3OT9A

Phosphopentomutase from bacillus cereus bound to glucose-1,6-bisphosphate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
Knots found
sequence length
391
structure length
390
Chain Sequence
b'NKYKRIFLVVMDSVGIGEAPDAEQFGDLGSDTIGHIAEHMNGLQMPNMVKLGLGNIREMKGISKVEKPLGYYTKMQEKSTGKDMTGHWEIMGLYIDTPFQVFPEGFPKELLDELEEKTGRKIIGNKPASGTEILDELGQEQMETGSLIVYTSADSVLQIAAHEEVVPLDELYKICKIARELTLDEKYMVGRVIARPFVGEPGNFTRTPNRHDYALKPFGRTVMNELKDSDYDVIAIGKISDIYDGEGVTESLRTKSNMDGMDKLVDTLNMDFTGLSFLNLVDFDALFGHRRDPQGYGEALQEYDARLPEVFAKLKEDDLLLITADHGNDPIHPGTDHTREYVPLLAYSPSMKEGGQELPLRQTFADIGATVAENFGVKMPEYGTSFLNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopentomutase
publication title Bacillus cereus Phosphopentomutase Is an Alkaline Phosphatase Family Member That Exhibits an Altered Entry Point into the Catalytic Cycle.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 141
structure length 390
sequence length 391
chains with identical sequence B, C
other databases KnotProt 2.0: S +31
ec nomenclature ec 5.4.2.7: Phosphopentomutase.
pdb deposition date 2010-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01676 Metalloenzyme Metalloenzyme superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Phosphopentomutase 3ot9A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 3ot9A01
1FSUA 4GTYA 2VQRA 4LR2A 3A52A 2ANHA 3IDDA 2GLQA 3BDFA 1KHLA 3T00A 4QAXA 4LR9A 3UNYA 1KH4A 2XR9A 4TN0A 3WAXA 4ZG7A 1ALIA 1EW2A 4UPIA 1O98A 1SHNA 3NKOA 5IJQA 4LQYA 3IGYB 1AJAA 3B5QA 4LRAA 3UN2A 3M8YA 4UPHA 3WBHA 3TG0A 4ZG6A 5HRTA 5L0BA 1ANJA 1N2KA 5KXAA 4UPLA 2W5VA 1E3CP 5LRNA 1EJJA 3WAWA 4N7TA 4GTXA 1E2SP 3NKNA 2X98A 4NWXA 1AJBA 1KH7A 1AJDA 2D1GA 3DPCA 3BDHA 4LRFA 3M7VA 2W5XA 4KJGA 4ZGAA 1AJCA 2W8SA 1EW9A 1KHJA 3IGZB 4FDJA 5L0KA 4UPKA 1ELYA 2QZUA 5LRMA 4MIVA 1ALJA 1E1ZP 1EI6A 3NKRA 4LR7A 3SZYA 1URBA 3MK0A 4UOPA 4LRCA 5DLTA 4KAVA 2GSUA 2RH6A 3BDGB 4LRDA 2IUCA 2XRGA 4CYRA 1ED8A 4UOOA 2GSOA 1EQJA 4CXUA 3WAYA 2GSNA 2W5QA 2ZKTA 3NVLA 1ANIA 3TWZA 1ALHA 3M8WA 1KH5A 2W5RA 1E33P 1O99A 2W5TA 3NKPA 1HDHA 5LIAA 5INHA 1AUKA 3LXQA 3CMRA 1ELXA 2W5SA 3MK2A 1SHQA 1ALKA 3MK1A 4B56A 1ED9A 4ZG9A 3UN5A 5IJSA 4KM4A 3OT9A 4UORA 3DYCA 2G9YA 4YR1A 1URAA 3E2DA 1ZEDA 5TJ3A 1HJKA 3NKMA 1HQAA 3UO0A 3KD8A 4NWJA 5GOVA 3WAVA 4CYSA 1EW8A 3ED4A 5DLWA 1KHKA 1KH9A 4LRBA 4GTWA 5C66A 3T02A 4KAYA 5L0EA 2W8DA 5DLVA 5EGEA 1Y6VA 1KHNA 2IUCB 3SZZA 3NKQA 4KJDA 4MHXA 1B8JA 4FDIA 4CXSA 1ELZA 4LR8A 3UN3A 1K7HA 2W5WA 4CXKA 2GA3A 4LREA 1P49A 3TX0A 5LQQA 5GRRA 3T01A 2IFYA 3Q3QA 5EGHA 5K4PA 1Y7AA 3M8ZA 3BDGA 1N2LA 4GTZA 1ZEBA 4MY4A 5AJ9A 1ZEFA
chains in the Genus database with same CATH superfamily
2MZJA 4F0HA 4V1Ak 1FJGF 5IJQA 2DIVA 1X31C 3DDNA 3IFEA 5HL7Q 4B3OB 3R3TA 4K8RA 4DUYF 3T5LA 4UPKA 3DLEA 1HR0F 4C98A 2K06A 3BGRB 1PC5A 3S6EA 3CJ2A 4YMEA 2V69A 4PWUA 1WF1A 1SVDA 5DZ7A 2MDAA 2OPQA 2YX7A 4FYYB 4O3SA 2GQCA 4XK8C 4ZCMA 3NBPB 1FEHA 4ATNA 2W5RA 2MQMA 5IOLA 2HYIB 4KSEB 4YR2A 3IRWP 2X3DA 2R2SA 1SHQA 4CRJA 3CSKA 1F5AA 2MGZA 3PW5A 3W66A 1KVKA 2H4WB 1RHJB 4GRSA 4FBTA 1VQOS 3ZZUA 3OQ2A 4DR3J 1WD6A 3D2WA 4M1KA 4MT1A 1KKHA 1VBYA 4C8LA 3BGFA 4I2QB 2R42A 4QJVA 2FZCB 4IRKA 2YKPA 3IR7B 3K17A 2MKKA 1JLEB 2BANB 3DLKB 2JHEA 2UXCF 3TO8A 1SKWA 3V5RA 2CJYB 3T1AA 1H0HB 2XNQA 3MMAA 1U0HB 4V19J 4ETXA 1GXUA 1FRMA 2W1BA 4WFAQ 5L0KA 2C2RA 2DNMA 1C1CA 1U6ZA 2Z58B 3BDGB 1O51A 2XSFA 2HBRB 3V4IB 4ZVSB 1PYTA 4ECUA 1QTNB 2DHXA 1FRJA 3OV7A 4JI2J 3L9ZA 3PJXA 1M5SA 3IG1B 3M32B 2I1RA 3VZIA 2ZH4A 3VAKA 1ACMB 3WBZA 3AJ1A 4K4SA 4W90B 1YHQS 4F50A 4IRCA 2ZBIA 2FY8A 1YVFA 3MFIA 1DHMA 1RT2A 3KLFB 3H0PA 1IBLJ 2YNHA 3EZUA 1S9EA 1WC6A 4USJC 1NBEB 1RT3A 3PX0A 2C22A 3CIMA 2ZZNA 3BEGB 4KKOB 3OHBA 4O3PA 1HQ2A 1PG5B 2ADCA 1RTHA 1YI2S 2N4CA 5K4PA 4DG1A 1T9VA 4ILRA 1L3SA 5A76A 1LWEB 4M5KA 2B9WA 1APSA 3OL9A 3TR5A 4AT1B 2LVWA 3GIRA 2LCWA 2E5JA 5G0RA 4DMZA 2FUG9 4ZPBA 3I4PA 3TQEA 2DD8S 2XZDB 2WCXA 2F1FA 2JX2A 1FRKA 3PG9A 1PSDA 1QJHA 2E5GA 4YHHJ 2AGOA 2JFKA 1TV6A 1UMJA 4KGZB 4P7TA 2EWHA 4DQQA 2D41A 2DIUA 4W92B 4MKBA 3UCGA 1PJ7A 4F0KA 2XCAA 4ED5A 3HD2A 3NP5A 3GFHA 4CP5A 1JLQB 2J6UA 1PIEA 3QO9B 4ID5A 4EI2A 1T03A 2WRMA 3CD7A 7AT1B 1SPBP 3KLIA 3RRGA 1S49A 4USUA 2RE1A 1MWZA 1RXOB 1YK9A 1NJYA 4RZRA 1K1QA 1IBMJ 2DNHA 4UZBA 1IR0A 3N5FA 3T3FA 2G2OA 4NMXA 4DPUA 2VFVA 2DY1A 4Q5VA 2K8GA 3ZNJ1 2HEKA 1RACB 1UA1A 3IWNC 1OPZA 2J7KA 2MLZA 2HFUA 3A12A 2N82B 2NS1B 4ZPAA 1ZEFA 1FSUA 3MMCB 2DNPA 3AQOA 3D6MB 2PD1A 1HBOA 4K5SA 4DV4F 2FVRA 4F67A 5CXTA 3MPUB 1WEZA 5MAOA 2BOAA 4F2SA 4TQRA 3POTA 2XQCA 1QE1A 3QSIA 4C0OC 2POKA 3VF0B 3THTA 5F8MA 3PZPA 1OYDA 3DI6B 2F63A 4LRDA 3IR5B 5EWGA 1IXKA 2KM8B 3PIPQ 3TX8A 3KUHA 4MMOA 2EFPA 2OTLS 3QRRA 2KDOA 4NI2B 3F0NA 1SXLA 2XY6A 1BQNB 1HHTP 5GOVA 1S9GA 1PJ5A 1I94F 2DNGA 5KT4A 4YR0A 3EUNA 2WHOA 4TVAB 1BE4A 3NOGA 4I56A 2DNKA 1VOMA 1JLAB 5E7OB 3CUNA 1BWVA 2HFSA 1HLWA 1QSYA 3C3LA 1G7CB 1JWWA 1NSAA 1EAYC 2CQBA 1R0AB 2DR9A 2PFFB 2CPDA 3OTCA 4YR3A 4OFZA 4C0BA 4NLDA 3M6WA 4U9RA 4PWWA 4F8RA 1IKWB 3AA9A 3QGGA 3PFOA 4FDJA 1F1BB 4BLGA 4Q44A 4LFCJ 3GYXB 1MMLA 3Q8PB 2ZBQA 4O3OA 1WOSA 4Y28C 4MFBB 3BQ2A 5FLXY 1UCNA 1ZBTA 2FJXA 1WC4A 2RSQA 