3OS1A

Pfv target capture complex (tcc) at 2.97 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The mechanism of retroviral integration from X-ray structures of its key intermediates
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3os1A04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3os1A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3os1A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3os1A03
4E0DA 2YRVA 4FK2A 1VRTA 1RBVA 4BD3A 4CJSA 2WOMA 2PZSA 3KLEA 1BIZA 4KB1A 3H08A 2M1HA 5JS1A 1KFSA 3F70A 4CF1A 4ICLA 3NBPA 2QQRA 3MEUA 3HJFA 4RW6A 1XHZA 4FYDA 3LGFA 4CJUA 3OMGA 1DLOA 4IDKA 4GMJB 4RW8A 3MP6A 4CEFA 4FJIA 2B6AA 4N5SA 1SL1A 3HT3A 4N4GA 3L2UA 3PX4A 3L3UA 3B6PA 3G0ZA 3P8HA 1WSIA 2XY8A 3NH0A 5J26A 4FK4A 1BL3A 3AVNA 5SZTA 1VK0A 3DB4A 1S5JA 3PMIA 4CERA 4FU6A 4Q5WA 3SPZA 1D9FA 5JS2A 4KB0A 3QJ6A 3LP1A 4CGIA 4CK3A 4RW9A 3T19A 2KZMA 4CJQA 5KE2A 1JL2A 3KLIA 2HHTA 3AA4A 3SUPA 4QOZB 3K59A 3QETA 2JZ2A 5FDLA 5J1EA 3HVTA 3UWNA 5C42A 4M3YA 3CFPA 4B9TA 1KVCA 3L2VA 1L3VA 3WNHA 4CJTA 4DSKA 4CF9A 3NTHA 4M3TA 5KI6A 1Q8IA 3NF6A 2D5RA 2F8SA 2D0CA 3QEXA 1RILA 1YTUA 4CHYA 2BUDA 1IG9A 5HRRA 2KFNA 1HQEA 2K3YA 3TAQA 4FJ8A 3BDLA 1WLJA 2G8FA 3WNFA 4HUEA 3AVHA 4I7FA 3QKJA 2VG5A 2Q3SA 2BKDN 3ZSVA 4DQIA 5DMRA 4JLHA 1Q9YA 4C5GA 2RKIA 1VSEA 3LAMA 3I0SA 1IKYA 3I0RA 2KTQA 1S1UA 4FM2A 1A5XA 4LD6A 1S9GA 3P8DA 3V9WA 4W5RA 3SD4A 3NNQA 3LPUA 4RG8A 4X34A 3LAKA 3DLRA 3KD1E 3ZT2A 5HRPA 4WE1A 3K5OA 4J2DA 4C8OA 2RHUA 3CG7A 2B8AA 1BI4A 3AVKA 3NAEA 4PLIA 3DYAA 4FJGA 3QIOA 4M3RA 4BE2A 3ZEHA 3M8SA 1LWCA 3OYGA 1RBTA 4CFCA 4CGFA 3LDSA 3L2WA 1RT6A 2YNIA 5HRSA 5D6WA 1RT2A 4B9XA 3V1RA 1WAJA 3SZ2A 4KV8A 5IN1A 2JGUA 4HTUA 2Y1JA 2G8UA 3VQAA 3RWUA 1TGOA 1D8YA 1HYSA 3AVGA 3MECA 1SSFA 3WNGA 3LYIA 4DTXA 3TWHA 4CEBA 4M42A 4CESA 2HNDA 1VSMA 2RI3A 1BQNA 2L3RA 4CIEA 3K2PA 2OPRA 3VA0A 3QNOA 3NTKA 4IURA 3OYMA 2HQEA 2GFAA 2ZD1A 2ETJA 1X9MA 2NLUA 1Y97A 1ZBLA 1UAXA 4IUUA 4DU4A 1LW0A 1HMVA 3AVAA 1KRPA 2EQKA 3L8BA 2NUBA 2X6SA 1XI1A 4ZTFA 1JLGA 4ID1A 3QINA 3DOKA 4FXDA 4FM1A 3V4IA 3CM5A 2ITGA 3AVIA 4CGHA 4KHUA 5J2MA 3META 4DTJA 2OZSA 1YVUA 3MEDA 2O4IA 5C6SA 3HXMA 1B9FA 4GW6A 3ZT0A 4CJ3A 3AO1A 2HHVA 1ITGA 4BDPA 2E6LA 5CZ1A 4N4IA 1U49A 1C1AA 4Z4FA 2BGGA 4KTWA 4BDZA 1LWEA 3HYFA 4FW1A 3K5MA 3ZSWA 4C8NA 3O3HA 1NJWA 1G5VA 3SUQA 1XC9A 3FFIA 2HHSA 4C5EA 4JRPA 4CHQA 4QW2A 1JXEA 2IS3A 3V1OA 1D5AA 1SKSA 3VQ8A 3C6UA 2QXFA 1RT1A 4CECA 2QKBA 4RW7A 3VQ7A 1K6YA 4N41A 4A4FA 2FC0A 4DQPA 3O3GA 1HNVA 4ELVA 4Z4IA 3H6ZA 4DLEA 2EX3A 3V9ZA 1I39A 4ZTJA 3VQBA 4OPKA 4IG0A 1ZBIA 1CXUA 4HCCA 3OYEA 1LW2A 1LAWA 4BDYA 3NF9A 3HP9A 5J39A 4NCBA 4DTNA 3OYDA 3V6DA 4DWIA 3I8DA 5I42A 3SNNA 4DF4A 3DRPA 4K8XA 3SQ1A 3QBYA 4F3TA 4PY5A 2HHWA 2LCCA 4O0JA 2O4XB 3HK2A 1NOZA 2IOCA 2IDOA 3HPGA 5C0MA 1Z25A 5M9OA 3FDRA 3ZT4A 5K14A 4KHQA 2IAJA 1SV5A 1ASWA 3ZSZA 1HRHA 5KRTA 1TKDA 1RDCA 2RHIA 2HNYA 4QAGA 2VG6A 2EHGA 4CRIA 4J2EA 1EKEA 3SV4A 4M41A 4IG3A 2ZE2A 1SL0A 3HPHA 4B08A 4HVJA 2HB5A 4CGDA 2KZZA 2XHBA 3MP1A 3JSMA 1C1BA 2E4LA 3QNNA 4CGJA 2X35A 3LP2A 2OA8A 4KFBA 3VQCA 3AA3A 1RBUA 3ZSQA 2DFEA 3K5NA 4CHZA 3TR8A 4KHWA 1ZBFA 4MQ3A 4CJEA 3H8ZA 1EX4A 2GBZA 3LGLA 4E1MA 2RHXA 4IFVA 1ASUA 4CFBA 3NHGA 2HNZA 1NK8A 1Q9XA 3Q1JA 4DTUA 3RMDA 4CJWA 2XY7A 4DSEA 4NCAA 1TAUA 3V9XA 3E9FA 2LRQA 3KUFA 1NJXA 2X4XA 1X9WA 3QEWA 3OYAA 2YHAA 4B9SA 4Z02A 1MHNA 4HHTA 4FJKA 2KQ2A 1T05A 4OKEA 4FJMA 3K57A 5CIUA 4I2PA 3OYFA 4B9NA 5D6XA 3F73A 5D6YA 3OS0A 3AO3A 4KHYA 1LV5A 3E9GA 1GOBA 3OS1A 4E7JA 1QHTA 5J2PA 4PL6A 1NK9A 4PWDA 1S1TA 4C8MA 4M3ZA 4E7KA 1GOAA 4NCGA 3VN5A 4CEZA 3OYJA 4FM0A 3TAGA 3S3OA 1WNSA 1SKRA 3GOXA 4OGCA 1QSSA 1KSPA 2VWJA 4CIGA 1WN7A 1HJRA 3PV8A 2X4YA 3KLFA 2OYQA 1RI0A 4O0IA 4FLWA 3CFOA 4N56A 1S6PA 4OVLA 1RTJA 1U47A 3LLRA 2KW4A 4CJFA 1KLNA 3CEYA 4EP5A 2JTFA 3SQ2A 3PMTA 1KCFA 3OA6A 1A5VA 4HUGA 4EZ9A 3RR7A 1RBRA 1EP4A 1HYZA 3C94A 5CY4A 1VSKA 1U48A 2GF7A 3ZSXA 2RJCA 4H8KA 3MXMA 4FJJA 4LH4A 2Z1HA 2EFIA 3VQ6A 1S1XA 4N47A 3DOLA 4CEDA 1TL3A 2G8KA 3NH2A 3QESA 4CE9A 2D0BA 3ULDA 4PUOA 2OPSA 3OYHA 3VQDA 2OPPA 1XNIA 1IH7A 3NTIA 2DIGA 3RMAA 3UIQA 1RTDA 2R57A 5CYQA 1KVAA 1F21A 3KTQA 3LP3A 2XRIA 1VSFA 4CF8A 5KTQA 1NK6A 3CM6A 3VQ4A 4DTMA 1NJZA 3C4SA 4KO0A 1NKCA 4AILC 2HQXA 3S9HA 3S3MA 4IUQA 5KGWA 4OLAA 4LSLA 3EY1A 3MEVA 3V1QA 4XIUA 4FLXA 1SKWA 1MU2A 1TL1A 3TI0A 4Z0UA 2HVHA 3KKRA 2JLEA 2WACA 1HYVA 5CYMA 4B3OA 2D9TA 1B92A 2WONA 1O1WA 2EQMA 1YTAA 3V9SA 3OS2A 1BI4B 1REVA 2VWKA 1X9SA 4AH9A 2VYTA 4W5TA 3OYNA 4OKJA 1C0MA 2B4JA 3SJJA 4C5IA 4LSNA 1KVBA 2XY5A 4OKKA 3DI6A 1VSHA 4DFKA 4YNQA 4H4OA 2Z1JA 2E5QA 4GY5A 1RTIA 3SYZA 1TAQA 4B8AB 5C24A 3DLBA 2EQUA 1TK8A 4B9LA 4DSLA 3HPOA 1JLFA 1JLQA 3CQ8A 2LVMA 1X1PA 4Z4GA 2YNGA 4M3XA 3PX0A 2IC3A 4CJ4A 5J2NA 1FXXA 3MO8A 3KK1A 2R5MA 3MAQA 4AHUA 3S3NA 1KLMA 1B9DA 1ZBUA 4FJLA 2IGIA 4FLTA 4OGEA 3VQ9A 4DTRA 2RHZA 3SUNA 4CJPA 2X78A 2YNHA 2GFUA 3AO5A 4YFUA 2F8TA 1WSGA 3LX7A 4Z4EA 3HSTB 3O4QA 3O3FA 1IKVA 5J2QA 4HUFA 4E3SA 1JLAA 3NF7A 2ATQA 3KLGA 3THVA 3VQPA 2DY4A 1BCOA 5D3GA 1FKPA 2G8VA 4DMNA 3SQ0A 4JS4A 3HL8A 