA 5HBFA 4A8LA 4GYPC 1LDCA 1SFTA 1Z69A 3RJXA 4PUMA 2X1TA 5IHSA 3WLTA 1PDZA 4DBWA 1TVPA 3N2OA 4GI8A 1MO0A 1GEQA 3FN9A 1OF8A 2NUYA 2Y24A 4J27A 4D9PA 4PC8A 2D73A 3WQEA 1A4LA 4N6FA 3A13A 3EBVA 5G2WA 2Z25A 2ATSA 2HK1A 2FVMA 4REQB 4IZGA 4C6PA 1ISYA 2H90A 1DVJA 2EJ1A 3CLWA 2VX5A 3W2KA 1QWGA 4XO6A 1W1ZA 4RV8A 3L65A 1EL3A 2XIJA 1JQVA 1G4PA 1V6YA 3ZIZA 4AU0A 4FAMA 2PSNA 2YDQA 1KCLA 4MUZA 1EQCA 3M0JA 1L6FA 3WEMA 3THAA 3WMBA 2PU1A 2EF9A 1QK2A 5CSRA 3VCRA 1AD4A 3QZAA 3N3TA 5LYRA 1E4NA 4YTUA 1OT2A 4JTHA 1VLWA 1XGDA 1XCWA 3CMGA 2Y63A 1OYCA 2XN2A 3C3UA 1JZ8A 3IS4A 3VMPA 4QLKA 1E0TA 1SFJA 3D46A 4D6HA 2AAMA 2ZTJA 1XIIA 3AI0A 4R5EA 1EJVC 4QE5A 3RNDA 3NXFA 4KGJA 2D0HA 2TRSA 4GOAA 2Y6ZA 4AZ5A 3FYPA 1Z3NA 5AVHA 3W76A 4B9YA 1KQYA 4A05A 4XAPA 4CQ8A 4D6GA 3W26A 1CXLA 1DWIM 4N7QA 4MADA 3H70A 1RUSA 5I5RA 2PWGA 3BAYA 1MDLA 3Q37A 1SR0A 1H49A 4BCEA 3BGJA 2YLLA 5DFAA 1WXJA 3MHUA 3EDKA 4GACA 3EB3A 4MJ4A 3DN5A 3AQUA 3NURA 4XZBA 4AB4A 1GGOA 2Y4SA 2F7FA 1MXDA 5I24A 5CSSA 4JHMA 3MWAA 4P5UA 3BOFA 4HOWA 3LGDA 5LIYX 2G41A 1K4HA 1LYXA 4JIQA 1ODZA 4M0XA 4AD0A 3GNPA 2BY1A 1N8FA 4G6CA 4H9XA 4QLLA 3D47A 4QBXA 1Z8AA 4ROPA 3E3HA 3M47A 3O05A 4NZJA 4FEZA 1D9EA 1W9UA 2O9RA 5DCDA 2J7DA 4HHPA 4KQNA 2VWTA 4O8AA 3ZT5A 1W54A 3CV7A 3L2IA 4PEKA 1KFCA 4IJCA 2YL8A 4G7EA 4LC8A 4MJZA 3H55A 3LSBA 1KCXA 1N8WA 4E8DA 2QCHA 2AMXA 3CZKA 3SIMA 1W1TA 2YDAA 2WANA 4JTCA 4GE8A 4US5D 4QITA 2XVNA 1IWBA 3KX6A 2ZDRA 3HPAA 1OABA 1S46A 3I3EA 1AQFA 4QJ5B 2WBGA 4GZIA 4MFEA 4WJ8A 4FR6A 4CQAA 3U5UA 2C18A 1Y5WA 4S2BA 1PTDA 2P88A 4H1ZA 3SADA 3PZNA 3MCNA 2NT0A 4ZA0A 2VZSA 4XV0A 1EKOA 3WEZA 4IFKA 4M5PA 3DAQA 3BAXA 2XFFA 2EJAA 9CGTA 1PJ9A 4KMQA 1Q4WA 4M1BA 3XINA 1E1FA 1UYQA 1GZ1A 3BV7A 1SZEA 3ITCA 4AC7C 3GKFA 4WXZA 1XGZA 5BOOA 4PMZA 6ALDA 5KMYA 4XZWA 1SZGA 2HWGA 5HNRA 1ICPA 1ZPTA 1PZ3A 2JEPA 2PPGA 4L61A 1ICSA 1GKQA 3MU7A 3K8MA 2PB1A 3ARZA 4C6NA 1UWAA 3SW6A 4LXFA 3VGBA 3L4ZA 3QC0A 4DBDA 3HTWA 2AKZA 4AEEA 4CCDA 1W1VA 1NP0A 3LPGA 1MXGA 5ABFA 2IS7A 3CUZA 2V68A 1JFHA 1WKFA 4GQQA 4L6HA 2WMFA 3I6TA 4BFAA 4M82A 5FSDC 3DCPA 4GVGA 3UWEA 3SJ3A 1FH9A 2ZE0A 1UZ1A 4HVXA 3VZYA 5JH1A 4QS6A 3HA1A 4HHHA 4UR8A 1BD0A 2HROA 1C92A 1V79A 1F3XA 1G9HA 1V77A 3VOHA 2QCEA 1VYPX 4A3UA 1TTJA 4IPIA 1VS1A 5E93A 3A9BA 1XQKA 2ASHA 3LCHA 3TNOA 1UROA 2GL5A 4JX4A 3DU0A 1B4EA 3NOYA 3RO8A 2HE5A 3SM0A 3FAWA 3XISA 3DKLA 3LQLA 1LLOA 1KC7A 1OQFA 1RK6A 2VENA 1GW1A 1QOXA 3U3HA 1Q4NX 1KLYA 3T0AA 3ZR4A 4QCFA 3BLEA 2GQ8A 3S3GA 3W83A 3I7QA 2PRHA 3CPRA 4XWUA 4BQ3A 2YDRA 4N0RA 4TO8A 4LVAA 5LSMA 1EA9C 1XCXA 3LTSA 2WCSA 3DEQA 2DIEA 4AX7A 5U7SA 2DY3A 3NG3A 3ZVHA 2CYGA