2MTLA 4K4XA 1R6VA 2UXDJ 3OHAA 2ZUAA 2BJ1A 5ETLA 4QW8A 3ZFVA 5A8RB 1JIHA 1SJ4P 1L3KA 2UUBF 1FT8A 1NJIT 3T41A 3TA2A 2H48B 3HSGA 3VAGA 5KT6A 2DXFA 2VF3A 2R8KA 4J9SA 4R8UA 1NHKL 2XLIA 5KT7A 2HQDA 3OR2B 4URSA 1BGXT 2XHCA 4HEA9 2QFIA 2NXEA 3DRPB 3B82A 1O5JA 3TVZA 4F2RA 4ZVEA 1ZAVA 4FXVA 1M0SA 3DU6A 3HF5A 4RWXA 4J9PA 5DQIA 2JDJA 1VRQC 3DOLB 3OSNA 1RAGB 1Y3JA 3ZZZA 2XRGA 1S48A 3G96A 2DNRA 3DRYA 2HZAA 2BRKA 2VBWA 2QSFA 3OR1B 3IAM9 2EW9A 2F4FA 4Y2IA 1BWEA 4M8LA 2Y0SD 2RH3A 2JWNA 1RAHB 3E51A 5BYQA 1KLMB 3MECA 1FHTA 3H2VE 1CJVB 4K2JA 1S6PB 4EBCA 1J5EJ 1BLUA 3MPVA 1YBTA 1B8JA 1TL3B 2FLOA 3GYGA 3GCXP 1RTDB 3ET6B 3LP1A 3D0GE 2PEBA 3CO0P 3T9NA 2KTQA 3ZNUA 1X5SA 4UQTA 4LR2A 6AT1B 2PMWA 3SFUA 1JLBB 3AHPA 2V2QA 3JB9k 1NK8A 2PA3A 2ATLA 4I0WA 2IYIA 4OYAA 1V5VA 2YQ1A 2ZH3A 2V8DA 3CCSS 5HRTA 1U1KA 1IBKF 5KXAA 2EFNA 3HK2A 3NKNA 1O0PA 2QYGA 1KLNA 3UW1A 1KHJA 5KOWA 1C1BB 3G9CA 5E5NA 2DHSA 2UUCF 5D15A 4YUDA 2V0NA 5F9NA 2OPSA 4AXJA 3GJSB 1FKOA 1RJJA 3MM8B 4GKJJ 2CPHA 4LIWA 1CJKA 2O66A 2PGCA 2KG0A 1CC8A 4JI3J 1UP1A 4KAIA 3BN4A 1U8SA 4NLXA 3HXMA 5B0CA 1N0UA 2QL9B 2WK4A 3P3DA 2YNIA 2ZVIA 3NBPA 4HDGA 4F4YA 1CULA 3BSAA 4DN0A 4M95A 2F4VF 4QIVA 4DV1J 2M5YA 4JB8B 1WC3A 3DM2A 2GVZB 4N41A 1PAEX 1RAJA 5CZXA 4R0JA 2JNJA 2FZKB 5CD4A 2ZHAA 3TA0A 2CPXA 2Y0BB 2EK6A 1FXDA 2MY7A 3OL8A 2XHWA 1YDLA 2IHR1 3K89A 3V2UC 4JV5J 5M2PA 1NJXA 3FCVA 1S97A 1UEKA 4KAVA 3QWPA 1L3TA 5KFQA 1CQMA 2B5JA 3ILIA 1N5VA 2ASLA 2ILZA 3OVAA 2EPIA 3NKPA 3A8EA 3GG0A 2F8EX 5G4DA 4GMKA 5LMUJ 3HJVA 2RS8A 1XMQF 2ZBPA 3H25A 3RR8A 3ZTOA 1YJTA 1YRUA 2HNYA 3OTBA 4ZA1A 3HMJG 2V8PA 3C6TB 3ZZRA 3I0SB 3VALA 2HVEA 1RP5A 1FX2A 3M32A 2R7SA 4DV0J 4W4MA 3A8KA 4BWJA 2ZDOA 2QC3A 4J9MA 3FBFA 2RDDA 3D0HE 3KLFA 1JNRB 3HHLA 5ADZA 3TZZA 3WAXA 4RNMA 1VBKA 3WX8A 1WNEA 2ZE2B 1NH8A 1VQ8S 3BYPA 2HHVA 4RW8B 1N54B 1TMMA 2IMOA 1QVGR 3CCWA 4CLTA 2VJUA 3OJUA 1HFEL 4RU2A 1Q79A 4HHJA 4ZITA 1WJ9A 5HATA 1H2TZ 4ZLPA 4K59A 2QT7A 2G9OA 3EGVA 1MSWD 5J2NA 2W2MP 4U8YA 2GCFA 3BGOP 1WKKA 1HDHA 5KFUA 1LEOA 1Q82T 2DT9A 4WFNQ 4RR5A 2XULA 2DVIA 3E3XA 4DU7A 3NMRA 4A8MP 3CW2C 3MM6A 5DM6Q 3KNAA 3OTDA 5K8PA 2HMIB 2L48A 4PWDB 4OYIA 4NXMJ 1KHNA 3JAMU 2O01C 1JJ4A 2QRRA 1XR6A 4E0DA 1TVRB 5H9EJ 2GHWA 3G87A 3FMWA 3W8PA 3DCAA 2NXCA 2YNFA 1X9WA 4KHPJ 3ZZPA 1MN7A 1S57A 4X4NA 3BPDA 2BJEA 1FTRA 3ZC4A 3NGSA 1D9AA 3NEKA 1AW0A 1JLGB 1YQHA 3QYYA 1MU2B 2QA1A 3CD6S 3MMCA 3NCPA 1RUSA 2DO4A 2RRNA 2CQ2A 1F5CA 4WFYA 4W98A 5DDQC 1D9FA 3M2UB 4OHYA 2KYZA 2ZOGA 4FPRA 2MQLA 1FWKA 4KC5A 2OFHX 2HSEB 4HHUA 3HO1A 3N6LA 1S77D 3HFVA 4B3MJ 4YB6A 3VWSA 1DBDA 2A2DA 2MKSA 2Z57B 1Z2LA 3OFGA 2YQ0A 4KAYA 4X4SA 4K7QA 3T5JA 4ZVUB 1H73A 4MIWA 1VQLS 2OELA 3MD1A 1BQNA 1B0PA 3T00A 1DJ0A 2FQQB 2ZH6A 2NR0A 4U96A 2UUAF 3SXLA 3KHGA 2BQ3A 1SQGA 4P52A 4B9UA 4DV3J 1Y10A 3BZQA 3VGSA 1KN6A 5F0WA 3GB0A 1VS3A 1R8HA 3WIUA 1JLAA 1FCAA 3EJMA 3D9BA 4I69A 3ENQA 4J7CA 2BACA 5HMYA 1R0AA 4B9TA 4CTAA 4DS4A 5KFJA 3ZTQA 1PO6A 3S8SA 3M9MB 2X51A 3HD1A 2CNOB 1ZM4A 4B56A 1OY6A 2GQ2A 2D9OA 4YR1A 4PQAA 3W2VB 3G86A 4LF9F 5F8NA 2YNGB 3I0RA 4KYZA 3KLGA 3T02A 1F3FA 2B9EA 1NB7A 1U1PA 4B3RJ 5L8RC 2L9WA 2MMYA 4OI6A 1RSCA 4NASA 1WOOA 5ETPA 3T6BA 2Q6BA 3BBCA 3V6DA 3MDFA 2GJ2A 3A4TA 3EGWB 1SL0A 3K5MA 1X7VA 2MKYA 1YKWA 2VA3A 4CM0A 3NGKA 3UN2A 3TG0A 3HVAA 1LFPA 4EYIB 1C4AA 4HVZA 3J7YU 1KH7A 1Y3KA 4DL0C 3OR2A 3MCNA 1DTQB 3C15A 2HNDB 5KG2A 5I3PA 5I42B 2CQ0A 4X65J 4WFZA 2MZRA 4NA2A 4MKYA 2CDQA 1AA1B 4EGLA 1DAXA 4WTOB 4LFAJ 4OZJA 1S6OA 1U49A 4CT9A 1HBMB 4O44B 2EFGA 2EI5A 3BO2A 5F41A 4WF9Q 4L6V3 3IO1A 1KH9A 1DARA 4DR5J 4X66J 2KT5A 4DSJA 4O0IA 2BYCA 1P27B 1HNVA 1YGYA 2FC8A 4CLUA 1N52B 2BJ9A 3R2CJ 2N7YA 2ZUGA 2XNRA 3D1HA 5K14B 4P72A 4KT0C 3MFHA 4KTQA 2LDIA 3T1YF 2E66A 2VZ9A 3SBMA 1TMJA 2GFFA 4OJ1A 5BYSA 3TQ1A 1RISA 1HBUB 2ACYA 3P8BB 3HSZA 4WJBA 1IWAA 2ZVSA 3O5TB 2LLZA 3IRXA 1HNXF 4N7TA 3U7JA 3OXGA 1RTDA 2HW3A 1PC4A 2P5VA 2CJXB 4NRUA 3QSYB 3Q89A 2I5JB 3CJ4A 3K5OA 5EX3A 4A8WA 3ILOA 5HQLA 1R6YA 2OEJA 5KOXA 3K0JA 4N8NA 4CLPA 2VDHA 1CJUB 2BE2A 1UWBB 2HBZB 4X64J 4P6QA 2V2VA 1FKPB 1FFGB 1WHYA 4GVBB 1OSCA 3NGUA 1GX6A 3K7RA 2CJQA 3FRYA 3I31A 3GIJA 3CCES 4RL1A 3HI9A 4LF6F 2PI5A 2ZDPA 3MM8A 2WVDA 1RQ0A 3GV7B 4PXBA 4K0KJ 4Q8EA 2VB6A 1U25A 3W5ZA 5LXYA 3KHHA 3GJRB 3EGZA 3AT1B 5AJ9A 4IRDA 2WTFA 1FA0A 4C8OA 4ZIWA 4LBPA 4RNHA 4ZN1A 3JSBA 2H54B 1Y4ZB 5IT0A 5AE1A 3HDSA 4OX8A 4IFVA 4HTJA 3P6YC 4IO1A 3DU5A 4DUYJ 2YH0A 2HG4A 1HKAA 2M7SA 4E8UA 4EYHB 2CQPA 5KFXA 4GC6A 4DL3A 3A3NB 4HH1A 2LXUA 5C42A 1U1OA 2R8GA 1A0OB 1H7WA 3CCQS 2R7RA 4Z7YA 2R7VA 1N34J 4Q0BA 2HFZA 5INHA 4TLQA 2XMKA 5DGBA 3I9ZA 2DY9A 4RBVA 1IBCB 1FNXH 3BKUA 2RHQB 3M8PB 3BBFA 1RI7A 1NM2A 2C2EA 3H42A 4X84A 2K7KA 2BBEA 1Y6VA 2Z56B 3V81B 4ZP7A 3U1MA 2EFOA 2KVIA 3D0IE 3OXLA 4X4VA 2EFVA 3MZIA 3QGHA 2NXUA 3AXKA 1U4BA 2YWGA 2LEBA 2XMWA 1YRTA 2V9KA 4C0HA 4DQSA 4ES1A 1W2BR 5C25A 2HIQA 1SJFA 2ZWOA 1UW4A 5L1IA 3HHDA 3I4HX 4HH0A 1HQEB 4DX5A 4N47A 5HQMA 5LRMA 4HI1A 4LF8J 5KT3A 4DQPA 5L1LA 4DSFA 1TL5A 2CKWA 1UFWA 2IRXA 1U48A 4FKXA 1LW0A 4F7VA 4QYZK 3QZ7A 2VFSA 1EQ0A 2QA4S 1T95A 2FVSA 2ZWPA 1Y0HA 3SI8A 5BR8J 2HGLA 4DR3F 2JC0A 5H1SV 2LQBA 5DM7Q 1FK9A 3UDCA 4I6WA 2BVZA 4JV1A 1P9QC 