4KI4A 4HCZA 3KK3A 2P1JA 1S1WA 4FJ5A 1UOCA 4CJLA 3RRHA 2HVIA 4CJKA 4TSXA 3NH1A 4DG1A 1A5WA 4ELUA 3AVCA 5CZ2A 3IG1A 4C8KA 4FLZA 3QEIA 3P83D 4IUPA 3AVJA 1LWFA 4CIFA 4GVMA 3EZ5A 4E19A 2RHYA 4DFPA 4CHNA 4KHSA 4Q0BA 2AJQA 4J2AA 2R58A 4QQ6A 4L8RB 4W5QA 2L8DA 1HNIA 3FEOA 1T03A 4QQGA 4AHVA 3L2RA 4AHSA 1RNHA 3VA3A 1L3UA 2CKKA 1FK9A 3OJSA 3ISNC 2RJFA 4OJRA 3D45A 4M3UA 3OYKA 4K8ZA 4FJNA 1NKBA 4G1QA 4ZHRA 1ASVA 1RT4A 3LP0A 4DFMA 4CK1A 5FRNA 4AHTA 3BDPA 1GOCA 4CGGA 1RT7A 2QK9A 1QSLA 2PYJA 2OPQA 3OYIA 1TV6A 1WGSA 3AVFA 4DS4A 4OPJA 3V9UA 3PO4A 1JLEA 3DLGA 2YKMA 2RJDA 1VSDA 1TVRA 3O8VA 4CFAA 4N4HA 5HROA 3U3YA 1WSHA 4DU1A 2FBTA 1JKHA 4DSIA 3P1GA 2LTOA 1CXQA 2B5JA 4FCYA 3TANA 4IUVA 4NS5A 3KK2A 3S6WA 4E7HA 1L3SA 1J53A 1TKXA 5FROA 2IG0A 2I5JA 2RPIA 3K58A 4FL6A 4F3OA 2PYLA 1FKOA 4DQRA 2MWOA 4RG2A 3LZJA 3E01A 3M8PA 1ZYQA 3MEAA 3TAFA 3AVMA 3WNEA 4IKFA 2M16A 1SUQA 2P5OA 4A4GA 3ZSYA 3LWMA 4O5BA 1G15A 3MEGA 2YHBA 3D0PA 3QEVA 4W5OA 3NDKA 2XDPA 1OI1A 2P51A 4FW2A 1NKEA 3ZSOA 2P0KA 3NF8A 3TAEA 2X6NA 4FLYA 1RTHA 2R7YA 4FLUA 3U6FA 4CEEA 3LZIA 4JRQA 4B9VA 1N27A 1BCMA 2EQJA 4F2RA 1R0AA 2GV9A 4DQQA 3B6OA 3AVLA 3ITHA 3AO2A 4I9QA 3HVRA 3DMJA 2G8IA 4CJRA 2BANA 2QKKA 2RF2A 5SWMA 3DM2A 4DSFA 3PUFA 4Y1DA 3CYMA 4Y1CA 2FBXA 5KE3A 3L2QA 2RI5A 4CF2A 1CZBA 1KHCA 4FZZA 4FJ9A 1OYXA 1JL1A 1C1CA 2LDMA 5KGXA 3O4NA 4CJ5A 3KD5E 1RDDA 3OVNA 4KTZA 2A1RA 3MEEA 4CEOA 3OY9A 4UC4A 4M3WA 4CF0A 4B9UA 1U04A 4PQUA 4LY7A 3OMCA 3VQQA 3A2FA 1RT5A 3CFRA 3U3GA 1QQCA 2DFFA 1WJSA 3DLEA 4L59A 4KREA 1BISA 4DTSA 1W9HA 2W42A 3LWLA 3QIPA 1NK7A 2G8WA 1S1VA 3ASMA 4II1A 1WSEA 5FRMA 3IRXA 3AV9A 4KRFA 3M8QA 4IUTA 1T7PA 1IKXA 4DTOA 3KJVA 1JLCA 2Y1IA 1BGXT 3NE6A 3DRSA 1OZ2A 4CFDA 3DLHA 1S9EA 4R5PA 1C6VA 5E41A 2PQWA 2E6MA 3G10A 2OZMA 4CCHA 3ALYA 3ZSRA 4N76A 1RDAA 3NFAA 4IBNA 3ZT3A 1D9DA 3DRRA 3RMCA 2HMIA 4EZ6A 1RBSA 2O4GA 3OB9A 4CHOA 2XY6A 4CK2A 3SQ4A 4ID5A 1QS4A 1NOYA 2XK0A 4M45A 3JYTA 3UT1A 4DF8A 3TAPA 2DIQA 1C0TA 1EETA 4E89A 3TABA 1QTMA 1WSJA 2GUIA 1UA1A 4CEQA 3SCXA 2RO0A 4PA1A 2XO7A 2L89A 4EDUA 4W5NA 4CHPA 1IO2A 1QSYA 4NZGA 1WJQA 1WJRA 2E6NA 3PNWC 5EU7A 2VG7A 3ZCMA 1J5OA 3TAMA 1TKZA 1UWBA 1CZ9A 4F2SA 3OQ5A 2BIVA 4QVZA 1KFDA 1VSLA 1KTQA 2HW3A 1U45A 3C95A 3MP8A 2F96A 5DK5A 1H3ZA 5HP1A 3AA2A 4LD0A 4FVMA 3IAYA 3MXJA 4CEAA 2MWPA 3LPTA 4KHNA 5T7BA 1OZ3A 4KTQA 1WAFA 3RR8A 4LH5A 4Z4CA 4F8RA 4DU3A 1L5UA 2HHUA 2BDPA 3HP6A 5HLFA 1RT3A 1NK4A 1I3AA 1SL2A 3SV3A 3HO1A 2LSNA 3IS9A 3PO5A 2DAQA 4KPYA 1TKTA 3RTVA 4FJHA 3DB3A 1LAVA 4DFJA 3NCIA 4F4KA 4DLGA 2KFZA 4B9MA 3DLKA 4I9LA 2A1SA 2D0AA 3T1AA 1S6QA 4C5HA 4QQDA 3ME9A 4FJXA 3AVBA 1NJYA 4KAZA 3FLGA 4A4EA 1Z26A 4DTPA 3V81A 3L3VA 1TK0A 4OVAA 1VRUA 3KKSA 4KKOA 3SUOA 1YT3A 1HPZA 3OJUA 3NGYA 2F5KA 3QLHA 2G8HA 5HBMA 3RRGA 1W0HA 2G3RA 2RI2A 1DTTA 1DTQA 3F9KA 1VSIA 3DLMA 5KCOA 2FHDA 3HM9A 3NGZA 2DFHA 4PLLA 4BACA 1CLQA 3OYBA 4QCLA 2ZQBA 2X74A 1ZBHA 3RMBA 3QO9A 1L3TA 3AO4A 4EP4A 3SI6A 2P5GA 2QQSA 1J54A 1NK5A 4NYNA 4OLBA 2RJEA 3EAEA 3SPYA 3NGIA 1BQMA 1U4BA 1N6QA 3OYCA 2O4XA 3MEWA 4BE1A 3VQ5A 5C25A 1N5YA 2FBVA 4FZYA 3PY8A 1EXQA 1XHXA 4FJ7A 4A4HA 5IAYA 4I2QA 3KLHA 4NYFA 4UQGA 1QE1A 1RDBA 4J2BA 1XWLA 4RW4A 3PFSA 4H4MA 4DS5A 2PY5A 2RN2A 4BWMA 1WSFA 3ZT1A 5KRSA 2EKOA 3TARA 5KCHA 3PX6A 3P5JA 4BWJA 4E7IA 3LANA 1J9AA 4JS5A 4O55A 5HRNA 1NK0A 3QEPA 2YNFA 4FZXC 1JXBA 3T3FA 4Z4HA 2FBYA 1RCHA 3EYZA 1T8EA 4FK0A 2DTUA 1JLBA 4O4GA 2R5AA 1BHLA 1TK5A 2YV0X 2Z1GA 2YKNA 3LH0A 3QIIA 4ELTA 4MFBA 4FLVA 3AA5X 3LALA 2K3XA 3MXIA 4BE0A 1IKWA 3L42A 3QERA 4O44A 4KI6A 2X4WA 4HCBA 1BIUA 2M0OA 4C8LA 4B8CA 1VSJA 1UA0A 4E1NA 4DSJA 2HHXA 4E7LA 5I3UA 4B9WA 1HQUA 3K5LA 4AHRA 3M8RA 4DQSA 1C0UA 3VQEA 3ASKA 5KH6A 3M9QA 3FC3A 2HHQA 4AHCA 2BE2A 2Z1IA 4CJVA 3C6TA 3KIOA 3OYLA 4IFYA 3BGRA 4Q5VA
chains in the Genus database with same CATH superfamily
4XORA 2ASPA 4E0DA 1D1AA 2V9PA 2YX6A 3ZMZA 5IXBA 4OB1B 3WEEB 3RI4A 3QDRB 4OMPA 3H08A 3M8FA 2QWMA 5JS1A 5HLTA 1KFSA 4CF1A 3N5NX 4CC4B 2KXCA 2QQRA 3SMPA 1H8KA 3G1OA 1T33A 1YO5C 2DK8A 3H0FA 4YPRA 3OIOA 1ODDA 2OCCH 2B6AA 2JMWA 4HOBA 5EX5A 1B7TA 4N4GA 3HT3A 4G7ZF 5GAN3 4OMOA 2IS4A 1KQSM 5J26A 2QVOA 3CC4A 2OTLN 1TUDA 3ENBA 1WHMA 3FZVA 5BOXA 5KK1A 3IL2A 4B1ZA 1S5JA 3PMIA 2X1EA 3EN9A 2K86A 1MMDA 3TDZC 1CKAA 3JCMd 1WCMJ 2ACJA 3CI5A 3E1SA 3CHWA 4EMGA 1KG5A 2JA5J 2XVCA 3LP1A 2H8RA 4CGIA 4CK3A 1KD1R 4L6V5 1JTYA 1WHKA 3KLIA 3AA4A 4QOZB 3AGRA 3QETA 3RR6A 2JZ2A 1LDKB 5FDLA 3SBGA 2KIQA 4C3IJ 1M27C 4C0GA 4RGUA 3KEOA 3CFPA 4B9TA 2QBYA 1YOVB 3WT0A 2XAQA 4RGXA 4XSXF 3L09A 2LKXA 3O80A 4CC7A 2OUMA 1RAIB 4ZDPA 2Q8KA 4PDKA 1Q8IA 2NUTB 5J6XA 5D5WB 3TEDA 1ZQ1A 2JS0A 5J3BA 2P9UB 4FYXB 1YTUA 2FZGB 4CHYA 2L0AA 1IG9A 5HRRA 2IRFG 3MK6A 2Y4XA 6PAXA 4BQAA 1WHUA 2PJRB 1UHCA 2JTEA 1IBLK 1DGWY 3F72A 4I7FA 3BR6A 3K0LA 4FWKA 5ILVA 1NYFA 2JW4A 4WF9L 2CS7A 3ISPA 1T08B 1S22A 4J6YA 5LJ5f 1YI2A 3E97A 2K7AA 4J8OA 2X3WD 3EEQA 4LD6A 1QVFM 3ERED 3CCJT 1SQKA 5GAN5 4UVBA 3V9WA 4JJNK 1YJWQ 2UXDK 3SD4A 3IRRA 3U4LA 2O5RA 3I5SA 3NNQA 2ASMA 4MHGA 1OEBA 2OTJI 1QNTA 4M7AC 3RTRA 4JEPA 4JN4A 1ETQA 1VQ9Q 5DV5A 5ICCA 