4OHZA 1VQSA 4QW9A 1ICEB 4QCLA 2R2TA 2AF6A 2CNKB 2HBYB 2WOMB 3RW6A 3T5HA 4P73A 2Z2LA 3CJRA 4PRFA 3J81U 1SL1A 1LWCB 3GWCA 1FVSA 3IR6B 1IUJA 4NLRA 3NWGA 1NPKA 3CNQP 1TAUA 3DDKA 2GW8A 2IAJA 1M1GA 1HD1A 3PEJA 3VAIA 3DRSA 3AJ2A 4OYOA 3PYFA 2QX0A 4ZVQB 5CD4H 1N2KA 4BS2A 4UQGA 5DS7A 1JQGA 1TVRA 4TKTA 4C48A 3BPSP 4JI2F 4NX9A 4WYLA 4H4MB 3PDNA 2I0XA 4IOCQ 2F65A 2X1FA 1RT7A 3ISZA 1Q95G 2ZJQQ 2FVPA 3PFEA 2DPIA 1MN9A 3R9LA 3WC2A 1IBLF 1EP4A 2BUNA 2IA0A 2B7BB 5KFYA 3CCTA 1DURA 4UUXA 3SFGA 4Y65A 3KNGA 1JJHA 2IRYA 3WAVA 2DJWA 4U67Q 2GS8A 4A8FA 1IKVB 5C5JA 4TY9A 3D6HB 2H51B 3OFFA 3GFXA 2X1AA 1RKIA 2PFDA 2OHDA 1FVQA 4OZNA 4OYWA 4B3SJ 4O4GB 4G1PA 2W2NP 2P9GA 4ES3A 2MEWA 5ETQA 4UPIA 5A2QU 2XB2D 4YHHF 4A8XA 3B5QA 1MG7A 4XDCA 1Q7YT 4L72B 3ZTSA 1RE1B 1XNQJ 2Q3PA 4JBCA 3UR3C 1ZA2B 5H9FK 2XWYA 3DYAA 3K5NA 3FEXB 5L9NA 1M5HA 3GCWP 4WIQA 2WSFC 2CQIA 1R0CB 3M2RA 4BBYA 1WI8A 2CYYA 1O8BA 1IBMF 3WAYA 1FRXA 1NKBA 4QPTA 2R3VA 4ZVGA 3VAHA 4CO4A 1HWIA 3FSIA 3HJFA 5DGAA 4QWEA 4OYPA 5AE3A 4RLEA 4S0MA 4ZOSA 1NSPA 4IDKA 5AXLA 2H9ZA 4A8SA 3KG0A 1TUVA 3QQCD 4R5PA 5LSLA 4WE1B 1UW9A 1F60B 3GPAA 2G4BA 1WC1A 3VAFA 2BKOA 1TK0A 1V3RA 3CJTA 1FFSB 4PUOA 1P49A 3N28A 4FVMA 4CLWA 3Q3QA 1RLDA 1RHMB 3LUYA 3K58A 3T1HJ 4M5IA 1LV5A 2M9KA 3HKWA 2DHGA 4DF8A 3U27A 4URGA 1NPPA 3LF0A 3M8YA 2GC8A 4X4RA 4HT7A 3B54A 3BO3A 1CLFA 2ACMA 3NNAA 4WU3A 1J5OA 1REVB 2ZKUA 3RW7A 3SDEA 3JSRA 1VQNS 2CVEA 3CJKB 2MJUA 3TI0A 4J5OA 4DZDA 3M9NB 3SCLE 1SH3A 2IRUA 3JAMY 4NCGB 1WHVA 3RG6A 4MK9A 2M0GB 3EDQB 3FQLA 3A8JA 1LW2B 2QFJA 1YJNS 1ELXA 1HWUA 3FEYB 4YY3J 1DTQA 4Y2AA 4B17A 1HNIA 3D7SB 2C42A 1HQAA 1OJ4A 4ZPDA 5AJ3J 4CYSA 2FZGB 2FD2A 4LF7J 1PYSB 1GX5A 3KJFB 2YY3A 2IFYA 1NNDA 3GQCA 4HI2A 3PRDA 1EB0A 1N36J 1XMOJ 2DITA 4FN5A 1VHIA 4LFCF 3QAEA 2O3DA 4DR6J 2KJWA 5HVGA 3SQOP 2KXFA 3BKTA 4UPHA 4WP8A 2MLYA 2A1BA 4ED2A 3P96A 3BM7A 2ZD1A 4X2BA 3G82B 1S1XA 3KG1A 4LRFA 2UXDF 2EBGA 4PXCA 4NLSA 1FJCA 1WTFA 5KG3A 3W2WB 3JQJA 3C6UA 3RYLA 4A48A 1DLOA 5IM0B 3ENAA 4F3QA 1UTAA 5A8KA 1QSSA 2CVIA 2ZH2A 3EVWA 3VGUA 2HQGA 2FHJD 4DPYA 4K4UA 2KJVA 1RT5B 2QMXA 5J1NA 2BX6A 3N01A 5ETRA 2L9DA 3HCXA 4KGMA 2VBXA 1YJ9S 2W8DA 1F2HA 3I87A 2KB2A 3LTOA 3DMJB 2AX1A 1UWBA 3TX0A 4A47A 4U7UD 2CXEA 1KQFB 2YKOA 4DV7F 3GU0A 4KPCA 5CCMA 4EBEA 3SSRA 9ATCB 4J9KA 2BJ7A 2MB0B 1T3NA 2OLWA 4ZG7A 3OW2R 2YWEA 2HQFA 1IBKJ 4IKAA 2BW7A 1U47A 4F3OA 3R27A 1M90T 2VIHA 1H98A 1DZ5A 1RCOB 1TZ0A 2GO8A 1S1VB 1NKEA 1EKSA 2K3KA 4X4OA 3EXYA 2MKHA 1OY8A 2BJ3A 1SV5A 2FC9A 2UV8G 2J6SA 2R7UA 1OO0B 3PW4A 2M4MA 4OZLA 4FP9A 5M2UA 3DXBA 4C7QA 5I4MA 3KFWX 2Y1IA 2HS3A 4DX8H 4B3TF 3PRVA 2KU7A 3CDWA 1DTTB 4CO0A 1TELA 1IQTA 4DV6J 4I67A 3A8IA 1Q0NA 1JKHB 1TUWA 4CYUB 2UXBJ 3R8YA 5CYJA 3M8PA 3MCSA 4CH7A 1N33J 4H4OA 3C16A 5J1EB 1O98A 4N5SA 3CDUA 3JXOA 5KG0A 3OSPA 5HROB 3PACA 3R7BB 5IQ6A 1UKUA 4GKJF 4USHA 1HBNA 3BF4A 3AB2B 5ETVA 3R97A 2HGNA 4EMDA 2IBKA 4CYRA 1QDUB 2RT3A 3M2VB 3US5A 2OH2A 2RU9A 4JI3F 2D3UA 4ECVA 1TK5A 2Y3YA 1KTQA 3TUJC 3EVOA 4PPZA 3EDRB 1XMQJ 2PIIA 2G9YA 3CXCR 5B7WA 4HDHA 1DY3A 4DV1F 3QT6A 1D8ZA 3MCMA 3H98A 2XMVA 3DLEB 5DQGA 2MSSA 5DG7A 1M5OC 3AA8A 1UZHA 1PCAA 1IM4A 3Q8RB 3VAJA 1UVNA 4F3MA 2EFQA 3J81j 2EG1A 3DLHA 5KT5A 4JV5F 2MGZB 4FXWA 4ED8A 4I64A 2QMUB 5B0EA 3RB6A 4B02A 1QM9A 1KTVA 2E9ZA 5KT2A 4OZ0A 3B6BA 4LBHA 4NEZA 4FF2A 1HHQA 3AFGA 2BRLA 4QPXA 1HW8A 4KQZA 1X0FA 2E7XA 2LQJA 3LWMA 1S9FA 1VQ7S 2GSUA 5B09A 1AZSA 1FO1A 5LMUF 1NK6A 3PYDA 2RQ4A 4QIWD 2EXUA 2XZTB 2GSOA 1YRXA 4AFFA 3RBDA 2AZ3A 4QBUA 4FZVA 1E33P 4OZ5A 2B4VA 5KTQA 3MMAB 2NSBA 1IWGA 3GJTB 4G6VB 2QLBB 3LALA 5T41A 2XI2A 2KHCA 3ADAC 3CULA 2J6TA 3FBCA 1TP7A 1TL1A 2VKZG 2L08A 1C1CB 4O3RA 2DR7A 1S12A 4GTWA 4Q2LA 2BR0A 1HI0P 4DL2A 2UU9J 5GVQA 1U7LA 1YG0A 1Z4UA 1U1LA 2LYVA 4KHRA 3DOMA 4IQXA 4GTZA 2XMUA 1FI4A 4JI6F 3VTIA 1UVJA 2H4YB 1YBUA 4ICLA 3LWLA 3FEZA 1SHNA 2MKIA 1RT2B 2RILA 3MTKA 2YNHB 1S9EB 3P4UB 2WSCC 2CQ4A 1U0SA 2C1EB 3HZGA 3PIOQ 4HTIA 4C8KA 4O4RA 2QGFB 4MIVA 1RTHB 3HLUA 1B0VA 2JEIA 4CLLA 3Q8UA 1BQMA 3SMZA 5GAEI 3BREA 1TKTB 4OI3A 4ANCA 4KV8A 3AXMA 4RBUA 3C8YA 3UNGC 1F2GA 2PE8A 3EGNA 4NXMF 5CQGA 4C3MA 1OQ3A 3TEHB 2AHOB 2AEFA 1VFJA 2HS4A 1CVJA 3MTJA 2DNOA 2MQQA 1TV6B 4KHPF 3HHNB 4FNHA 3D3BJ 5C24A 3OLBA 3R6GB 1NSQA 3W62A 3FMBA 3FNNA 1JJCB 4UW2A 2AGQA 3KLIB 4P2SA 1UJ4A 2ZZTA 2J0XA 3LGMA 3WIVA 4L3KA 4CO3A 1KRPA 3RB3A 2XWXA 2OJ3A 1OPIA 4P2XA 1F6TA 3S7RA 4BCAA 1S0MA 1WEYA 2CWKA 2QE5A 2WBRA 6FD1A 1E1ZP 1KD1T 3MK0A 1NMEB 1WDTA 1FJEB 4B3MF 5SUHA 5JMNA 1HBOB 2JH3A 4ANEA 2NYHA 5A8WA 2YBVA 5DLFA 4JI4J 1QE1B 1SKUB 2RQKA 2EG2A 1R7IA 3K8WA 1NK7A 1U6FA 2NLWA 5K8OA 5C66A 5B0AA 2PC6A 3ETMA 1LW2A 1N0VC 2VQEJ 4FF3A 1M5KC 2R8HA 1Y7AA 4MY4A 1VRUB 2NSCA 1VMBA 2KT2A 4KFBA 5DLGA 2NQPA 4N77A 1E6YA 3MEEA 1S9GB 1QAYA 3L7OA 4FYVB 3SV4A 4FNIA 2MZTA 3A3OB 4WXWA 1RU1A 3Q2SC 2MXYA 2D3ZA 1BUXA 5HP1B 4DUTA 3HX9A 2XMMA 1ZS6A 3GSIA 1VQ5S 3KLVA 1YJ7A 2DNQA 1VJQA 3MCOA 3N0VA 5KFHA 4TQSA 1VQYA 4PG4A 4B3RF 3I32A 4L73A 1M1KT 3MPDA 4Y00A 1VBZA 1MROA 2DGWA 3TAMA 4U8VA 4ELVA 1U8WA 2I8EA 2YVSA 2K3IA 2M70A 2XMTA 4LRBA 2QA4G 2QZ8A 1AB8A 1OSDA 4NLGA 2J7UA 2VA2A 2KRRA 4DR2J 4OHXA 3PNIA 2C2OB 4CLSA 3HHKA 2CDRB 1CG2A 4DZ6A 4IH5A 2VJVA 