1EIFA 4AIHA 1BI4A 4BRQA 3DYAA 4PZJA 4GLKA 3UKUB 1IZ1A 2ISYA 1NMNA 1RBTA 5LJWA 2QYOA 4LF6K 2LJ1A 5GAGJ 1RT6A 3IDHA 2NYSA 1EF4A 2RB6A 2MC4A 3RYRA 4B9XA 3IH7A 1RT2A 1WAJA 1M2VB 1HKCA 4KV8A 1Z9QA 3GO5A 2EFPA 1TC3C 2KXDA 2M51A 1KC8U 1U3OA 3DEEA 3OL4A 1YF5L 4HTUA 3R2XC 2A08A 4WQ5C 2E1CA 2J6OA 2E2QA 4FTHA 1TGOA 3AVGA 1FSEA 4GLMA 3WNGA 2V1DA 3JCMW 2MIOA 4UUTA 2RKHA 1W2BA 1Q18A 1V29B 4CI6A 3SZTA 2A5XA 2O9VA 4XH4A 5AFUA 1BQNA 1XC5A 2L3RA 3BG3A 1SS6A 2OPRA 3GFLA 5J3LA 1WJEA 1BW5A 1HKTA 3BR0A 3NTKA 4IURA 4HLYA 1X27A 5CKTA 2VQCA 2VWFA 2F5CA 2GFAA 3LW5E 3GVAA 2L4AA 3S1NJ 1Y97A 1ZBLA 1BIAA 1M1KC 1UAXA 1G3WA 4IUUA 2CUBA 2M30A 3EUHC 2QUFA 1JTXA 1JQQA 2JUCA 1I5ZA 2RQWA 3WODF 3GYHX 3Q7BA 3A4CA 1E3OC 3HTSB 3H92A 4DKWA 3FHFA 4ZTFA 1GUUA 2E7WA 4HF0A 3SAHA 1ZLMA 1PNJA 1IGUA 2H8WA 5B1AH 2P9SB 1LDJA 3JB9I 4HF2A 2OCEA 3DOKA 3TU5A 3V4IA 3CM5A 2ITGA 3A5ZB 2OZSA 2DPUA 2CZ7B 3TW7A 2JN6A 4CCNA 2Y9YA 4ISFA 2QA4T 3SDGA 1B9FA 4XU1A 4GW6A 1Z9ZA 2LCSA 3DBHB 1HBXG 4YDUA 2X6XA 2RNGA 1C1AA 4JI3K 3JCMh 4BDZA 4IQJA 2KK4A 5IT9Z 2L54A 2XKPA 3ZGKA 4C8NA 2A07F 4LF9K 4JHDA 4C2MJ 4IL6C 2HHSA 1DP7P 1X75C 4C5EA 4QW2A 2IS3A 4KGXB 3V1OA 5FPEA 1D5AA 2ZNZA 1SKSA 2KHMA 5J4YA 2C0TA 3VERA 1VQMI 2QEXQ 5AQGA 2KROA 3MWPA 3N0UA 4JD2A 4JJCA 4AIKA 4RW7A 3VQ7A 3VJPA 4A5NA 3SAFA 4N41A 3L2ZA 4NC6A 2L2PA 3QYHB 4PJJA 2KSSA 4DQPA 4E7SA 3G1JA 3M3YJ 5HLGA 2PMZN 4PL8A 4BI8B 2ZKZA 1OCPA 5EGOB 2QTDA 2MI6A 2EX3A 3O3KA 3V9ZA 2OQGA 3JRCA 1YJNQ 4OPKA 4IG0A 2O8CA 1ZBIA 4ZC3A 2VLAA 1CXUA 5TJJA 1K9MU 1QCOA 5L3FA 1OLTA 5AR0A 1LW2A 2V26A 3CC7Q 3I3LA 1LAWA 3ROUA 3NF9A 2HOTA 1QO0D 4M7AF 5IY5H 2FSJA 5J39A 2HL3A 2P9IA 1YS7A 3OYDA 2YX4A 5E3OA 3CCEA 5I42A 5BRFA 4XRMA 3QICA 2H3EB 4BRCA 3SQ1A 3CMAT 2OPTA 3KZYA 3OW2A 4E47A 3QBYA 4IXCA 4F3TA 4XKCA 2KJCA 3JCMV 2DDBA 1LJ9A 1BJZA 1KYZA 4LB5A 4O5FA 2DA1A 2O4XB 2YUSA 2K85A 5ICFA 1PWTA 3EO3A 3HPGA 1GLBG 1Q81O 1KAZA 4HWIA 3CCUQ 1RACB 2BZYA 4KHQA 2KR3A 4KT6A 1ASWA 2CT3A 1A0NB 1RDWX 4PK4A 4X9CA 2FXAA 2KRNA 1O7LA 4FASD 4FWMA 1FWZA 1OH6A 5H2FC 1SFUA 4UXNA 3FM3A 3F8BA 3S2HJ 4M7AB 2HPMA 1A6IA 2EHGA 1R4NB 4DZPA 1YIJN 5EG0B 2CFXA 2JG6A 3FX3A 5LJ5d 4A69C 3MZHA 2VBWA 2DAOA 5GANf 4M41A 4MDWA 1LQ1A 4U0VA 1SL0A 2CYZB 4HQMA 4B08A 2BY2A 4J7IA 1Z21A 2AQFA 2VVKA 1IRXA 5I2MA 4YORA 5K5OA 4XH1A 2PVGB 3D0SA 4CCOA 3A1YA 4NC8A 3MP1A 4Z8AA 2E4LA 3FJPA 4PJOD 4CGJA 2WTUA 1X2MA 1R58A 2X35A 5F1JA 3FXJA 3U23A 1W4SA 5LJ3f 3VQCA 4HQEA 4DV0K 3AA3A 1RBUA 1AZGB 3ZSQA 4XKBA 2O61A 2ZXWH 4EA5A 4OB3B 1X2KA 3TW6A 3M0PA 3VTHA 2A42A 4JKGA 3HIFA 2CSOA 3V7RA 1YWOA 5BRDA 2HNZA 1NK8A 1Q9XA 1YQKA 4MFEA 5KYXA 4CJ7A 3KP5A 1M3QA 4ATOA 5M5WJ 3HFOA 1N8RU 4CZMA 4A57A 3KWGA 2HMPA 4RCBA 4NCAA 3BW1A 3E9FA 1XQSC 5E3NA 1NJXA 3SHWA 1NGBA 2DMTA 2PBDA 3QEWA 3CPFA 5E8GA 4B3AA 2YHAA 4WCGA 2MA3A 4J9HA 4HHTA 2R7UA 2DOAA 1VQNN 1J5YA 4XK8E 4GY2B 5CIUA 3C65A 2GZWA 5FLXZ 4BUPA 4C92B 3ENHA 4NB4A 2K9SA 4XKWA 1TXQA 2FUG2 2PNIA 4L9NA 5GMKm 2KQWA 1LV5A 3FIWA 2UUCK 3E9GA 3IQLA 4DR4K 1GOBA 3OS1A 1QHTA 2O2OA 4PL6A 1TYQA 2DA6A 4C8MA 1TS9A 4A54A 4M3ZA 4RMOA 1JCGA 4NCGA 3KVGA 3TSQA 1JHFA 3TAGA 4DUZK 3H3VK 4BVOA 4V19K 4JKHA 1VQ9T 4M77G 2O03A 2DA5A 2VWJA 1VFCA 5CKEA 5IT9K 3RKWA 3M59A 4DW6A 5GMKl 1FP1D 2E2IJ 1R59O 4AIDA 3CWUA 4FLWA 3LSHA 4N56A 4BXXJ 4XKVA 2CP2A 3J80K 1KLNA 1S72Q 2JTFA 3SQ2A 4I6MA 1KU3A 1KCFA 3OA6A 5GJWB 1UJ0A 3ZL7C 1Z3XA 1A5VA 4EZ9A 3RR7A 3KETA 5GADJ 2NOGA 2Z33A 1VSKA 3CD6I 1U48A 2GF7A 2GTJA 1N8RR 4MFDA 2Z0WA 4LH4A 2QWNA 2K5CA 2BVLA 3GTQJ 4JJBA 1DJ7B 4N47A 1KD1O 2JMAA 4JLGA 1DDNA 3L4IA 3NH2A 4RAGA 3BFMA 1IG7A 4CE9A 3I54A 3U9GA 3JCMP 5GAGP 3W3CA 4XTWA 2M02A 4PUOA 3U2RA 5FKKA 1XNIA 1A5JA 2DETA 1ETYA 3T1YK 3LSTA 1RTDA 3WTXC 4B22A 1KVAA 4J5YA 4HZFA 1RIOH 5FU6C 1MMNA 2XRIA 3C3WA 5CO7A 4U67L 5LBQA 3QRFF 3S16J 3M6GA 5KTQA 1WBBA 3DV8A 2K9GA 4RLFA 3CCSQ 2E1YA 4I99C 4PJ0C 1ETWA 1QQNA 2HS5A 3SXYA 1X3MA 1WNLA 2DNUA 4IUQA 3V1QA 1ZG3A 1VQKI 1VQPA 1MU2A 2R7OA 4IEJA 2LKPA 4LITA 3QPSA 3BR2A 2M87A 2DL8A 4C1NK 3TO7A 4M78G 2CZ6B 2XPVA 1VQON 3F8NA 1C0WA 2PLYA 1B92A 2H3JA 4ABZA 4J00A 1ARKA 1QPIA 1PUEE 3I59A 1YTAA 3V9SA 2TRTA 3CCLT 5I9EB 4E9GA 4XR6A 3PLAA 2CU7A 3FXQA 1BA5A 1REVA 4FT8A 1X9SA 3RMQA 5E84A 1E7OA 4KUMA 1KO9A 4I0AA 2RA2A 2VYTA 4OKJA 4MMKA 4LFBK 2B4JA 2JT4A 2DA9A 2KYMA 1B8IB 3SJJA 5KAFC 1KVBA 4GXOA 1ZBJA 1QCFA 5C2FA 2QEXT 4EMKC 1W36D 4YNQA 1RTIA 3HXLA 3TBIA 2ZWHA 4C92D 2DXIA 4B8AB 4DIQA 4HVUA 5EG2A 5GANd 2CQXA 3DLAA 1SMTA 1LE8B 2B63J 4GV3A 3L6QA 2CW0F 1JLFA 1RAAB 1I81A 5I2SA 4KNYA 4Z4GA 3BZKA 1XG1A 2YNGA 2CQ7A 1M1GA 1HQCA 2CO5A 3ELKA 4M3XA 3PX0A 2IC3A 2EFOA 1QVGA 1MBGA 3H36A 4C3JJ 2EYWA 2PU9B 1SFXA 5C3EJ 2EIFA 5LJ3d 5MLCQ 2IXSA 1BU1A 3MAQA 3S3NA 1KLMA 2P5VA 1VQ8A 1WKMA 2G7HA 1QVFA 2W40A 2Z5UA 3CCUN 1LVAA 1KD1C 4J9CA 5KYWA 3LQQA 2JWKA 1VTNC 3AAQA 2EV5A 1ZK8A 3EKSA 1YUWA 1RKWA 4H5TA 1HDDC 1JEGA 3O3FA 3HGGA 4RTFD 3M1EA 4A3LJ 1A31A 1B07A 3NF7A 3THVA 4BY9C 3VQPA 5FLXK 1I1JA 2W6LA 3CCYA 5GTHC 5F1RA 3G71A 3G25A 4ORZA 1G4DA 1NPPA 4DMNA 2PMUA 4AM3A 3SQ0A 5GAMd 2XGDA 1O75A 4KI4A 4HCZA 3SMSA 2P1JA 4M7DA 5JI6A 3KBGA 1OMIA 3WQTA 1K7AA 1P2FA 2QWRA 3RRHA 1ZGWA 3MAJA 3ZP5A 3W0LA 4CJKA 2VB6A 1WVRA 1WPKA 2HXOA 3QBWA 1FTTA 1NG6A 4DG1A 1KONA 1SFKA 4YOXA 2LYCA 1WSUA 1YHQI 1Q82U 3VS0A 3V4GA 4F7UA 3EKUA 1LWFA 4CIFA 4HDVA 4GVMA 2IA0A 2E1ZA 1YQLA 3THWA 2R7WA 1EO1A 4BEHA 2D1XA 4EVIA 2LT4A 5IP7J 1M90R 5M1PA 4ESJA 4N0AC 4Q0BA 1O4XA 2R7VA 1PM3A 3WXLA 4J2AA 3DKXA 1RDUA 3MCPA 2L8DA 1X19A 3ZQIA 3LA3A 5CVUA 4O6JA 2DZCA 1P4XA 2CV0A 5ERIA 3CZ6A 3OJSA 5JLXA 3ISNC 1R1VA 3IMXA 1NG7A 1I3QJ 4KIBA 1AT1B 1TQMA 4K8ZA 2CP0A 3E5XA 4ISGA 1HLVA 1JCEA 1IN8A 1JU5C 5FRNA 1ZLKA 4OMFB 4G12A 4LMYA 1RT7A 2QK9A 2DZ9A 2MC3A 3CCRI 1X3WB 2HXIA 3FMRA 1SANA 1WGSA 5HS8A 1S7AA 3VGMA 3BDDA 3AVFA 3KEYA 3W2VA 2HHHK 3CMEN 1VZ0A 3OYYA 4BRMA 3DLGA 3WHCA 1TQPA 1Y6IA 3FWEA 1IW7F 4CFAA 1T6CA 3S17J 3HPWA 1XG7A 3ABMH 2Y31A 1PP7U 1JKHA 4DSIA 3P1GA 5J1YA 2LTOA 5L3CA 3SWNC 3TANA 1VQ6I 3E3VA 1QPMA 3JRBA 2P9KB 4IHVA 4G9ZA 4X9DA 1HW2A 1Q82R 2BW3A 2I5JA 3BY7A 3KX2A 1ZRFA 1BI3A 4C8QD 4XH5A 3WVDB 4IZZA 2CGKA 1YITN 2PYLA 4ASNA 4WF2A 4DQRA 3VUBA 4OMMA 4RG2A 4UUVA 2I0NA 4XLCA 4XICA 4J83A 1N78A 3TAFA 1J09A 3EG9A 3AVMA 3WQUA 3TTCA 4IKFA 2PEXA 4BVPA 1HDPA 3NHNA 4V2SA 1MUNA 2HBMA 4M72A 2KQRA 4EJUA 2XG8D 4RGRA 4A0ZA 2QI2A 1ZG5A 3HSEA 2E12A 1QKXA 4EMKB 3D0PA 3WEEA 2CUZA 5FPNA 2ZPEB 4ESFA 1R0CB 1QZEA 5IT3A 4BI4A 4F17A 2ZBKA 3CJ7A 2WAFA 3ZSOA 5KPZA 1NKEA 4XK4A 4XLHA 4XLPF 4FLYA 4YFKF 1RTHA 2R7YA 3QWYA 4FLUA 2OF7A 4DV5K 1KC8C 2W1OA 4DQ2A 2RDPA 4PIIA 1LFPA 3CC2T 1BCMA 3VYTB 4LK0F 3HOUJ 2PG4A 4LOCA 2STTA 3ZMTA 3B6OA 1GRIA 3H46O 1SD7A 2R7TA 2CYYA 4X62K 3AO2A 4W97A 2R5ZB 4H0XB 3DXKB 5HK3A 2E5NA 1OCCH 1HX1A 2OJ2A 4DSFA 3PUFA 4Y1DA 3N5BB 3GTOJ 3O9UA 5BMZA 5EC7A 3FM5A 2BY0A 1EJ9A 3HRUA 5TKYA 4CF2A 1NJIR 4FZZA 1NGJA 4FJ9A 5JHFA 4LD5A 2VIXA 4YEJA 2EYZA 1OYXA 3ENOA 3SZPA 4XU2A 4BBSJ 4KIGA 5E8IA 1C1CA 2LDMA 5AZIB 2JHJA 3KD5E 2EGEA 1WFWA 4KTZA 2GLOA 1ZSGA 3CCMI 4IO9L 4UC4A 2OTLT 4FWOA 1OKRA 2GX9A 4BQLA 2W4SA 1TP4A 1R8OB 2Q97A 3A2FA 3CFRA 2UXXA 1TUUA 4EIKA 3TP0A 4S05A 2KRFA 3RPUD 2NUTA 3BQZA 1XGNA 2I7PA 2P9UA 3NQOA 4PJNA 1W9HA 3WHBA 3F0CA 4PGHA 1VRLA 1WDXA 1ACIA 2YDLA 1YQAA 1NK7A 4LFAK 1YG2A 3RSEB 2RD1A 1Q86U 1S1VA 3E66A 1FT9A 3ASMA 2BV6A 2PJRA 5A2QE 2D1KA 2EGAA 3R3LA 3RDVA 3HKSA 4EHTA 4GNIA 5IOZA 4IUTA 3ZQFA 1GCQC 3X28B 5LMNK 3NMUA 4AG2C 3W3DA 2FOWA 2CW8A 1ON2A 2HNIA 1RC9A 2Q1ZB 2Y0MA 4IRHA 2O8BB 5B3SH 5LGNA 3IAS2 3M57A 1VQMQ 1PSEA 2HOSA 2OZMA 1O7FA 3V7SA 4AM6A 2W41A 1TW2A 4EJZA 4CZJA 3ALYA 1P4WA 2I5UA 1KQ2A 2ZPGB 2O9SA 4BJ5C 3KEQA 3RMCA 2HMIA 5M1NA 2DJZA 3UKUA 2O4GA 1PP8F 3UB5A 5CVRA 3HOWJ 2BOLA 3OSVA 4RUGA 5AQZA 3UT1A 2QA4A 2JWLA 3A5LC 1MJ9A 2JVVA 4DOVA 1C0TA 1QTMA 4E89A 1M2VA 4EFHA 2GUIA 1ZSZC 3OA9A 2Y48A 2GIVA 4LDYA 1YJ9Q 5J8FA 1K4US 2EV0A 1IO2A 3ZMVA 1MW7A 4HCKA 2R0QC 3HTVA 3SWNB 1ZX6A 1WJQA 2VE9A 4IIMA 3IH2A 4A5BA 3PNWC 1H1VA 2VG7A 1J5OA 1PRMC 4FWSA 1NLPC 1S7EA 3S14J 4F2SA 1HA8A 1Q86R 3G6EI 2X9HA 1DGKN 2FRWA 1UFMA 3IUOA 2K5FA 1NGAA 3I35A 4QVZA 3V7CA 4JUVA 1U2VB 1VQ7I 2E88A 1U45A 3C95A 3MP8A 3E6MA 4U0YA 5HP1A 4QPQA 3AA2A 1T95A 4CSWA 2VJ5A 5AQWA 1AWXA 1WUAA 1A6QA 2PTKA 2GXGA 1X3NA 4E9EA 3CJRB 1X69A 3MXJA 5HS7A 3HSRA 2LY1A 3LPTA 5ELZA 4NUBA 1VQ5I 1BU6O 4OMLA 4YRVA 4KTQA 3RR8A 4B3SK 3LDNA 4RMNA 4LH5A 5BN8A 2D2WA 2K2VA 2KLAA 2P9SA 1ZELA 4CZIA 1MKMA 4A62A 1REPC 3D5RC 1KIKA 1RT3A 1NK4A 3CCVN 1K8AO 5CYVA 2FLOA 4RCCA 3O6WA 5BREA 2O31A 1R5GA 4RTXA 2OAZA 5J1RA 4PCQA 2XMFA 4CZCA 2V51B 4AIJA 2CZ0B 1EFNA 3CP2A 3OIPA 2E8AA 2O6GE 4LIVA 1XSDA 3W2WA 4F4KA 1OPKA 2KFZA 2LOOA 2WC2A 3U9DA 3DLKA 2LJ0A 3C18A 1P59A 1SHGA 4QQDA 5CVJA 4IXAA 5AQUA 3JB9H 5K5RA 1VQ4I 2RQRA 4FJXA 1UB4A 3JRZA 4KAZA 2YUOA 3FZMA 3D5SC 1QZZA 1KQSP 3OR2C 5GJVB 5KPRA 5HKCA 1N8RC 1YT3A 2LVSA 1NBEB 3OJUA 4MO7A 2E60A 1OVQA 1IC8A 1MSEC 3SBTA 3PO3J 1DTTA 2L3QA 1NM7A 4IQ4A 3P38A 4P96A 2AS5F 3QFUA 3RYPA 5EGOA 2DFUA 3JB9F 1BOBA 3BF1A 3TQNA 2CH5A 4X0GA 2WC9A 4ON0A 5FFXA 3BE3A 2VBYA 3E0JB 3MZYA 1L3TA 2VV5A 4YHHK 2DJIA 2RVCA 1KXPA 2P9LB 4FWPA 3EUKL 1JGGA 1OH8A 2RH2A 2MK5A 4E70A 2QQSA 1NK5A 2V1QA 1I07A 2EQIA 1P7JA 2MW8A 4OLBA 1HW1A 3EAEA 3SPYA 4RB2C 1UDLA 1BQMA 1M3CA 1X58A 1JKOC 1N6QA 1IUFA 3SYTA 3G0QA 3LSJA 2FMLA 1E4FT 2O4XA 3VQ5A 4BE1A 2OTJT 2JRMA 1N5YA 3E5QA 4ILGB 2CQQA 4FZYA 2DVJA 4XTZA 5AQKA 3MKDA 1XHXA 4UY8O 4ELYC 4VUBA 3D5LA 4DHYA 3VS4A 1HJOA 3MHXA 3P9IA 4J19A 3FISA 4BWMA 3CW7A 1M90O 5FPMA 5C10A 1VIEA 5HCKA 1PU8A 2M4KA 2EKOA 2O8DB 2JPSA 1QVFP 1QHGA 5KCHA 1VUBA 3PX6A 4M7AA 3DBRB 3OOUA 5EG0A 1MGTA 4BC4A 4JI8K 2GOMA 4E7IA 1ILYA 1GBQA 2AZVA 4I76A 5EF6A 2WAQA 4OIQF 1NK0A 1WEGA 3QEPA 2UXCK 2L7ZA 3FK6A 1FYLA 4CC2A 1TWBA 3PSFA 4DJAA 4HNTA 2VGMA 4OB2B 1T3LA 3I56N 1YJWA 5AQLA 1ZSZB 3A02A 1ZUUA 3H3NO 2DTUA 4O4GA 1BDGA 1Y56A 1NGGA 4DV6K 4BY1J 2JA6J 1VQ9A 2YKNA 2XDBA 4WQ5A 1QQJA 3EL2A 4FLVA 3LALA 1YIJT 3MXIA 2OZUA 1NTCA 3DTIA 3MKLA 1TT0A 3HRMA 4QIWN 4KI6A 1VF9A 2X4WA 1TL8A 1CZAN 2B9SA 1AWCA 2HGCA 1TTYA 3EE9A 3K1PA 2M1BA 2WBNA 1QP3A 4B8CA 3HFNA 3M4GA 1VHXA 3KZBA 4BUGA 4FOEA 4JNEA 3J7AF 3QU3A 2E10A 2VCPA 3N05A 2BXYA 4LJZF 2KPMA 5F0HA 3RVCA 3QWXX 3VEYA 5KYUB 2FOKA 1SAUA 3LWFA 1VQKQ 1LMZA 2R7XA 