1RAIB 2GVDA 3WC0A 4DCPB 2IVYA 3SIPB 2VFTA 2GJFA 1NJWA 5EGYA 3KK1A 2E5HA 1F9HA 4MAKA 4DV5J 2RNEA 1HNXJ 4ZCLA 4X65F 1I1GA 2J0WA 3TAPA 2VG6B 3ONQA 2IJFA 2CRLA 2QO3A 1ZA1B 5CCLA 4F25A 3UDEA 3BBBA 1K44A 4LFAF 1SUQB 1VIXA 2KFZA 3BKFA 3JQMA 3DOKB 1S0NA 3KLEA 4NRTA 1LXJA 4DR5F 3N9UC 1BY9A 1C0UA 3GIIA 4LF6J 1EW8A 1XR5A 4Y6IA 5EGEA 1Y9OA 2CPEA 1EIYB 4FDFA 1YJWS 5DDOC 4RWWA 3TEGA 2J9DE 1DQ9A 2M88A 1REGX 3OTEA 1HI8A 7FD1A 1S5ZA 4NLVA 1H7XA 3RRKA 5ETMA 3E8OA 1KH4A 5AE2A 4DL4A 2E44A 1I51B 2HHUA 3MECB 4XPCA 4PYAA 4ZG6A 1KFSA 3R5BA 3ENVA 3RRHA 2AU0A 2XLKA 2D69A 2VG7A 3D4JA 5CABA 3ZO7A 3LP1B 4YDXA 4LRCA 2IDLA 2YX1A 2NZCA 1CJTA 1YLXA 3FFIA 2KZZA 4U7CA 2DR6A 1NK9A 1WHXA 2JJ4D 4CLFA 2V67A 3DLJA 2OP5A 4WCEQ 4K0KF 3UN5A 5D8HB 3PRBA 1WKJA 3TJ8A 3JQKA 4H4KC 1N32J 4M5HA 1J27A 1ZOTA 5E2QA 5E0OA 2I2YA 2DTJA 3M2VA 2CAJA 5KFRA 4QR2A 2H5EA 2OPSB 3NNHA 4F36A 1FKOB 4EK2A 1RB0A 5GRRA 5A6WA 3TZYA 1S7IA 1SQFA 4OX7A 2JFDA 1CJKB 5T14A 3KMSA 1N2LA 1NK4A 1RT4B 2CIMA 3FVYA 3K59A 3QJPA 4OL8A 3MM9A 2CQGA 3OVBA 2BM1A 4IUFA 2A6OA 1C4CA 3NLCA 2OTJS 5DO2A 3QATA 4UOGA 1G2EA 2W5VA 1H2VZ 1PBUA 4LVOP 4KPYA 2YNIB 2PEHA 3FSYA 1N34F 5F3ZA 5KFWA 3G8QA 2AX0A 4PG7A 1CULB 5CYMA 3NWRA 4LMZA 1AXQA 2ZOFA 4LSLA 1LXNA 2X1BA 3DM2B 1S6UA 3ICLA 1VC6A 3KJNB 1Y5NB 1RHQB 4B08A 5LSOA 1C0TA 5HSPA 2OIHA 3B4MA 2MHEA 6FDRA 1L3UA 4IYQA 2ZJPQ 2AJ0A 1D1UA 4NWBA 2GIQA 3ZXWA 4QU6A 3RZAA 1S6QA 2E1AA 3H2LA 2B56A 4B9MA 2EVZA 2YXLA 2MQOA 1VRTA 2B5JB 3UD3P 1RABB 1FNMA 4RW7A 1WC5A 5LQQA 2FJDB 4C8ZA 3PEHA 3T6JA 4ZP8A 2A3JA 2YKNA 2XTJP 4KO0A 3BQ0A 2R2RA 4LF8F 1EW2A 3O6QA 1N5TA 1YJRA 4ER8A 1VC5A 2BW2A 2LP4A 1K0TA 4M5DA 3PVXA 2HNYB 1E2SP 3R6LB 2YH1A 2D1GA 1H6KX 4OYXA 2EKYA 2LQ5A 1S0OA 2W4CA 4DPOA 4ETZA 5BR8F 3QT5A 1P9YA 2EC2A 2HWHA 4NLOA 2HRTA 2VL1A 4DSKA 3SV3A 2HURA 4A8QA 4I7FA 3HHLB 3M8SA 2ZBRA 3PX6A 1H74A 3PW7A 3KJQB 4P2MA 3MUMP 4G1QA 2XY7A 4ZLJA 4QIFA 2HFVA 3I82A 3MOZA 4OV6A 4MYTA 1FRLA 5J2PA 2PMHA 2YWFA 1TKTA 2DCUB 5IV4A 2FJWA 3NGTA 3P5BP 2CJKA 5J2NB 3ILJA 4ZP9A 4ZLLA 1R0BG 2F9JA 1VQMS 4N8OA 3CMQA 1XC9A 2B8QA 1T9XA 3MM6B 2MJNA 3GILA 4ZS6A 1PGZA 3AJDA 4PAAA 2QL5B 2ILYA 3T19A 3SZ2A 1MWYA 2BKNA 2YNFB 3OLAA 2DEJA 2PN6A 4MKVA 1JXLA 3TWZA 4DFKA 3HZEA 4RW4B 2HHQA 4RW9A 4CO2A 2BA9A 5ETTA 3UE2A 1G1XA 1DQ8A 4MK8A 1KVIA 3UFCX 3SEOA 4B3SF 1UA0A 2JEGA 5D4NA 1TFWA 1R8BA 3CCLS 2HZVA 4ECWA 3NKQA 1GEHA 3OJSA 3LPYA 4BC7A 2SXLA 4PG6A 4K4ZA 5D4OA 3KK3A 3TJ9A 5JVGQ 2ZH9A 2YKQA 4AL7A 2IM3A 1XNQF 3GV8B 2WB1D 2HHXA 3IN5A 1GNKA 2X3GA 1GFWB 3AB4B 5HLFA 5KFPA 4PPDA 2DISA 4URQU 1FDBA 1F5BA 3W3SA 1NJZA 2PDAA 1URRA 5LJ3Y 4OZ1A 2KZMA 4I2PA 3GTYX 3QIDA 3DPCA 2L41A 2HHWA 2EC0A 1VRUA 2JSXA 2V4QA 4NXNJ 3D5MA 4RPFA 3KDOA 3MM5A 3MEDA 4QOTA 2HAIA 1Y5LB 5HI7A 4PXDA 2M8HA 1U09A 5C2GA 3PHEA 4WBFA 3FK4A 4DX6A 1U2FA 5KFSA 2V63A 5J2MA 5HP1A 4ZVRB 1OY9A 3GSDA 3T1HF 1PKUA 2RB7A 2HPUA 3W60A 2VBZA 1U1NA 3BH7B 4LR8A 4CTAB 4DL5A 1XIQA 1Q5VA 3M4XA 3RBEA 5EN1A 4Q45A 4DDFA 1JK9B 2MY8A 2ASJA 3SYZA 4LJMA 1JXVA 1XNRJ 2PI4A 3I0RB 4C97A 2BKPA 4HT5A 1R27B 3KLGB 3GFYA 1K1SA 2N4DA 3O8WA 3P49B 4ZCKA 1KP6A 1I5OB 3HFZB 2XLJA 2OD4A 1KS2A 2DXDA 1ZTTA 3H5SA 5D4LA 4LF1A 2UVRA 2EBEA 1VQPS 1N5SA 4ZPTR 4DCOB 5EUHA 3V6DB 4YY3F 3R5CA 5B0GA 1FDNA 3ITHA 2XCPA 3VVUA 5AJ3F 5KG7A 2VD3A 2JZ5A 1FTCA 2CPZA 3KDNA 3L7PA 3N4WA 2VG6A 2YKMB 4Y0FA 2WVEA 2FJVA 4LF7F 2WONA 4ZG9A 2K1RA 4PXEA 1Q78A 1T9WA 4C8NA 1NKCA 1SUQA 3KUEA 2OO4A 3MR5A 1N36F 1XMOF 2P8IA 1GTEA 3C15B 1WHWA 3DOKA 4RNFA 2CQCA 1LNQA 1RDRA 2BJDA 4OQJA 1UEVA 3QLHA 2R4FA 4DR6F 4DX7A 1VLYA 3ETOA 4DV7J 4JYAJ 2ZEJA 4YOEA 2V34A 2AYBA 4DR4J 3QFWA 1ZH5A 1Q53A 3MOJB 4RW6A 2XR9A 2W2OP 3SQGA 4DJBA 2BXJA 1ANJA 1RT6A 4HACA 3CJ8A 4IFYA 4IG3B 2GGPA 4IOBA 3JSMA 3P5TL 1ZAXA 3ILLA 1HNVB 4L76A 3MR7A 3GP9A 4NLYA 4TY8A 5A0YA 4LR7A 2I38A 3PCOB 4DPWA 5IWAJ 1XERA 1K9MT 5L46A 3N6MA 3BDEA 2C2DA 3ENWA 2AJFE 3LGHA 3UWTA 1ANIA 1DRZA 3W9JA 1UFKA 1W25A 1PYOB 2CZVC 4ZJQA 4ZKAA 4D3GA 3IRXB 2XMJA 4WKRA 2D9PA 4F02A 4ECTA 2QG9B 2XYPB 2XS5A 2VFUA 4NYOA 4B3TJ 1NLKL 3TZWA 5DLWA 4ZPVR 1VR6A 1R8PA 2Z2ZA 3TP2A 4OX9J 2E7VA 1VDHA 4OHVA 3CD5A 3BV8A 4KY3A 1CEZA 4JI8J 2FDNA 4EO8A 2CQDA 2BE2B 3K5PA 4K2XA 5FLXU 5EHHA 3G6XA 2O67A 2V2ZA 1X0PA 1KHLA 1T94A 5L1KA 1A9NB 4D3HA 2CG8A 1HNWJ 2NREA 4F4WA 3GIKA 4WYWA 3MPWA 3ZZOA 2O5DA 1RT4A 3AD9C 5DG8A 3SZYA 4IR1A 3U1LA 1C2PA 5DZ6A 1EJ7L 1RTJA 2Q6CA 4TU8A 5LIAA 4IFVB 4E2FB 1B0TA 2VPXB 3OVSA 2RF2B 2W5SA 1TKXA 4DV6F 5FD1A 3TUIC 4CI0B 4ELUA 1RU2A 2B4OA 3QNWB 3LGNA 4QWAA 2UXBF 4Y2CA 2B43A 4USTA 2D7SA 5L0EA 5C42B 3NL0A 4DV2J 2N7CA 1RAAB 3G6VA 1YSJA 1N33F 3B8HA 4KGKA 2C3MA 4CT8A 4QWDA 4JV0A 4Q0BB 1WKLA 3QFHA 4U7UK 1QAJA 1WSRA 2VQRA 1GMUA 3GONA 1U1MA 4KHMA 3H7HB 1U24A 4DBQA 3EM1A 1RA7A 5HANA 3DRXA 2GA7A 3F44A 5M2RA 1LQ9A 1NZ8A 3WZ0A 1RCXB 2MQPA 2HZCA 4ED7A 3Q0AA 3HT3A 2X98A 4HL9A 1Q81T 1SJ3P 3UDVA 2JVOA 1GMWD 4LSZB 2RQCA 2HQIA 4NYZA 4LQ9A 1SBRA 1GXTA 5C25B 1XR7A 2YKAA 1XMBA 1N8RT 2AJ1A 2E5LJ 1I6JA 5EWFA 2KG1A 1HPZB 1HYSA 1RADB 4ERDA 3BH6B 1X4DA 4N76A 2OMLA 2QLFB 1FRIA 1KHKA 3S1TA 2IIHA 3AH6A 5HVFA 4FYXB 2DGXA 1YZ7A 4JI7J 1KFDA 2G0JA 2OPRA 1LW0B 5IFMA 3HVTB 1K73T 2C2KB 2LU1A 4KRWA 4JI6J 4LUBA 4A8KA 1FK9B 2W2QP 4P2FA 