1QVPA 3SEZA 1Z7LA 2XIGA 5M5XJ 2W0ZA 4NO7A 4A2AA 3EUHA 4BRLA 4M9ZA 3FRNA 3PVQA 5L3GA 1WJDA 4K25A 4JYKA 3LSGA 3H41A 2VN2A 3CDHA 2DI3A 2GBQA 4C92A 4CJSA 2PVDB 4EW0A 3KLEA 1XQHA 1BIZA 1XOVA 4XLAA 5FD5A 3G4SN 1P92A 4BHPA 2DKGA 3BQYA 4HVWA 3HJFA 4RW6A 4FWQA 4FYDA 1DLOA 1BYMA 1V55H 4CEFA 2LKSA 3CBPA 2P6SA 3IV5A 1SL1A 2DPDA 4I7HA 1YJ9N 2YUQA 3PX4A 3L3UA 1PKTA 4DA4A 2EZKA 5D6EA 3P8HA 3GBTA 1VQNT 1WSIA 1YI2I 3ZQQA 5SZTA 4M7DG 4D7MA 2EYYA 1MUYA 5EZHA 3CIPA 4OWRB 3DB4A 2EH3A 2DJQA 2KIMA 5I21A 3VETA 4M77D 1D1CA 2R93J 1C0FA 2VQFK 2DRKA 4FSSA 2XB5A 3A8YA 5DPKA 1D9FA 5JS2A 4KB0A 3QJ6A 3L9FA 4MGRA 1D8JA 4CCJA 1SRMA 4F7UG 3T19A 4FPAA 2YLCA 5KE2A 5F08A 4K2EA 2XHCA 1LNXA 4CZEA 5J1EA 3HVTA 2BTFA 5EOYA 1R23A 2HF4A 1W0TA 3WNHA 4CJTA 3ZQGA 4CD1A 2LNBA 3K2AA 4HNUA 3H6EA 4DGWB 1E3HA 3BG6A 2QEXA 1K73U 2HI3A 1I27A 1NEBA 4KA4A 2Y0SA 3NF6A 5CHIA 1RILA 4UB8C 1TNTA 1K78B 2BUDA 4FJ8A 3DPUA 2XGEA 2WY7Q 2HQRA 1WLJA 2G8FA 3B02A 4HUEA 2L02A 3R1XA 4HV5A 1YJNA 3OSSC 4LF7K 3CC4N 3TDUC 5AQFA 2BKDN 1G3TA 2XASA 4DQIA 5DMRA 3JTHA 4JLHA 1Q82C 1Q9YA 3I0WA 3CC7A 1EA3A 4HAMA 1M3BA 4K11A 2I10A 1VSEA 3LAMA 3QJYA 1IKYA 3E9LA 5CK9A 4LNPA 1S1UA 2RREA 3IWFA 1TWCJ 1YHQQ 3MWMA 2OA4A 1O3RA 5IYBJ 1WWXA 3CBOA 2P0QA 2IIRA 1XCBA 1WIEA 4OMZA 1E3PA 2E3HA 4X34A 3DLRA 3I33A 4Y17A 1IO6A 3K5OA 2RHUA 2EFWA 4DR2K 1WJCA 4BRIA 1WHJA 1QA6A 4M3RA 3M8SA 4BAYA 4JZ4A 2VT3A 3OYGA 2ZJRF 2E4HA 2YG9A 4CGFA 2A5YB 3GX4X 5FKNA 1B8IA 4EJYA 2YNIA 2R5YB 3LCNA 5JR3A 3ZQCA 2JGUA 3FLCO 3DPLC 1JRIA 4E7ZA 1K9AA 1VQOT 2D1HA 4CZLA 1CGPA 3LMMA 3A5NC 3P31A 2Y1JA 2FZKB 2G8UA 1BL0A 5DUKA 2L7KA 3SJMA 4GO1A 1LE8A 3A8LB 1HYSA 3K4JA 3A1PA 2M2EA 4JAXA 3CCRQ 2H8HA 3TWHA 3CERA 4ZJZA 2HQAA 1ENHA 3GCMA 3BJAA 2EAYA 4B3MK 1OCTC 3VOVA 2HNDA 2DU9A 2RI3A 1H3HA 3ASOH 4ZYEA 1WJ5A 4OMQA 1Y96B 4RM2A 2HQEA 3RZDJ 4MZTA 1VQ6Q 4E9FA 1NJIC 5F1XA 3K2ZA 2LMJA 2ETJA 1X9MA 2MLKA 5FKMA 1SEUA 4DU4A 1LW0A 1HMVA 1KG1A 1IBKK 2VBZA 4A12A 3TL4X 4BBRJ 2NUBA 5JVGF 2KIFA 5IYDJ 2XV4S 2ZJQF 1JLGA 4HF1A 1DIZA 4FM1A 3MCZA 2K2MA 5AQNA 2P4RA 1MJAA 4MNUA 2CWEA 2HVSA 4KHUA 4KITB 4AG1C 4D0PA 2DLLA 4KULA 1LUJB 1OYYA 2B7EA 3AO1A 3C2BA 2KRMA 4BDPA 3FZHA 3UF4A 4XN0A 4N4IA 2W7NA 3K70D 1D5YA 4KBOA 3V8JA 1WXUA 1R22A 1LWEA 1U1TA 4A3KJ 2A36A 4A4KA 4M78E 4HW0A 4EMSA 1K4SA 2KP6A 4UOBA 3O3HA 3CD6T 1G5VA 2I7NA 4G94A 2C0IA 1XC9A 3M3ZA 1ZREA 2Z1DA 1DUXC 4UNOA 2HKOA 2AXTC 4OMNA 4CHQA 1JXEA 1I8FA 5DD4A 1N32K 2HZTA 5DM7L 1UZCA 3VQ8A 5F27A 3CJ1A 2HTSA 1QQIA 1JBMA 3EETA 3FXLA 2P0PA 3Q0UA 5FO5A 3C6UA 2QXFA 1M3HA 4XRSA 4CECA 3JS6A 3LWHA 3ZQLA 4IOCL 2IVWA 1TWAJ 1K6YA 3HDDA 3M0QA 1GFDA 3K4NA 2FC0A 3O3GA 1HNVA 1ZRCA 1TSFA 2W00A 4ELVA 3S8PA 2VE8A 4ENMA 5GAEP 2JSCA 4C0DB 1B34B 2XKOA 2AHJB 2K7LA 1I39A 4XIDA 5J40A 4YPHA 4HCCA 3Q7CA 1RAEB 4DBFA 2A69F 2VQLA 1RGIA 4JKDA 3RPUA 1MBJA 2ZZDA 5LMUK 4AVPA 1F4KA 4IHSA 2QDLA 2QSGX 2EBPA 1S72A 4AUXA 2UYTA 5L8RE 1JJ2S 4RAFA 4NCBA 3CXCP 4DBQA 2YU3A 1OCZH 5AIPA 1IGQA 3F8MA 4OO1J 4DF4A 2Y90A 3CCMQ 1Y8RB 5FPDA 3ZX2A 3EG3A 2VUMJ 1UJYA 6AT1B 4BKXA 1VQLQ 1PVSA 4CA0A 4PL7A 3JRHA 5JFRA 2V6EA 4IO8A 2H6CA 4C2UA 1BG3A 2IDOA 1Q86C 1K8KB 5C0MA 2P9KA 2Z3YA 3EYIA 5B5EC 5KRTA 5I11A 1RDCA 2CT4A 3F23A 2RHIA 4LC9B 3A0BC 2HEOA 1U6ZA 5CQGA 5K7ZA 5GAMg 3FE1A 3JV3A 3EH2A 4E9HA 4QAGA 4WYBA 4DYRA 1TW3A 5IT9O 2H1LA 4AI5A 5M3FJ 3ZFJA 3CCSA 4YIFA 4CZFA 5H1SQ 1S9HA 3HPHA 3QSUA 3AAPA 3J80O 4II3A 4HPQA 2IS1A 4H0OA 2I2LA 2O0YA 4CGDA 1NK3P 2DOEA 4A2BA 2XHBA 4PKIA 3JSMA 2JA8J 5BR9A 2NRXA 3HRSA 3CCEN 3BPVA 3CMMA 3GFMA 1N75A 1H8AC 2O7OA 5E3LA 4JKFA 2NWMA 1YITT 4JOMA 1ZN2A 3K5NA 2F5EA 3CCQQ 3ZXSA 4KHWA 1FMKA 4X66K 3LDLA 4MQ3A 3H8ZA 4J9GA 1UGQB 1PSFA 4E1MA 3NHGA 2M45A 3SJHA 4DTUA 2LX9A 5BNGA 4B24A 2CH4A 2BE7D 4OMYA 2YHXA 2IVNA 4IWVA 3CCLI 2R5ZA 5ED4A 1Z77A 3DXKA 3VF6A 3DLLA 3V9XA 4LG0B 1JUMA 4NL2A 1YVNA 5JHUA 4FO0A 2YR2A 1R4MB 1H88C 4BC2A 1X9WA 4B8XA 2VT2A 4MIMA 3G6EQ 1MHNA 4NHJA 3C0BA 4CYCB 2XICA 2KQ2A 4OKEA 3K57A 1ETVA 2FU4A 2DO3A 3H9NA 1VQ7Q 3OS0A 3A2KA 3B6CA 3E7LA 5AZIA 1TU0B 4KHYA 4M63C 3R6SA 4XLNF 3C7NB 1AWOA 3KP4A 3S2DJ 3RKXA 1GLFO 4Y33A 1VQ5Q 2F2XA 1YHQT 2DX1A 4PWDA 4M7YA 4O8UA 1GOAA 2FF6A 3VN5A 1WOQA 3KK7A 4A59A 4FM0A 2BYVE 4JLIA 3S3OA 1WNSA 1SKRA 3GOXA 1KSPA 1XX5A 4BS9A 1SC7A 1SF9A 1WN7A 2FPEA 2JPBA 1I6XA 3MZ8A 2P7CB 4B3XA 1PJRA 1QZ5A 1VQPI 2ATCB 5TGTA 4B48A 3RSEA 2OYQA 4M6YA 1RI0A 4O0IA 2KRCA 4PGGA 1YRNB 4JK9A 3EPZA 3KXTA 1LCKA 1YX3A 5KN8A 4EP5A 3WE3A 2UZKA 1EP4A 4R8HA 5J8CA 5CY4A 1BB9A 3M56A 3ZSXA 4N0AA 4H8KA 2AKLA 4FE7A 2Z1HA 2AXLA 4UNFA 3VQ6A 1S1XA 4DR3K 2O8BA 2QGFB 2KZVA 2E5LK 3BCBA 4BRPA 1H89C 2HU9A 2A6EF 4L0ZB 1GLCG 2A0FB 3O08A 3ML6A 1I0CA 1NGHA 4FYYB 5GAN8 4LFUA 4MLEA 1F43A 2A6AA 3OBYA 2LC4A 3ULDA 4IOAF 3HOVJ 1IRFA 2ELJA 2X6OA 3OYHA 1HC8A 4AMCA 1FP2A 1UCRA 5AQIA 3HYIA 2KDSA 1W5SA 3FBIB 2NRHA 2F4IA 4PKHA 1KQ1A 3U21A 5M1OA 5AIQA 2F2EA 2Y4YA 4Y92A 1GLNA 2V75A 2QW9A 3LSKA 4PJLA 4DTMA 2NS8A 2WSCE 2KIUA 2HAXA 1NJZA 2QGUA 5FLXO 5F64A 1IN4A 2KHOA 3L0QA 3SWNA 4LSLA 3EY1A 2EJFA 2GTOA 2E34A 4WK8F 3Q0WA 1MA9B 4Z94A 3VWBA 2OFIA 3KP6A 2HVHA 4B1RA 2JJ9A 5GMKe 1Z91A 2KLOA 3TPQA 3I58A 2WACA 1LEAA 1TQIA 2KZGA 5CYMA 4B3OA 3D7EO 4BYYA 3EQLF 3LDOA 2WONA 2YJEA 5AQYA 1U2VA 5FFZA 4OB0B 1PYVA 4FT4A 3KYCB 2J6KA 1OCOH 4C30A 4M9XA 2QM3A 3JCMQ 1MPGA 4M78C 2D5VA 1ZKGA 3I5UA 2MOXA 3TOAA 5CKFA 2ICWG 3MX5A 1C0MA 5F6FA 2MYSA 2XHKA 3UKRB 3CF5L 3F6OA 1T44A 5A2QZ 3DI6A 2E36A 3VS5A 4DV7K 2K9NA 2A28A 2P9NB 3I55I 2E19A 3DU5A 1QP2A 4KN4X 3C6HA 3PIPA 3DF8A 3RBBB 2RHKA 4C92G 4QT7A 2C06A 1I1SA 3SEQA 5M1QA 4DSLA 2QQBA 1X9JA 4DR5K 3MN6A 2LP5A 1XN7A 5D4RA 2ASOA 2LVMA 1J5EK 1VQLN 1USTA 2ECZA 4XMYA 2K27A 5CR4A 4CJ4A 2OQRA 1EBMA 5DDGA 3KLNA 1HSTA 4O8KA 3F5TA 3S6IA 2OTJA 3HZJA 4LLNA 3KK1A 2R5MA 5AJ3K 4RKUE 1VQPN 3H1CA 3SFIA 2NVQJ 4AHUA 1B9DA 3CCJQ 1UGSB 2X4HA 4WCIA 2Y69H 4FLTA 4OGEA 3AL0C 3ABLH 4DTRA 5DTDA 4CJPA 4CYDA 1Y71A 3VOEA 3AO5A 2QQ8A 2F8TA 1WSGA 4L9JA 4A3FJ 3LX7A 3O6BB 1BW6A 4Z4EA 3AAFA 3QBXA 4S04A 3O4QA 1HU0A 5F0XA 5J2QA 4HUFA 1U8BA 1XGSA 2ATQA 2VKVA 4B3RK 2DY4A 4F3QA 1BCOA 2ECCA 3ZMUA 1KSWA 1W7PB 1FIAA 3ZBDA 2G8VA 3A01B 3LOCA 3CC2I 4G6QA 3G2BA 3HL8A 2P5KA 1D3BB 3ONQA 1ZTRA 3KK3A 3HSFA 4BY7J 1PRLC 2P9LA 2HVIA 3VEWA 4TSXA 5LEKA 5A0GA 3NH1A 3F21A 4ZYDA 1U3EM 4D7NA 2KKZA 1A5WA 3AVCA 2DEUA 2CGJA 2XF5A 2IA1A 5AQSA 2DBKA 3O1WA 2CP3A 4I02A 3I64A 2J06A 3M53A 4EATA 3AVJA 4WFAL 4M4ZA 4GYIA 1GCQA 1VQ8N 1IJJA 2VOOA 4XQFA 4E19A 2OAWA 1VYVA 3M55A 1FNNA 4CHNA 4NDLA 4KHSA 2FEZA 1LNWA 2F5FA 2R58A 2YHTA 5CE3A 1PU7A 2H56A 4H5WA 1JXSA 3FEOA 4QQGA 3HGYA 3OOPA 4XOTA 2JSPA 2OTLI 4AHSA 2GUPA 2O8DA 2J5OA 4CXFA 3WTUC 1IV6A 2CKKA 4A5AA 3ATVA 1YBYA 3GTJJ 2EJ9A 3TMOA 3OYKA 4G1QA 4ZHRA 2QDYB 3G71N 2RPNA 5FW9A 2QA4Q 4DYCA 1SEMA 3ER0A 1Q7YR 3AARA 4AHTA 3JRAA 2L0KA 4JKCA 4CGGA 4OFEA 1QSLA 1V4RA 4IZ9A 1KU2A 4OPHA 2PYJA 2OPQA 5ADXH 4M78F 1TV6A 2HSTA 4DS4A 3S2WA 1BC8C 1KG7A 4OPJA 3V9UA 2ZFUA 1JLEA 1L0OC 3HHGA 1TVRA 1F5TA 1ZSZA 2HL5C 8ATCB 1VQMA 3O8VA 2DM1A 5DM6F 2WV0A 3U3YA 2FNPA 1WSHA 2DF6A 2FBTA 2VWBA 3HL2A 1Y0MA 5KCMA 1CXQA 3HUGB 2R7DA 4FCYA 1UMQA 4IUVA 3COAC 1IV8A 4YIRX 3SB2A 2KNBB 2E5ZA 1JKPC 3S6WA 4E7HA 1J53A 1VQ5T 2WB1A 4CBWA 3REOA 2QAZA 1AWWA 3DTKA 4RTVA 1ZBSA 3TCJA 5IHNA 2VUBA 3U9ZA 2RPIA 3ZMSA 2WSEE 4F3OA 3QP5A 1WYXA 1FKOA 1LEBA 2EYQA 3B8AX 1LFUP 3QYBA 3QZ5B 1FYKA 4CD3A 2MWOA 4C8QG 2DEQA 5KYUA 3LZJA 2M34A 3ECHA 2LP0A 3I56T 3ID6A 2PMHA 3IKVA 4LLLA 1M3AA 2CUDA 2L3SA 2LJ3A 4GGGA 4M78B 3MCAB 1FYNA 4TV7A 2HDCA 4C9YA 1VI0A 1GLEG 2F48A 2JJ7A 3IP4B 1LJOA 4BRDA 3OS5A 3C6AA 4O5BA 3VMFB 5H6QA 3E6CC 1FOKA 1G15A 3UPUA 2GAUA 4F93B 2YHBA 2YUPA 3UNGC 4W5OA 1UB9A 4ZZDA 2JM8A 4ESRA 4BR2A 1GXQA 1VQ4T 4B43A 5A2QK 5BPIA 3ZEUB 4FW2A 4JX6A 4FSVA 2WWYA 2P0KA 3CMAQ 2CV2A 1GDTA 1X4PA 1KG2A 2X6NA 4OPAA 1IN6A 4M75E 5EEGA 3LZIA 4B9VA 3F3XA 1N27A 2DK5A 4FE4A 4A63B 4F2RA 2ZFWA 4ENJA 1R0AA 4WTOB 4DQQA 3S93A 4JKAA 3ITHA 1Z0XA 3KTUA 2NXNB 2FSNA 2LD5A 5AQRA 3L4QA 3HVRA 2G8IA 2F9WA 2F6CA 5IYCJ 2QKKA 2RF2A 5SWMA 3DM2A 1QZYA 4Y1CA 2PZ1A 2Q2EB 4H0VB 2A61A 2FBXA 4BC5A 5HDNA 4YFNF 5GAN4 1W4MA 5DS9A 4M7DD 3EH1A 5AONA 2GWJA 1H92A 4M3FA 3VTIA 3O4NA 1XDUA 4CJ5A 4NQWB 4XRSG 1NGFA 4JZ3A 3JB9J 2A1RA 4AFZC 3MEEA 2UUAK 1MH3A 4C0ZA 3OY9A 1U9NA 1JO8A 2VODA 4E6KG 3VQQA 1RT5A 3U3GA 5AQJA 1QQCA 4QKUA 3AHUA 4EV0A 2L7MP 3M07A 4L5JA 2DFFA 1JUPA 4LDVA 3JAME 2ELKA 4KH1B 1QLYA 3DLEA 4L59A 1M1KO 2A3LA 5GAOr 3PFIA 1Y8QB 2EILH 1K78A 3KP2A 1E0EA 1KK7A 3VEOA 3BR3A 2X1DA 2AP1A 2G8WA 3WG7H 1ZUKA 1W6XA 1WSEA 5FRMA 5D8KB 3M8QA 1T7PA 2JT1A 1IKXA 3JRDA 3KJVA 3BG9A 2I8DA 1J3TA 2Y1IA 1RFQA 3DRSA 4CFDA 1C6VA 4Q47A 5E41A 1HSQA 1ZQ3P 1GHCA 1KGSA 2QWWA 5EEAA 1BWFO 4AFQC 2V1NA 1MBEA 2E6MA 3G10A 4Y3OA 2F1LA 3LFUA 1QVGM 1B72B 4DV2K 4KDPA 2BZTA 1RDAA 3NFAA 5AFUH 4G9YA 2AZSA 4ZGEB 1YAGA 1XMOK 4EZ6A 1RBSA 3CC4T 3TSUA 3OB9A 2XY6A 2D6FA 3CETA 3OR1C 2M8GX 5LY3A 2DYRH 3H5RA 2R5YA 1IHWA 3TAPA 1IF1A 3GPLA 3PIOF 1TUYA 1UA1A 4CEQA 1VIFA 3REBB 2D1VA 3DU6A 2CH6A 4EQQA 2HVRA 2K79A 3FGUA 2GOXB 5LRSA 4W5NA 4CHPA 3OHRA 1QSYA 2IP2A 3CD6A 3O9RA 4CCLA 1WJRA 1B3QA 2KDOA 5IHIA 3JXUA 3ZCMA 2HQ5A 4H0TB 1TKZA 1WB9A 3RKYA 2OX7A 1KU7A 4YOUA 1KHIA 4HSBA 3K9TA 1PUFB 4HSRA 2WA0A 2DMPA 2BZ8A 4JI7K 4AC0A 1Y96A 4JI6K 2V52B 2CRGA 1TWGJ 1DEJA 4JI5K 1W1FA 5GPAA 5BR8K 4BRFA 5B1BH 4KHNA 4CEAA 3OSFA 1V5EA 2MWPA 2BGCA 4AIAA 2IS2A 4LLGF 1OZ3A 1MSFC 5T7BA 1BJAA 3CO7C 3CUQB 1C6VX 1ON1A 4DU3A 4GVEA 1YE9A 2M7AA 3PT9A 2FQ4A 3WTZA 1YN8A 1L5UA 1OQKA 2GCXA 1WH5A 2BDPA 1YI2T 1CSKA 1SL2A 2XPWA 1YIJI 2HSPA 2QA4N 1KAYA 3NEUA 1TH7A 3IS9A 3PO5A 1D0XA 9ATCB 2YUNA 3M8EA 5ILUA 1VQKA 2F9TA 3M5RA 1H641 2NS7A 3IKTA 4ZDLA 2CH0A 1TUGB 2HZYA 2XAJA 4FJHA 5EYRA 3FXOA 4WFNL 2W84A 2HMAA 4DLGA 2VC0A 4CICA 2A1SA 3BF3A 1AD5A 4IEIA 1HNWK 3T1AA 3JW4A 3DKMA 1BR4A 3VRYA 3AVBA 1NJYA 4XN3A 4ZZLA 3EG2A 1Z26A 4DTPA 3TVTA 2XAHA 1K61A 3L3VA 3ERMA 2RK1A 4EHUA 4D5FA 1VRUA 3KKSA 2QZ8A 4KKOA 3SUOA 1HPZA 2DXBA 4H0PA 2LMDA 1G2HA 4Q5VA 3GF2A 2QTXA 3PQJA 2F2WA 3RRGA 1W0HA 1U2WA 1QZ6A 3QP6A 4KISA 3WU2C 4H03B 3HOZJ 3CCLQ 1DTQA 3F9KA 3V42A 1KC8R 3IKMA 3JR9A 1R6RA 1GVDA 2CV1A 2F4OB 3BZ6A 1RRSA 3DLMA 1B34A 5AQPA 2H09A 4FOIA 2GELA 4RB1A 5F2RA 3GL1A 3MN2A 4ZGJB 1FOWA 3CDLA 4PLLA 2EV6A 