3NOCA 4J90A 2QJ3A 3H5UA 4UUWA 3TVYA 4M63A 1RBLA 3RB4A 3BDHA 3CD0A 3VGVA 2R7QA 5LL6d 1UVLA 2W8LA 3A3PB 1VQ9S 1HARA 4Q8FA 2CFXA 2IAJB 2LMIA 2IUCA 1BHNA 1FJ7A 3LP2B 3DRSB 5L9XA 3THVA 4ECXA 4C3KA 3M8WA 1EETB 5GAEU 3M8RA 2A10A 1SJRA 1QUPA 1L5UA 4UORA 2UU9F 5DETA 4DR7F 3TANA 4QYZJ 1V3ZA 3VAMA 2NZ4A 2QSWA 4WTYA 2DH8A 2MPUA 2RHSB 1RT7B 4ED3A 4EZ6A 2RUGA 4RW4A 3PYEA 5J2QA 5HAOA 1R43A 3MEGB 3M30A 1EP4B 1ZM3A 3EMTA 1T3OA 3CB4A 5I3UA 2AJ2A 4P71A 4TN0A 3V6HA 3QAUA 2B8PA 2HFNA 2BQRA 4C9DA 4UY85 4FVCA 2R7OA 3PHTA 3UI3A 3H40A 2F5GA 1K8AT 3X1LB 1URBA 4DHVA 3J80U 2BABA 2AEMA 1RWPB 1T05B 3QIPA 4IG0A 4B9NA 1IJFB 3LA0A 4J9UE 5KFKA 1U2RA 1VISA 4DR1J 1XQIA 3WDOA 1IN0A 2BQUA 4K4TA 5TJ3A 3DYAB 3NKMA 5KG4A 2LFVA 2LECA 2C2ZB 2AQ4A 2VICA 3HKZD 5DLVA 3M2RB 5F8HA 2W25A 1HW9A 1YJVA 1KQKA 3HVWA 2NXNA 4EUVA 2I6WA 1UFLA 1T9UA 5KG5A 5K8NA 4ES2A 1RBOB 1JLCA 4XPEA 3IS9A 4DL6A 2YQ3A 2C3YA 2QLJB 4HKQA 4OV1A 3HHLC 4M94A 3MMBB 3OUYA 2OPPA 2DGUA 2W01A 4IDKB 2HVIA 4R5PB 4JP8A 4JI5J 2EKNA 2CZ4A 1ZM9A 3SSSA 4OZ3A 3KLHA 3IP0A 1E6VA 4PUOB 2F8HA 5KAKA 5GMEA 2E1CA 3CTRA 4UOPA 2Z30B 2G0IA 2Y9HA 4JI4F 2VDIA 2WB4A 3KMQA 2CNLB 1KVJA 5H9FJ 2DB1A 2GIFA 3P45B 1PAUB 3PR4A 3TAQA 1X60A 2KVQE 3GZ7A 4RUBA 5FJ4A 1RZMA 2QTWA 3D67A 5EX0A 1J5OB 2W7PA 2MSTA 1GQEA 2VQEF 3E01A 3SDEB 2ABYA 1Q7LB 4DXLA 5ETOA 4FS1A 1YIJS 3EPIA 4FDIA 1JMTA 5LM7E 3G71S 2YKMA 2KI2A 5LXRA 1P8GA 1WF2A 3C14B 1Q8BA 3RU0A 2UVUA 3FQKA 2MKJA 2J8AA 4YN3B 4B9LA 4WZQA 1S1WB 1YJUA 1EX8A 1HNIB 3NCRA 3Q8VA 1F9EB 1XEZA 1HMVA 1TL7A 5LRNA 4PKDB 2FVCA 4FXDA 4ZDNA 5IT9U 4QYRA 3H59A 1UZDA 3KYLA 4K4YA 1RWWB 5CAAA 1H72C 1RLCL 1SC1B 1VI7A 2B6AA 1RTIA 4P74A 5B08A 2J0SD 1FWLA 4IG3A 2BE9B 1O6XA 2P2CB 2ASYA 2RQMA 3U02A 2ZD1B 1S1XB 2B4UA 4DR2F 4J9QA 3DYCA 3CGIA 4EU0A 2ROPA 2V5HG 2HQ3A 2KM8C 1SJ1A 1B70B 2FJAB 3C6UB 5KFTA 2XYGB 3UVJA 3LAMA 2CPIA 1DLOB 3PXGa 1Q1KA 1F0XA 5D0EA 3PV8A 2PSZA 5A8KB 2HIYA 1X4CA 4DV5F 3RR7A 5KFZA 3VCDA 4CO1A 5HVHA 2V8VA 1F3VA 1IQZA 4KGVB 4I4BA 1WORA 4F26A 2V4JA 4KB7A 5JVHQ 5J1PA 4IQMA 3DRRB 3C46A 3LO3A 3DLGA 1ALIA 1TKDA 1FDDA 4TNOA 5D4PA 3W63A 2FLLA 2V4RA 5D78A 4LSNB 5LJ5Y 2PMZD 1KEKA 4KJGA 2F40A 2H5IB 2AMCB 4RX6A 3CJ0A 2CZ9A 2B7CB 2P6TA 2AGPA 3CCZA 2VFRA 2GAHC 4OIXA 3X3UA 2IJRA 3GJQB 2HWTA 4C6AA 4F4XA 3PX4A 2ASDA 3OL6A 4QWCA 1Z2ZA 4AL6A 4MK7A 4DPXA 3OXFA 4GO7X 5E33A 1TR0A 3MWBA 5A6PA 4BHQA 1RT1A 4UZCA 2ATCB 3BO4A 3KOAA 1W26A 3MAHA 5FDLB 3AOCA 3H5YA 5D3GA 1SV5B 4NYPA 3HP6A 2W9CA 1KQSR 3DNCA 2FGOA 4Z2XA 3PR5B 3CPWR 2CG4A 1VHFA 3THPA 1MMDA 2RF2A 5EGHA 2MLXA 1U1RA 4OLOA 1H38A 3DXSX 3V6KA 3PYGA 3IDDA 2GLQA 2Y1JA 3LP0A 2E29A 3LAKA 1M5VC 2DNNA 5MLCV 2AEJA 3MM7B 1ZZFA 1GTHA 5T7LB 2CJ9A 4GKKJ 3O3LA 3Q24A 2W5XA 4AQYJ 2RIJA 4OI0A 3NKRA 2VV5A 4C11A 2Q79A 2HKEA 1N32F 2YPYA 4H4OB 3C16B 1NO8A 1NH7A 2AW0A 2KN4A 2WBMA 1Z1ZA 4H54A 4TLRA 5DQHA 1ED9A 2XSJA 4OI2A 1KC8T 1WG5A 1FDAA 3NXZA 1HBNB 1BD6A 1A6LA 1KSPA 3D66A 2CWXA 2VQFJ 4KJIA 3H2UB 4LREA 3O44A 1HPZA 1B64A 1QLNA 4PQUA 4GTYA 3VHQA 2Z0GA 4ECQA 2QEXS 5F8GA 3PJ9A 4HHHA 5HJXA 1X8DA 2CNNB 1YWXA 3HVTA 1HWLA 1TKZA 2RRAA 3BR8A 4DFPA 1FERA 4Z37A 4ZVFA 1V5IB 2K7JA 1UVKA 1X5TA 2G1HA 1WC0A 3AD8C 1RWXB 1SQEA 1ALHA 3AOAA 2BJ8A 3I56S 3MK2A 1JLFB 5KFOA 3WHIA 3OT9A 1NK5A 4WP9A 2GZOA 1ULRA 1MMNA 4X4PA 1RYSA 2DNYA 1RHUB 3LP2A 5HBMA 2QN6B 1WSVA 3RUBL 1AZSB 2IDEA 4B9VA 4MJKA 4DU8A 1EETA 4PR6A 1AUDA 3NY0A 4ZLNA 2OFGX 4Y34A 1QD1A 3EXCX 2DGOA 1TL1B 1SC4B 3GYNA 3JTOA 1AROP 2OAUA 2KFNA 3WBHA 4I68A 3KK2A 2CJAA 4ZMMA 3TA1A 1EJJA 3FDSA 1S59A 3OFHA 3MEGA 1UL3A 2HWIA 2UVWA 1KBRA 3LW5C 3EZ5A 3KXDA 1ALJA 1EI6A 2JOQA 3MAAA 8AT1B 3DOMB 5CHCB 1UWAA 2MKCA 5F8JA 2ERRA 2GHVC 1RWUA 4ICLB 3EZOA 2J5AA 2ZH8A 3JS9A 3QJJA 4ILLA 2C3UA 1SCJB 4TU9A 2L9NA 4NA1A 4MIBA 1N5YA 2DCLA 3QWUA 4G1IA 1GMVA 1HQUA 3ED4A 1T05A 4USMA 1BQMB 4EO6A 1AFIA 3UPFA 2Q43A 4KJDA 2UUTA 1YITS 1AT1B 4IH6A 1EZZB 1OIAA 2ZJRQ 2LA4A 4KV8B 2J0QD 4N56A 2XMAA 2E7WA 3MR3A 3PO4A 1FEEA 4NA3A 4DWIA 1M1HA 4OJGA 3CJ5A 3OD2A 2CPFA 2XBPA 3GIMA 4WFXA 1PILA 1X5OA 1Y11A 2KYXA 4QQBA 3IAS9 2ZZMA 1NK0A 3QRPA 1IKXA 4R25A 5KFAA 2RKIA 5C24B 5KFFA 1U02A 4YB7A 4M5MA 2ZH7A 2AJQA 3MMBA 4ECYA 1S79A 2OSRA 1RGVA 3N6NA 4PZVA 4AL5A 3JYTA 1O99A 4UOFA 4L3NA 1M5PC 1HNZJ 3R5AA 3D54A 2HLUA 3ELHA 1G3OA 3WX4A 5GAHI 2HHPA 1Y5IB 2RRBA 2ZHBA 1LWFB 3CCUS 5K5MA 3C66A 4DOZA 4B3OA 5DG9A 3HM9A 1MLAA 3UN3A 1D09B 3EX7B 2ZC4A 2HHTA 4DFJA 2MZQA 2VODA 5A8WB 3BGRA 4LT6A 1FESA 2LA6A 3HFKA 1KWMA 2D3OR 4NXNF 4FF4A 2CUYA 4ZHRB 3H90A 3CJQA 5L39A 2RS2A 2XM3A 1G4CA 4NOHA 4M5LA 1AJDA 2DK2A 4WXOA 3EICA 3Q8SB 4YQWA 2IYGA 1S1UB 4QR0A 2G0CA 3C14A 2KRBA 2CQHA 2IBOA 1S1WA 4LF4J 4NPOA 4KFBB 1UETA 3VZHA 1B99A 4CXUA 2W5QA 4I2QA 4L74A 1E6YB 2LKZA 3MEEB 3W1YC 2UUWA 1CBKA 3FJ2A 4ECSA 3HHLD 2JLGA 1ALKA 1JLEA 5EWEA 4RO0A 2BANA 3DLKA 3QT8A 1U26A 1UVMA 4GVLA 3AOBA 1AYEA 1CQNA 1U0HA 2BDPA 1WWHA 4X62J 3DHXA 2U1AA 4CXSA 2OMOA 4QZVB 1XNRF 2MQ8A 4UOCA 2QV6A 3DGPB 5GAGI 3J7Z5 3CDBA 1NRKA 4DEZA 5KG6A 2G13A 2O1PA 3BDGA 2DKOB 3V4IA 4E98A 3J80Y 5C7PA 3UD5A 1TUGB 3ZZ0A 1MROB 3LANA 3HHEA 4P75A 3TAMB 4DUZJ 1ELOA 2FLNA 3IG1A 2YPZA 2XI3A 3M05A 1GXLA 2QA2A 3OTOJ 4UOHA 1U2CA 2AIRB 3LOUA 2BE7D 2GVDB 4ZVOB 1UAWA 