3VODA 4MZMA 4HLXA 2W04A 2V1UA 4GKKK 3OYBA 1U5SA 2A40A 2QYZA 5C0YA 2E71A 1WRJA 1Y7XA 1YJWI 3QO9A 1R1TA 2LDUA 1VQNI 5HNFA 3IHOA 1J75A 1OH7A 1G2BA 5BQTA 3DAWA 3CMAN 2LREA 2VKDA 1GFCA 2IS6A 2RJEA 1SRLA 4C0FA 3KP3A 1U4BA 3MN7A 3I4PA 5DCMB 3OYCA 3MEWA 2CP7A 1FBSA 3BR5A 1WXTA 2E20A 2LY9A 3W6JB 1K8KA 1NH3A 3GUDA 1UHFA 1JXMA 5IAYA 3J8AA 4RW4A 3ZLJA 2FPFA 3PFSA 2FNAA 2A3SA 1EV7A 5L3BA 3ZT1A 2H3GX 5GAOp 3TARA 2JTMA 4EM1A 3X26B 3K4LA 4M75C 2RNJA 1VAZA 3QODA 1KAXA 2Q31A 1K79A 2K57A 3JRFA 4AT1B 4BWJA 3P9KA 4I0BA 1ZYRF 2KBTA 2STWA 1XQPA 2RK2A 3K7AJ 4O55A 2RM4A 2ZXHA 5HRNA 3U1KA 4YELA 2DT7B 1FZPB 3Q3SA 1YHQA 1Q7YO 1NG2A 2ZGYA 2DYSH 3GNFB 3VYGA 3SHFA 1KQ8A 1LWWA 3URGA 2XSJC 3A8HB 2LFBA 4A0XA 1UG0A 4DEXA 2XAGA 1FTZA 2R5AA 3QIIA 4ELTA 2ESNA 3AA5X 1TG0A 1IKWA 4KFCA 3L42A 3QERA 5CJ9A 4E1JA 4HCBA 4I2OA 3J81E 1K9MR 4C8LA 1DQUA 1KA8A 1VSJA 4FVUA 2LNVA 3RDIA 3WGHA 4E7LA 3BWGA 1HQUA 5F04A 2GEMA 2W85A 3K5LA 4D8KA 2E1NA 2YPRA 4CI0C 4LG0A 3VQEA 4LD9K 2VKEA 5HL7L 5KH6A 2NVTJ 3CCET 3A5MC 3FDYA 2CGPA 1NPRA 2QTVA 2YSRA 4EA4A 1B4AA 2Z1IA 1RRJA 4LE9A 3PGGA 3VSKA 4CYCA 2QENA 3CCRA 2XGCA 4QLCU 2GA2A 3I9QA 3BOQA 4M7XA 2DL7A 5L23A 1RBVA 3F8CA 1V3FA 3H0DA 2NLXA 1VQOI 4B44A 1QHHD 3FMSA 2WOMA 2PZSA 4HT9A 2WAQN 4U88A 4KB1A 2FBHA 3R4KA 3W6VA 5TISC 2M1HA 3C7NA 2OANA 2ZCWA 1Z1DA 3NBPA 5ICEA 1VQ6A 3PJRA 3CJTB 2KISA 1YJWN 2WY8Q 4FX0A 3MEUA 5GAMf 3WTVC 3LGFA 4CJUA 4GMJB 2OFKA 4RW8A 4BGDA 2IVMA 1VQ9N 3WE2A 5A0LA 3I55Q 5LHGA 4UV8A 4N5SA 1D1BA 3G0ZA 3H3UA 2XY8A 5L3DA 1UG1A 5K7FA 3NH0A 1IXRC 1OPLA 4FK4A 4BGAA 1BL3A 2NNNA 3AG4H 1VK0A 4RLQA 3BT9A 2HCKA 1HCRA 3T8RA 2HR3A 3H9JA 1YLFA 5K7HA 3GTLJ 3RQIA 1YCSB 1JUSA 1YRNA 2MBFA 1RLQC 5HDKA 5CKDA 4FU6A 4CERA 3H5NA 3C1DA 4QS9A 3VF2A 2UXNA 2DTHA 4WQ4C 2ZSHB 1UFFA 2LRDA 5LJ5j 1KG3A 2KE9A 4BQQA 2KZMA 5LFAA 4CJQA 3FJ5A 3FKJA 3EZWA 3GLLA 1V1CA 4WXHA 1KQ9A 3CCUI 3KPHA 3QWLA 4PJOE 4BY6C 2FQ3A 1P8ZA 4MZPA 3LH5A 3EHQA 3UWNA 3JB9G 4M3YA 4BR5A 1KVCA 5GAN6 1Q7YC 3QO3A 3L2VA 3JTGA 1L3VA 4V2GA 4ZH4F 2CS3A 5ECAA 1X3UA 3CPWP 4M75F 1NLOC 5IH2A 4BR0A 4A6DA 3NRVA 2W57A 4XM3A 2GQIA 5KI6A 4M3TA 2F8SA 2XROA 1Z3YA 1KZHA 4QTRA 2HQHA 1NGCA 3GFJA 4M71A 4ILHA 2AT1B 4Y28E 3CC2Q 2KFNA 2HPIA 1HQEA 2ZCFB 3FF5A 1HR0K 1R7JA 1USSA 1BA1A 3AVHA 2PBIA 4M7AD 4B6MA 3QKJA 2VG5A 2CDTA 2JNGA 4OINF 2O9LA 2NOBA 2VXEA 4C5GA 2RKIA 4WCEL 4QS7A 1ZXOA 5FU7C 1OOTA 2EFQA 3OMYA 1X1BA 1YNZA 3I0RA 4GCVA 2KTQA 3H0HA 1A5XA 1X2NA 3M1FA 3LAJA 3O2PE 3P8DA 2BY3A 1ETKA 5JVTA 3CCMA 4W5RA 1MZBA 5KQ8A 2M0MA 3LPUA 1NE8A 4RG8A 3LAKA 1VQLA 4M75B 1BBZA 3ZT2A 3KD1E 5CLSA 3GMEA 4WE1A 4J2DA 4C8OA 3UKGA 1FPQA 3F6VA 2QM1A 2B8AA 3CG7A 5LJ5h 3AVKA 2K3FA 3BUZB 2JA2A 4ZN1A 4FJGA 3ZEHA 1LWCA 4BG9A 4HX8A 2X51A 2OTLQ 1K0XA 3PE0A 1M30A 3LM9A 3EGUA 3LDSA 2NOJB 3J7ZI 3V8KA 3L2WA 4JK8A 2FF3B 2QEXN 3UKRA 5HRSA 5D6WA 2Y0SN 3SZ2A 3CJ9A 1XUPO 2P9NA 2Y2ZA 4F14A 1DPRA 5D8LB 4KUDK 1XD7A 2IW5A 4XL9A 3HM5A 4JX4A 3TP3A 1KFZA 2HD0A 4EM0B 4P1WA 4ZDOA 1S7OA 3I59B 4L9TA 3RWUA 2O8EB 1D8YA 1SSFA 3DEUA 3QYEA 1YJNN 4DTXA 5AQVA 1LVKA 4M42A 4X1VA 3A98A 5IP6A 3DXMB 3F22A 3CC7N 3K69A 4CESA 1PKSA 1VSMA 5GP9A 1X01A 3K2PA 5AQXA 3VA0A 3CMEI 3M9AA 4FWLA 2X9DA 2DA3A 2PI0A 2E2OA 2ZJPL 4H0YB 1FMWA 2GM4A 5D5UB 2ZD1A 2DXUA 1V4TA 2NLUA 2YX7A 3GTKJ 4C3HJ 2IBDA 2EIKH 3OV8A 4LFCK 2MAMA 4JYAK 1FSHA 3CCQA 4DNCA 5C12A 1KRPA 2EQKA 2K3PA 4KT0E 2EPDA 2BBYA 5JMVA 1SSHA 1Q81U 1XI1A 4A3DJ 1LOTB 4AD9A 1QQOA 1N34K 2HOEA 3K4BA 4FXDA 2VC8A 1YITI 3AVIA 3LSRA 1O3QA 1OU9A 2TCTA 5J2MA 3VDXA 3META 2H6BA 1VQPT 2BE5F 3MEDA 5H6RA 2O4IA 1W7PA 5FB2A 1P9QC 3EGXB 1WZOA 3A01A 4CJ3A 3MKWB 2HHVA 2OD5A 4D6WA 2DRMA 1ITGA 4B9QA 1IXSB 2E6LA 4B21A 2Q36A 4F92B 2GWKA 2L5QA 1D3BA 1T0FA 2JN0A 4Z4FA 2BGGA 1YW8A 3ATUA 2NAZA 3ZX3A 4DV4K 4RTUA 3G6EA 3HYFA 4YY3K 2ETHA 4CDGA 1NJWA 2K3BA 3TU4K 1VQ7A 3FFIA 3WTWC 3WXJA 4JRPA 1W0UA 1KQSS 2XGXA 2ESHA 2KT8A 4WXDA 2DK3A 5E1ZB 1VQ5A 3M0UA 3VS7A 2EA2A 2DTZA 5KHDA 3ID8A 4A4FA 5KYYB 5K5QA 2QQ9A 1TOVA 1G3YA 2YG8A 3L7WA 4Z4IA 2ENMA 1NWKA 1WJFA 1FOXA 3I8BA 3H1QA 3HKZA 4JKEA 4RAZA 4OOIA 3QAHA 2MFZA 2QWPA 1KC8O 4AYBA 5IOYA 1VYTA 4ZTJA 2IJLA 4F52A 2FMYA 1SG5A 4C92E 4EJWA 4K41A 1FJGK 3OYEA 2Z9OA 2X6YA 1Q81R 1J0RA 1LDDA 1W2BP 3HP9A 2GA1A 1UTIA 1OV3A 1QRYA 5GANj 4DTNA 4KHPK 1VQ8T 4BEHB 2CP6A 3V6DA 4DWIA 3I8DA 5EJCA 1VQ4A 2L4MA 4XONA 3L1PA 5JLHA 3BC8A 3OTOK 4K8XA 4RA2A 2DQLA 2UWMA 1VNDA 3ZPLA 2LCCA 1GV2A 4ENKA 1R71A 2HKXA 3VSLA 3KFWX 5LJ3j 3HK2A 1AVZC 4X1EA 4XBFA 4PFPA 5J1UA 1T3VA 2YRDA 3HUGA 1Q1HA 4HA8A 2P8TA 2HFHA 1EWRA 4FHTA 5K14A 2IAJA 1U6GA 2DBMA 1SV5A 3ZSZA 4RWTA 5FU6B 2A41A 4XOPA 1SVLA 4FYVB 1QVFS 4B4CA 3G7ZA 3ASNH 1DPUA 1D3YA 1SAZA 4M9SA 2ZXIA 3QXEB 2E1HA 3LSIA 1BR1A 2VYPA 1GT0C 2JWTA 3SZGA 3GLXA 2ZO4A 3I55T 1C0GA 4R0KA 2LLKA 1VA7A 4LXCA 2DQRA 1EKEA 4J2EA 3UE5A 3I4NJ 3SV4A 1JT6A 4BRAA 2ZE2A 4M78A 3O9QA 5CVVA 4PSXA 2D0OA 2A6TA 2ZB9A 5GAMj 1S72N 2KZZA 1NU0A 3THXB 4NOYA 5BN9A 1OKJA 3QNNA 2DMNA 3LP2A 4F55A 2HBLA 1WPYA 4JDSA 1NYGA 3EHRA 4KFBA 4I98B 2VBXA 1KD1U 1U06A 1Y1WJ 3ZEUA 1IG8A 5GANh 3M5AA 3P4IA 2VKHA 1UHWA 1YW7A 1UUEA 1JCFA 2AA4A 1MJBA 2QWQA 3TR8A 1ZBFA 2M7BA 5ADXA 2R7RA 2OTJQ 4CJEA 3ZCOA 4OU0A 1AHDP 3VRZA 1ASUA 4CFBA 4PJOC 1R36A 3WTSC 2GBYA 4IIOA 3Q1JA 3GBQA 4NB5A 5LJ3h 3AGKA 5FKOA 3RMDA 2O8FB 1K9MO 2GIZA 4CJWA 4UVAA 2XY7A 4DSEA 1TAUA 3TSPA 3RESA 2LRQA 2EA4A 4YIIA 4MDBA 2XAFA 3TTFA 2Q2EA 2X4XA 3OYAA 4B9SA 4Z02A 1K0SA 3ZQ7A 3CCSN 4FJKA 1T05A 2MD5A 4FJMA 1XQOA 4X6AJ 3VB2A 3C7JA 3OW2P 3OYFA 5DEQA 4B9NA 3F73A 5D6YA 2EWNA 5GADP 2LX7A 4NQWA 2EPFA 4JRKA 5CCAA 2RGVA 5D4SA 4YOWA 3NWSA 4IPAA 1XB4A 3CCJA 5J2PA 2FRHA 2EWSA 2YHYA 2UXBK 4E7KA 5GAMh 4Y0WA 2ZNYA 2O8KA 4CEZA 1K83J 1KU9A 4EMHA 1N77A 3X20B 2KKOA 1QSSA 2SRCA 2KL4A 3RIRA 5HODA 2H27A 4BJTA 2VKNA 2GNCA 3LFKA 3OGDA 2QSFX 4J9DA 1YIJQ 1HJRA 3GTGJ 2X4YA 1EZZB 2VXZA 3EDPA 3KZIC 5GAOm 3BLYA 3CCVI 3MMYB 4C8QE 4PSWA 3CFOA 1XSXA 3UDCA 1RTJA 3LLRA 4HEA2 3CEYA 2MG4A 2F4VK 2PQ8A 3MN5A 3D1NI 2ECBA 3JCMX 4OAZA 1XC3A 3QYFA 2F5DA 2NRTA 3GDQA 2G6FX 2WADA 2ZJPF 1HNZK 2WAEA 4FJJA 4KMUX 2EFIA 3PNYA 1V76A 3MKYB 4AQYK 3P9CA 1QU3A 3DOLA 4CEDA 1TL3A 1O3SA 2G8KA 5GAOl 4GRIA 3ULEB 3J7AO 2HOAA 3VUZA 1B72A 3ESWB 1Y07A 5TKWA 4DV1K 2JM9A 4AM7A 5HLIA 2OPSA 2GGRA 5B66C 4E4HA 1PCXA 4HKEA 3VQDA 4PFOA 2LY2A 4L5GA 1BBYA 2X0LA 2RV8A 2ZMEC 3M0RA 3VS3A 3BPXA 2R57A 1ZH5A 1OR7C 3GG4A 1N8RO 1M5Q1 5AQQA 1F21A 3LP3A 3KTQA 1VSFA 1GLJO 5CQYA 1U9OA 3WU0A 4MEYF 4X65K 4BB7A 1OH5A 1IXCA 5GTIC 4RGSA 4BI3A 1VQNQ 2K5IA 2JUGA 3GZ6A 2LBFB 1RADB 3VESA 4HBLA 3E5UA 3S3MA 5GAN7 1K9MC 1X6GA 3BTIA 5KGWA 4DUYK 3C2GA 2NOHA 3MEVA 2FD5A 1SKWA 2CFOA 1UECA 3M54A 1TL1A 2VC1A 1R00A 3TI0A 4Z0UA 4FISA 4L3QA 4XTYA 3JCMJ 1HYVA 1PUFA 4MDXA 1O1WA 1PHTA 2EQMA 3QQAA 4PJOF 2QCOA 2LQ8A 3JAMZ 3SK3A 4AU7A 3OS2A 1T8IA 3O9TA 2DD5A 2EKHA 3QU6A 1WXBA 2DYBA 1IGNA 2VWKA 3PIOA 4AH9A 4IVNA 5CKHA 1B9NA 3OYNA 3CUQA 4Y13A 5GMKi 4FT2A 1FJLA 3GTPJ 3BJ6A 1VSHA 2QXLA 4A3CJ 3FB9A 3SFMA 2E5QA 4HYEA 3F8FA 4G6TB 2PUOB 3VEVA 3A8OB 3ZETB 2V7ZA 1EH6A 2JHNA 3Q9VA 3DLBA 1OJLA 1Z6RA 1JJ6C 1TK8A 2ME6A 4B9LA 2OI3A 1N9RA 4XLFA 1NGDA 3GIBA 1JLQA 3CQ8A 4P5OA 3IAM2 4P9UA 3M7GA 1Z05A 2QG9B 2HYGD 2EZLA 1FXXA 4PJOB 3MO8A 2IGOA 3TO9A 1W36C 3HRGA 5JICA 4CBXA 3G1LA 3GZNB 3O5BA 4EW4A 4A5MA 4C92C 2ESWA 1KG4A 3I56I 1RAHB 2W10A 2E2HJ 1ZBUA 2EINH 4FJLA 1HLUA 4UUSB 1ORKA 2IGIA 2LG4A 3VQ9A 2E2JJ 4BG8A 3CMAA 3SUNA 4BRKA 2X78A 3DKYA 2GFUA 1Z9CA 4YFUA 2XD0A 2EIMH 4M74A 2DL5A 3AG1H 5DM7R 3HSTB 1YS6A 4BQOA 1IKVA 1SAXA 2R7SA 1JLAA 2W48A 1DP3A 2ROTA 5D3GA 5HY6A 4M3GA 2YXYA 3J80Z 3T5XA 1GV5A 1SVMA 4JS4A 4HX4A 3WXIA 4ANJA 4H0EA 2ZPBB 3R6NA 1VQOQ 3T1BA 2ZF5O 1UOCA 5HK0A 5FLMJ 1NZ9A 2KMUA 1XSVA 4Z6YA 4RAYA 5DUIA 4BREA 3G1MA 5AQTA 4PNOA 5GAHJ 3RUXA 5CZ2A 2KRHA 1P6RA 2DL3A 1EH7A 3G4SI 5DCMA 2OTJN 4C8KA 4FLZA 4J6XA 3DFGA 3QEIA 3P83D 1RUOA 3D2EB 3LDPA 5AN4A 5A2QO 3EZ5A 1UGPB 3VFZA 4DFPA 1E3MA 3CJCA 5A0DA 2CGHA 3MFKA 2AJQA 1QGPA 1YJ9I 4QQ6A 1MNMC 1BR2A 1HNIA 2JUFA 4KJZA 3L2RA 3S1QJ 2GXAA 1JT0A 1RABB 2VONA 3KFVA 1F9NA 2E7XA 3NMZC 1L3UA 3J7ZO 3W6KB 1FK9A 3VYHB 2RJFA 4J7FA 3D45A 2F4MB 5FD6A 2EVRA 4FJNA 1NKBA 1NKUA 1Q95G 1MMGA 1T38A 4IJAA 2L9RA 3BP8A 3SEMA 1QVGP 3CXCS 4I01A 4BL0B 4CK1A 2HQNA 1QCNA 2ZMEB 3QOEA 1GOCA 3L00A 1FMVA 3KYDB 1H9GA 3R0AA 1UHMA 4A3JJ 4L5IA 2NOLA 4UVCA 4KIFA 1DT9A 3P8BB 2ZJ2A 4YTLA 1LOJA 2D45A 3CD6Q 4N4HA 5HROA 1J7KA 2MPXC 4DU1A 3PO2J 4LUDA 2NNWA 4NS5A 3X25B 4IO9F 1L3SA 5FROA 2IG0A 3H3ZA 2E65A 4G7OF 3K58A 1DKGD 2Y30A 2CG4A 4FL6A 3M0TA 1IRGA 1QWFA 4JPBW 3VGLA 4UV9A 2LT1A 3CC4I 1FLIA 2P4WA 3M8PA 4C92F 1LB2A 1ZYQA 3MEAA 5EXWA 4NL3A 3WNEA 5KYNA 1SUQA 3JAMK 3I0TA 5CR2A 3EFSA 3NWTA 4A4GA 3JCUC 3TSWA 2EGCA 2X6WA 4C8QC 2QWOA 5GIPA 1GL5A 1Q82O 2ZM6K 3QEVA 2JK3A 4XU0A 5GMKj 1OI1A 4NBQA 1IRZA 4YOVA 1O57A 2KGTA 2DODA 3NF8A 3WGIA 2VXFA 2HSEB 1VQMN 3RNJA 1R5HA 3U6FA 1X2QA 4CEEA 3JREA 1NK2P 1KQJA 2VL8A 1KJWA 1X43A 4BROA 2EQJA 5AYFA 2GV9A 1JXOA 4AFSC 4EPCA 2X48A 1W5CC 2V8KA 2FA5A 2GQVA 1S3JA 4BRNA 2WB1N 1RAGB 2ID3A 3DMJA 4CJRA 3Q0VA 4KUIA 1YYVA 3CQTA 3MKZA 4JBAA 2A05A 1U78A 3CYMA 3HOTA 1QQMA 3L2QA 3RJPA 4WWCA 2BHZA 1V54H 2COWA 5GINA 4JI0K 1WH7A 1KHCA 1YJWT 1TWHJ 3CMEQ 2XRLA 5GPCA 4YOQA 1N5ZA 1JL1A 2G9WA 3BTCA 4BHCA 1O13A 5FLVA 1Q81C 4Q48A 3KNTA 1UJ8A 4HVVA 2P81A 4J9FA 4TVRA 3RMSA 1R1UA 4D9JA 1U04A 4S0HB 2XI9A 3S1RJ 3MDQA 4LY7A 3OMCA 4HTLA 3J81Z 1OYWA 4B23A 3QG1A 1YITQ 4F16A 1NJIO 1IN5A 2F5TX 1MWMA 5GMKh 3JB9D 1A04A 1PU6A 3CCLA 4GV6A 1XMKA 1BISA 2W42A 4WX9A 1E2XA 3LWLA 3NVKA 1X3ZB 3DLLL 1HK9A 2F5VA 3EE8A 2XKOC 1V5GA 2NVUB 3CWSA 3T8TA 4II1A 3AV9A 1R0BG 1K8AU 2V4JC 1D4XA 4DTOA 4U7BA 2PJPA 4B47A 3QHSA 2R3SA 3CXCM 4DBHA 2BXZA 1BGXT 1NG9A 3NE6A 1OZ2A 2LCLA 1JB0E 4U87A 3GWZA 4R5PA 3DXJF 2Y75A 3GP8A 4JRIA 3A8GB 2PQWA 3S41A 1OCRH 4M75A 3O9SA 1J2XA 3EG0A 3N4PA 3ZSRA 2R7ZJ 3DRRA 3HSBA 3R9PA 3OH6A 1KQSA 1ULYA 2CSQA 4K42A 5DLOA 4MDAA 4YOTA 4CK2A 3SQ4A 5D5VB 2W24A 4ID5A 1QS4A 3FKIJ 2XK0A 4PKGA 2EZHA 3DTEA 4EIAA 2DIQA 2YJFA 1EETA 3TABA 1WSJA 1WQ7A 4IFEA 2YS9A 2P6TA 1SD4A 4KBMB 4H5VA 1E4GT 1MUZA 2RO0A 4PA1A 4H4KC 4NLBA 4C8QF 1ABOA 4UY8I 1G6NA 3MMVA 4PJMA 1RI9A 2P9PB 2V7FA 2O8EA 5LHIA 1IDZA 4M77E 3FSPA 5M5YJ 1ATSA 4OP0A 2D0PA 4DR6K 2E6NA