3DRRA 2JC1A 3C19A 3W7BA 3FRZA 4KKOA 3QGPA 3KK1B 4YB5A 1V3SA 3R2DJ 4LSNA 1N4LA 4O0NA 2AYGA 1SIWB 4CIOA 5F8LA 4QWBA 4RBTA 4DQIA 4Y3CA 1LWEA 3VR1A 5F9LA 3KHRA 2J76E 4ED0A 3Q86A 4ZN3A 5AXNA 4ECZA 4JYAF 4NMLA 3VV2B 2XGQA 4DR4F 4NWJA 3BSNA 4K50A 2WW4A 1N5QA 2HBQB 4KH0B 5U47A 4KE5A 3PO5A 3J7A1 2P9EA 3KLEB 1NDKA 3CC4S 2M2BA 1QUVA 2ZBCA 2NUUG 2FHJA 3QZ8A 3BB5A 2KXNB 2X1GA 4NE9C 1C0UB 3QGIA 5FDLA 3BR9A 1NXIA 5IWAF 2HRUA 1JLQA 3QO9A 3FSXA 3PW2A 2X7IA 5FIIA 4F04B 1U45A 2IMWP 4ED1A 2W8SA 3NRBA 2LQ9A 3L95X 3Q83A 2DO0A 4OLPA 3TZXA 4ENOA 2DR8A 2VG5B 3W5XA 4LF5J 1HA1A 1ROFA 3MM7A 4FF1A 5T7LA 4MKAA 5E3PA 4XDDA 2JEFA 2Y8YA 5AT1B 4OX9F 3NAHA 1RAEB 2P9CA 4ZJLA 5D0HA 4ZVTB 3BGUA 1N88A 4BWMA 3ZTRA 2VG7B 4JI8F 1R89A 5HK4A 3M1VB 1MNEA 1CJTB 4JV2A 3U1NA 2W5WA 3FFIB 1QY7A 2DHAA 3D1OA 1FX4A 1RAFB 3DI6A 1HNWF 2H3EB 1I3OB 4BC9A 4ZPCA 5IT9Y 2U2FA 5HMXA 3BDFA 1T0TV 2EEYA 4J9RA 3NG8A 4ZP6A 1YX2A 4NI2A 3UR0A 3IXQA 1NSKL 3G4SS 3CMAS 4IR9A 1RWVB 3I5AA 2DYAA 2GMHA 1R3NA 2VOOA 3PKMA 1GH8A 1KHVA 2ZH1A 1LFWA 3NGDA 3D1QA 8RUCA 2DGSA 3HT0A 3MM9B 1NB2A 2DR5A 2GSNA 4J37A 3IM9A 2ZKTA 1NAQA 4UF4A 5K8MA 3VVTA 2KHDA 5EDWA 4ZCIA 3M8QB 4DV2F 2P6SA 3M6UA 3QMQA 1HJKA 5CYMB 1T11A 4DLEA 1W2IA 4K4VA 4LSLB 3UD4P 4HLBA 3OL7A 5GMKa 2W7AA 3BDPA 2OD6A 3KUGA 3MPYA 1IKWA 2OSQA 2WVFA 1D9DA 4LIRA 1L3VA 4FYDA 1C0TB 1P1LA 3MUVP 1JLFA 1WI6A 1S4EA 2LDYA 4MFBA 2COLA 4CH0S 3R7SB 3JTPA 2KO1A 4AUKA 4QAXA 1S6QB 2LU2A 3IBCB 3MAQA 2V8GA 1VLOA 5A8RA 2DRDA 2GJIA 2HVZA 2AKWB 3MXHP 4JI0J 2FY1A 1YTYA 5LMNJ 7FDRA 1NEEA 1VRTB 2V9WA 4RW7B 4KR0B 5DDPC 4NLWA 2IC3B 1HIYA 1RK8A 3C2PA 2E5LF 1VK8A 4MIAA 2YKNB 4KO0B 3D68A 2ZM6F 3FBEA 1NU4A 1URNA 4KGXB 4OYMA 2A0FB 4U6PA 4M5DB 2RU3A 4JI7F 3R5JB 3MK1A 4F4KA 4DR7J 3CVKA 2H65B 3DGVA 9RUBA 1RWKB 3DRPA 1NHUA 2B4PA 5IXUA 3FUYA 3G2XA 2FHMA 2LQ8A 4I7FB 1GAOA 1IKYB 3BSOA 4QR1A 5F0UA 3DOLA 4G1QB 2VUGA 2GMJA 1WG1A 5LSRA 4LR9A 5DJBA 1CC7A 2DPJA 1IM6A 3OR1A 3IGYB 2GNKA 5IT4A 4LRAA 5J2PB 4OMFG 1HHSA 4OZ2A 5JJBA 4ZGAA 1B7YB 4ZJOA 2ROGA 1KLMA 4ZIVA 1CJVA 2ALYB 1S6PA 3IC1A 1AFJA 3I5BA 2HNZB 3FZBA 1TL3A 2UP1A 1X4BA 1KOHA 2Y8WA 2XS2A 2KL8A 3D6FB 3ET6A 3NS7B 4LFBJ 2HS0A 2JLFA 2OGUA 3W61A 2QL7B 2VONA 3AAWB 2DGTA 1JLBA 2V2KA 3D28A 5LOQA 2J9DA 4JI1F 2XGPA 4ED4A 1FXRA 1EKRA 4YB1P 1BC6A 2HHHJ 1C1BA 1X9MA 1SI9A 5IS2A 4CWBA 1D0EA 4RW9B 2DXEA 2IVMA 2M3DA 3NKYA 5BJRA 4I6AA 2CADA 2XC9A 1LWFA 1BQXA 5IQQA 4NLQA 1UJ5A 3NKOA 5GADI 1XN9A 1RBAA 2D3O1 4LQ3A 1BXNA 3BN7A 3IGNA 4NZ6A 4YP3A 5D0GA 3MF5A 1EQMA 3J81Y 3VQTA 2W9AA 2YWHA 3B78A 1NDLA 1FJGJ 4DR1F 1NHVA 3KK3B 2W24A 2FJBB 3NS5A 3H8YA 5HMZA 3CCMS 1ED8A 5HLFB 4ZHRA 5ETKA 1S0VA 2Y1RI 2IPOB 1KH5A 3TW0A 3R5GA 3Q8YA 1HR0J 2GVZA 3DFEA 4OYBA 5DRKA 4I2PB 3PY8A 2XS7A 1N6QB 1S1UA 4KH1B 3L3CA 1ZETA 3PJWA 2Z2MA 3QBCA 2V94A 3E2DA 2H5JB 1ZEDA 2W9BB 4TN2A 1ITPA 4CH1A 1X4EA 3R7NB 5KFBA 2FB0A 3CMES 3MM5B 3ULHA 3MEDB 5HO4A 1OYEA 1HWKA 4JI5F 2AJ4A 3Q2TC 2JEJA 3AY0A 2RVJA 2HK3A 3MR2A 3V6JA 4DQRA 3OPKA 3FC9A 1GK8A 5J2MB 4A4JA 2R7TA 2MQNA 1NZAA 3KJVB 4NLUA 1IR2A 1YBAA 2VHGA 1VQKS 3O1LA 3DGPA 3TARA 2DEIA 2UXCJ 1DFDA 4BDPA 1N56A 5KFNA 1CS4B 3I96A 3C6TA 3I0SA 2R9LA 2AP6A 3I6PA 2CQ1A 1S72S 1VGYA 5A2QY 1CSJA 1UJ6A 1T8EA 5RUBA 4FPIA 4DI6A 2LEAA 3MD3A 5D6GA 5THWA 2FYXA 3M6XA 5H9EK 1MW7A 3GLJA 2ZC3A 3Q23A 2ZE2A 4RUCA 3TJAA 2HAFA 2L3MA 2NYIA 3ZZTA 2XY5A 1MWQA 4YFUA 3TYTA 3HULA 1A7GE 2W8KA 2RMLA 3ITHB 4QIEA 4OI4A 4RW8A 1FWPA 3MHYA 3T01A 1Q8IA 3QT7A 1EARA 2UVVA 4RNNA 1SKSA 4CZCA 2GMLA 2WONB 1XJWB 2K1RB 4HYKA 4WKYA 1S99A 1X4FA 2RUSA 2ADBA 2IM2A 4AXIA 1KQGB 1E3CP 5GMDA 3QLHB 1EW9A 2C2NA 2EK1A 1PJ6A 2A18A 1V9OA 4WIIA 3KG4A 2KKHA 2HMIA 4PWDA 3M6VA 3G8TA 2WSEC 3FBBA 1VQ4S 1KHWA 4CNYA 1B3TA 4DSIA 4RW6B 2V8HA 3SQGB 3CE8A 3IA0A 1RT6B 1YZ6A 4HACB 4IFYB 3RTVA 3IWLA 5IJSA 2GGPB 3JSMB 3JSYA 3RJMB 5B0BA 4CDIA 5AXMA 4J9VA 4TY8B 5A0YB 5HJYA 2VG5A 2DBBA 4WPAA 2J7WA 3VGTA 2WVCA 1ZAWA 1JLGA 1OS5A 2GA3A 1MU2A 3W9IA 1NDPA 4USKA 4CLZA 3M2UA 2Z8QA 3H4BA 2F8MA 1SH0A 4EZ9A 1VC0A 3M1VA 1JJ2R 3HVRA 3OBIA 4UPLA 1LKZA 1J2VA 1B7FA 2CPJA 2HQCA 1UVIA 4WP3A 3VQSA 3IGZB 4DV4J 5JUMA 2CJBA 1Y7PA 2VKRA 5E3CA 1SC6A 4NZ7A 2W4PA 4OJHA 1AUSL 3GMGA 4RU9A 2BM0A 2ZHOA 4J9OA 4CQ1A 2VPZB 5CH7B 4UT4A 5I3QA 4QIGA 1Q4RA 2C3PA 2AZ1A 3O2IA 5KFGA 5IZHA 3B4DA 1G6BA 3GFZA 3N79A 3CC2S 1RKJA 2MZ1A 1XTZA 3CT9A 3OFEA 3BYRA 2VPWB 1K7HA 3M8QA 2D74B 1RTJB 4O3NA 1JX4A 1W7WA 1HL6A 4KBIA 5HQ8A 3QRQA 4DSEA 1FE4A 2B0GA 1I94J 4GKKF 1TKXB 3BGLA 1VIOA 3RBXA 4AQYF 2VC1A 3F73A 2H1YA 5L38A 4UY8T 5L0BA 2DGVA 2BZ2A 3CDEA 1RAOA 3WAWA 3EWGA 2DH7A 2WAQD 4WK1A 1N48A 1T02A 3M7VA 1S1TB 5IC4B 2RJZA 3W2VA 1ELYA 2YNGA 4P10A 2HVHA 2R7XA 2E9RX 1SJQA 3RGIA 4UOOA 4WK3A 4TYBA 2MZSA 3I55S 4FKYA 3CMRA 2GQQA 1X5PA 2VQFF 4KIAA 4MTPA 1PBAA 1ZYQA 2IC3A 4X4UA 2GO9A 2HK2A 2A2CA 5KFVA 4K4WA 2R7WA 1K47A 2YWWA 4PG8A 1QVFR 2NXJA 2UUBJ 2C3OA 1LK5A 4IH7A 2JRSA 1K0VA 2HNDA 5I42A 2W7OA 1VQ6S 8ATCB 1HD0A 2V68A 2ANHA 2CQ3A 3ISNC 1SH2A 3MGJA 1QAIA 1HYSB 2M52A 4CO5A 3DDIA 1HBMA 1IKYA 4O44A 1FKAF 3TUZC 2ZH5A 1UPPA 2OPRB 2R8JA 4FS2A 5D77A 1D3WA 4ECRA 3S01A 3CCJS 4OYZA 3HSDA 3Q8QB 2ZOMA 4WZMA 2JLEA 1SL2A 3M9OB 1Q86T 2CA9A 5K14A 4V19X 2A6MA 1T9TA 2YTCA 1ZZNA 2E1MC 5KFMA 1HBUA 5JXSA 2DNLA 2RAQA 1RWNB 2HNZA 1OQ6A 4TXSA 1KR4A 3ZZYA 3NGRA 2E1PA 2IUCB 4CLKA 1HI1A 4MHXA 2IFXA 4CCHA 2I5JA 2UV8A 2F7VA 4WFBQ 2E5IA 1X9SA 2DNZA 1RHRB 4MYUA 2FJEB 2JVRA 3RB0A 1ZTWA 5B0DA 3UNYA 3PTWA 2J9CA 1S4FA 1Y00A 4I1TA 4NEYA 3GV5B 3FGVA 1IJEB 1CJUA 1FKPA 4EBDA 4GVBA 2CPYA 4CLYA 1JXEA 4NWXA 5KFEA 4C4WA 4L75A 5J2QB 5E3AA 3K5LA 3A13A 1RWOB 4LF2A 3M30B 3NMAA 2ZNYA 4K5RA 2R2UA 2APOA 2MYFA 4YDDB 5I3UB 1Q8LA 3R1LA 1XBWA 3BJYA 2IY5B 4TYAA 3IBFB 2UUCJ 3I5CA 1FD2A 4DPTA 3FCHA 2XG8A 3CJSA 3PKYA 3E2EA 1ZPWX 1WACA 4DN9A 3L4BC 4ELTA 5GAHU 1LK7A 5F3TA 5ITHA 1J5EF 1IR1A 2FIUA 3QIPB 4OHWA 4IG0B 3BSCA 4M5JA 3FKBA 3IGVA 2AV5A 2RD5C 4USVA 1N6QA 4M5NA 3CF5Q 2ZNZA 3IM8A 3DC2A 3W65A 4ZVHA 2HHSA 4CNZA 2W9BA 2VH7A 2F4VJ 5B0FA 1GT8A 4I6YA 3RAMA 3IMQJ 3CCRS 4USIA 2MHNA 2QLXA 4TU7A 3EVMA 4HR2A 1ZM2A 3SSQA 1HNZF 5KFIA 3ZTPA 1JLCB 1R8AA 2I9SA 2PT0A 3IS9B 3V81A 2DRBA 3HPOA 1LWXA 3I9V9 3OUYB 2OPPB 3KJVA 1TAQA 5K9FA 2Q1LA 3DKDA 4YS2A 5CYQB 1AUKA 3KLHB 4AE5A 4RKUC 1X4AA 3PW0A 1E6VB 1CS4A 3UO0A 4YEAA 3R1HA 1FD8A 1JB0C 1SB6A 3CWJA 1HQEA 2HFOA 3DLBA 1ELZA 3K2YA 2DHHA 1QTMA 3NAIA 2W4DA 2NUHA 5GAGU 1FE0A 4G65A 4A46A 3FCWA 2YWKA 3E01B 2KXHA 2IA6A 1AJAA 2OPQB 2B9YA 1RHKB 1WG4A 4O3QA 2OI2A 4LF4F 4F0MA 1FF2A 1LOUA 2G2YA 1VK3A 3F56A 3T9ZA 3W8GA 2QIFA 2QZUA 2HLTA 5SZTA 1V6HA 2WOMA 3FZ2A 1WF0A 3IBWA 2IVFB 2WW8A 1LWCA 1B4SA 1HMVB 3UCUP 1X4HA 1S10A 1VYAA 4X62F 2XEXA 4NZ0A 1KONA 1TL7B 3SCJE 5KFLA 2G2ZA 4DS5A 3TRGA 3G6YA 3RBZA 3EPGA 2D1CA 3RAQA 4GC7A 1D8YA 3KD8A 3T5KA 2LXFA 3D6TB 3SZZA 2RDJA 4DUZF 3W5YA 2B6AB 4CXKA 4H4MA 1RTIB 4F4AA 5E3QA 1DQAA 3MUTP 2PO4A 4DV0F 4Q43A 5IC6B 3GG1A 3QJLA 3A52A 1SKRA 5F8IA 3AODA 1H2UX 1T9YA 3OTOF 4LVNP 1OMSA 3GR0A 2QLWA 2VBYA 2VU5A 1WELA 3AD7C 3MI7X 2WVBA 3UVJB 2FVQA 1R8CA 2DRAA 4EWTA 4P7VA 4XO0A 2W2PP 3V4MA 3LQVA 1IKVA 2V4JB 3J7AN 2J9EA 1RT3B 3KWMA 4RUAA 3DLLQ 3DLGB 1S76D 2K2PA 4ID8A 1XK8A 4O4GA 2Y1LB 3G6ES 4MH8A 4DSLA 5CZVA 4DG1B 4KM4A 2ZITA 2E1RA 1XWLA 5E41A 3HSJA 2V6AA 4DLGA 4FYWB 2C28A 3WQPA 2N3OA 2G1DA 3F41A 4X4QA 4DF4A 1WDDA 2GV1A 4OX6A 4ZK7M 1KDNA 5G0RB 2XZWA 4G3IA 4M5GA 2F9DA 1UEUA 4ZVPB 4USWA 1FXLA 1ZEBA 1FFWB 5LT5A 2WZ1A 1FRHA 2AYEA 1NDCA 2ZFHA 1RT1B 4J9NA 3MR6A 1VJWA 5D3GB 3KKFA 4Z7CA 2W9CB 1AJBA 4LF5F 3UDLA 4ID5B 3DHWC 1T03B 2UUAJ 4WE1A 2HVDA 2AYMA 2NPFA 3A1YG 3TNVA 1KNZA 5ETSA 2FPHX 3LP0B 4DFMA 4Y2MA 2IJNA 1S1TA 3CC7S 5E3RA 3MEKA 2GAGC 1RA6A 2BV3A 3TUPA 2XO7A 2PA8D 1TK8A 2Z2YB 4PG5A 4B9SA 3QPIA 1REVA 4C11B 3POTB 3BQ1A 4ALZA 4WWSA 2V50A 4LF9J 5AXKA 2VASA 4UTGA 3CJKA 2E9TA 2QMWA 4IO9Q 2J8SA 2BOPA 2XSJB 3H20A 4NCGA 3UQSA 1P6TA 4NCAA 3NCQA 4P9SA 1TQLA 4GO5X 4LQYA 2FGCA 4A8YA 3TOQA 4AD6A 4DV3F 3MMJA 1HWJA 4J9LA 4WU2A 3H4DA 3RAXA 2Q66A 4FBUA 3GE9A 1U6BA 5D0RA 4IOAQ 2VOPA 4OI1A 4JUZA 2FTRA 2FHOB 4PQUB 3CO9A 2R8IA 1T7PA 1SC3B 2ZM6J 1FNOA 1F9FA 2LXIA 2YX4A 3SCIE 2JL9A 3TVKA 3KHLA 5L1JA 4PYDA 3UCZP 1EHWA 5KFDA 4EEYA 1QSLA 4AYBD 5KG1A 1R31A 3IWXA 4PABA 1TKZB 3PM9A 4NL5A 2BEFA 2VPYB 4H4KA 2AT1B 3W64A 1VCTA 1NUEA 3CJ3A 2B3TB 2N3LA 4ED6A 2OKQA 3EYZA 2Z4PA 5K20B 3KTQA 2KFYA 3G82A 3AQPA 1GMWA 3NS6A 3W2WA 3EE3A 3NNCA 4ILMA 2B51A 1H3DA 4Y2KA 4JI0F 5IM0A 2NPIA 5LMNF 1CPZA 4X4TA 4U95A 1ZPVA 1JNZB 3J7YI 4O23A 1NCLA 1VBXA 2QYCA 2HGMA 1RT5A 1OWXA 4XTTA 5HBMB 2XYHB 1UPMB 4F4ZA 4GTXA 2XO6A 1Q8KA 5C2CA 3Q22A 3T1YJ 3CDAA 3SCKE 2OUGA 3L09A 1Q16B 2FLPA 2RH6A 2AD9A 3G8SA 5KFCA 4Q7AA 3DMJA 3K8VA 4ITSA 4R8UB 3R5DA 4PCQA 3ISND 1RYRA 3LXQA 3KK2B 4ZPWR 4A8OA 4JI1J 1URAA 2BMBA 4J91A 1SIZA 5HN0A 4JOUA 2IM0A 2HRYA 1TL4A 2GX8A 3MAAB 1KOOA 3D3CJ 2F3JA 4X66F 3CEDA 1BMQB 1TTHB 3J7ZT 1S1VA 2LEPA 2KT3A 4RNOA 3LPEA 3M8ZA 1TU0B 4NLTA 4C8MA 2NCKL 3CIZA 4LBIA 2ALZA 1N5YB 1TFYA 4OJ3A 1HQUB 2OEMA 1RTZA 1S7HA 4RJVA 2UZAA 3K57A 2AWZA 1NPRA 5GADU 2GIRA 1AJCA 2IM1A 5ETNA 3W9HA 4LFBF 1P1TA 3CCVS 4Q2MA 3N5BA 3DN9A 4XIUA 1U1QA 5DLTA 1RWMB 2OEKA 1DTTA 4ANDA 4XAKA 1EQJA 2GHPA 4DL7A 1JKHA 3NVLA 2DH9A 4C2MA 2W5TA 4CYUA 2FHKA 2C2MB 4RUHA 4C8YA 2HHHF 4X64F 2KH9A 3LH2S 5BXIA 2B9XA 2VC0A 4PEOA 3GR1A 1IKXB 5J1EA 4QU7A 4CM2A 5DDRC 1WEXA 5CA5A 2ROEA 2M8DB 2RKIB 1WOPA 1WTBA 4C3LA 4DCJB 4EFAC 3H5XA 5HROA 1IVZA 1WUUA 5BYRA 4NCBA 5IV3A 2DGQA 4NLPA 3BS9A 1QAXA 3L7UA 4R0EA 5CYQA 3JTNA 3JYTB 5HMWA 1Q5YA 1X4GA 3MURP 2RDIA
chains in the Genus database with same CATH topology
1FSUA 4GTYA 2VQRA 4LR2A 3A52A 2ANHA 3IDDA 2GLQA 3BDFA 1KHLA 3T00A 4QAXA 4LR9A 3UNYA 1KH4A 2XR9A 4TN0A 3WAXA 4ZG7A 1ALIA 1EW2A 4UPIA 1O98A 1SHNA 3NKOA 5IJQA 4LQYA 3IGYB 1AJAA 3B5QA 4LRAA 3UN2A 3M8YA 4UPHA 3WBHA 3TG0A 4ZG6A 5HRTA 5L0BA 1ANJA 1N2KA 5KXAA 4UPLA 2W5VA 1E3CP 5LRNA 1EJJA 3WAWA 4N7TA 4GTXA 1E2SP 3NKNA 2X98A 4NWXA 1AJBA 1KH7A 1AJDA 2D1GA 3DPCA 3BDHA 4LRFA 3M7VA 2W5XA 4KJGA 4ZGAA 1AJCA 2W8SA 1EW9A 1KHJA 3IGZB 4FDJA 5L0KA 4UPKA 1ELYA 2QZUA 5LRMA 4MIVA 1ALJA 1E1ZP 1EI6A 3NKRA 4LR7A 3SZYA 1URBA 3MK0A 4UOPA 4LRCA 5DLTA 4KAVA 2GSUA 2RH6A 3BDGB 4LRDA 2IUCA 2XRGA 4CYRA 1ED8A 4UOOA 2GSOA 1EQJA 4CXUA 3WAYA 2GSNA 2W5QA 2ZKTA 3NVLA 1ANIA 3TWZA 1ALHA 3M8WA 1KH5A 2W5RA 1E33P 1O99A 2W5TA 3NKPA 1HDHA 5LIAA 5INHA 1AUKA 3LXQA 3CMRA 1ELXA 2W5SA 3MK2A 1SHQA 1ALKA 3MK1A 4B56A 1ED9A 4ZG9A 3UN5A 5IJSA 4KM4A 3OT9A 4UORA 3DYCA 2G9YA 4YR1A 1URAA 3E2DA 1ZEDA 5TJ3A 1HJKA 3NKMA 1HQAA 3UO0A 3KD8A 4NWJA 5GOVA 3WAVA 4CYSA 1EW8A 3ED4A 5DLWA 1KHKA 1KH9A 4LRBA 4GTWA 5C66A 3T02A 4KAYA 5L0EA 2W8DA 5DLVA 5EGEA 1Y6VA 1KHNA 2IUCB 3SZZA 3NKQA 4KJDA 4MHXA 1B8JA 4FDIA 4CXSA 1ELZA 4LR8A 3UN3A 1K7HA 2W5WA 4CXKA 2GA3A 4LREA 1P49A 3TX0A 5LQQA 5GRRA 3T01A 2IFYA 3Q3QA 5EGHA 5K4PA 1Y7AA 3M8ZA 3BDGA 1N2LA 4GTZA 1ZEBA 4MY4A 5AJ9A 1ZEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSU A;  4GTY A;  2VQR A;  4LR2 A;  3A52 A;  2ANH A;  3IDD A;  2GLQ A;  3BDF A;  1KHL A;  3T00 A;  4QAX A;  4LR9 A;  3UNY A;  1KH4 A;  2XR9 A;  4TN0 A;  3WAX A;  4ZG7 A;  1ALI A;  1EW2 A;  4UPI A;  1O98 A;  1SHN A;  3NKO A;  5IJQ A;  4LQY A;  3IGY B;  1AJA A;  3B5Q A;  4LRA A;  3UN2 A;  3M8Y A;  4UPH A;  3WBH A;  3TG0 A;  4ZG6 A;  5HRT A;  5L0B A;  1ANJ A;  1N2K A;  5KXA A;  4UPL A;  2W5V A;  1E3C P;  5LRN A;  1EJJ A;  3WAW A;  4N7T A;  4GTX A;  1E2S P;  3NKN A;  2X98 A;  4NWX A;  1AJB A;  1KH7 A;  1AJD A;  2D1G A;  3DPC A;  3BDH A;  4LRF A;  3M7V A;  2W5X A;  4KJG A;  4ZGA A;  1AJC A;  2W8S A;  1EW9 A;  1KHJ A;  3IGZ B;  4FDJ A;  5L0K A;  4UPK A;  1ELY A;  2QZU A;  5LRM A;  4MIV A;  1ALJ A;  1E1Z P;  1EI6 A;  3NKR A;  4LR7 A;  3SZY A;  1URB A;  3MK0 A;  4UOP A;  4LRC A;  5DLT A;  4KAV A;  2GSU A;  2RH6 A;  3BDG B;  4LRD A;  2IUC A;  2XRG A;  4CYR A;  1ED8 A;  4UOO A;  2GSO A;  1EQJ A;  4CXU A;  3WAY A;  2GSN A;  2W5Q A;  2ZKT A;  3NVL A;  1ANI A;  3TWZ A;  1ALH A;  3M8W A;  1KH5 A;  2W5R A;  1E33 P;  1O99 A;  2W5T A;  3NKP A;  1HDH A;  5LIA A;  5INH A;  1AUK A;  3LXQ A;  3CMR A;  1ELX A;  2W5S A;  3MK2 A;  1SHQ A;  1ALK A;  3MK1 A;  4B56 A;  1ED9 A;  4ZG9 A;  3UN5 A;  5IJS A;  4KM4 A;  3OT9 A;  4UOR A;  3DYC A;  2G9Y A;  4YR1 A;  1URA A;  3E2D A;  1ZED A;  5TJ3 A;  1HJK A;  3NKM A;  1HQA A;  3UO0 A;  3KD8 A;  4NWJ A;  5GOV A;  3WAV A;  4CYS A;  1EW8 A;  3ED4 A;  5DLW A;  1KHK A;  1KH9 A;  4LRB A;  4GTW A;  5C66 A;  3T02 A;  4KAY A;  5L0E A;  2W8D A;  5DLV A;  5EGE A;  1Y6V A;  1KHN A;  2IUC B;  3SZZ A;  3NKQ A;  4KJD A;  4MHX A;  1B8J A;  4FDI A;  4CXS A;  1ELZ A;  4LR8 A;  3UN3 A;  1K7H A;  2W5W A;  4CXK A;  2GA3 A;  4LRE A;  1P49 A;  3TX0 A;  5LQQ A;  5GRR A;  3T01 A;  2IFY A;  3Q3Q A;  5EGH A;  5K4P A;  1Y7A A;  3M8Z A;  3BDG A;  1N2L A;  4GTZ A;  1ZEB A;  4MY4 A;  5AJ9 A;  1ZEF A; 
#chains in the Genus database with same CATH topology
 2MZJ A;  4F0H A;  4V1A k;  1FJG F;  5IJQ A;  2DIV A;  1X31 C;  3DDN A;  3IFE A;  5HL7 Q;  4B3O B;  3R3T A;  4K8R A;  4DUY F;  3T5L A;  4UPK A;  3DLE A;  1HR0 F;  4C98 A;  2K06 A;  3BGR B;  1PC5 A;  3S6E A;  3CJ2 A;  4YME A;  2V69 A;  4PWU A;  1WF1 A;  1SVD A;  5DZ7 A;  2MDA A;  2OPQ A;  2YX7 A;  4FYY B;  4O3S A;  2GQC A;  4XK8 C;  4ZCM A;  3NBP B;  1FEH A;  4ATN A;  2W5R A;  2MQM A;  5IOL A;  2HYI B;  4KSE B;  4YR2 A;  3IRW P;  2X3D A;  2R2S A;  1SHQ A;  4CRJ A;  3CSK A;  1F5A A;  2MGZ A;  3PW5 A;  3W66 A;  1KVK A;  2H4W B;  1RHJ B;  4GRS A;  4FBT A;  1VQO S;  3ZZU A;  3OQ2 A;  4DR3 J;  1WD6 A;  3D2W A;  4M1K A;  4MT1 A;  1KKH A;  1VBY A;  4C8L A;  3BGF A;  4I2Q B;  2R42 A;  4QJV A;  2FZC B;  4IRK A;  2YKP A;  3IR7 B;  3K17 A;  2MKK A;  1JLE B;  2BAN B;  3DLK B;  2JHE A;  2UXC F;  3TO8 A;  1SKW A;  3V5R A;  2CJY B;  3T1A A;  1H0H B;  2XNQ A;  3MMA A;  1U0H B;  4V19 J;  4ETX A;  1GXU A;  1FRM A;  2W1B A;  4WFA Q;  5L0K A;  2C2R A;  2DNM A;  1C1C A;  1U6Z A;  2Z58 B;  3BDG B;  1O51 A;  2XSF A;  2HBR B;  3V4I B;  4ZVS B;  1PYT A;  4ECU A;  1QTN B;  2DHX A;  1FRJ A;  3OV7 A;  4JI2 J;  3L9Z A;  3PJX A;  1M5S A;  3IG1 B;  3M32 B;  2I1R A;  3VZI A;  2ZH4 A;  3VAK A;  1ACM B;  3WBZ A;  3AJ1 A;  4K4S A;  4W90 B;  1YHQ S;  4F50 A;  4IRC A;  2ZBI A;  2FY8 A;  1YVF A;  3MFI A;  1DHM A;  1RT2 A;  3KLF B;  3H0P A;  1IBL J;  2YNH A;  3EZU A;  1S9E A;  1WC6 A;  4USJ C;  1NBE B;  1RT3 A;  3PX0 A;  2C22 A;  3CIM A;  2ZZN A;  3BEG B;  4KKO B;  3OHB A;  4O3P A;  1HQ2 A;  1PG5 B;  2ADC A;  1RTH A;  1YI2 S;  2N4C A;  5K4P A;  4DG1 A;  1T9V A;  4ILR A;  1L3S A;  5A76 A;  1LWE B;  4M5K A;  2B9W A;  1APS A;  3OL9 A;  3TR5 A;  4AT1 B;  2LVW A;  3GIR A;  2LCW A;  2E5J A;  5G0R A;  4DMZ A;  2FUG 9;  4ZPB A;  3I4P A;  3TQE A;  2DD8 S;  2XZD B;  2WCX A;  2F1F A;  2JX2 A;  1FRK A;  3PG9 A;  1PSD A;  1QJH A;  2E5G A;  4YHH J;  2AGO A;  2JFK A;  1TV6 A;  1UMJ A;  4KGZ B;  4P7T A;  2EWH A;  4DQQ A;  2D41 A;  2DIU A;  4W92 B;  4MKB A;  3UCG A;  1PJ7 A;  4F0K A;  2XCA A;  4ED5 A;  3HD2 A;  3NP5 A;  3GFH A;  4CP5 A;  1JLQ B;  2J6U A;  1PIE A;  3QO9 B;  4ID5 A;  4EI2 A;  1T03 A;  2WRM A;  3CD7 A;  7AT1 B;  1SPB P;  3KLI A;  3RRG A;  1S49 A;  4USU A;  2RE1 A;  1MWZ A;  1RXO B;  1YK9 A;  1NJY A;  4RZR A;  1K1Q A;  1IBM J;  2DNH A;  4UZB A;  1IR0 A;  3N5F A;  3T3F A;  2G2O A;  4NMX A;  4DPU A;  2VFV A;  2DY1 A;  4Q5V A;  2K8G A;  3ZNJ 1;  2HEK A;  1RAC B;  1UA1 A;  3IWN C;  1OPZ A;  2J7K A;  2MLZ A;  2HFU A;  3A12 A;  2N82 B;  2NS1 B;  4ZPA A;  1ZEF A;  1FSU A;  3MMC B;  2DNP A;  3AQO A;  3D6M B;  2PD1 A;  1HBO A;  4K5S A;  4DV4 F;  2FVR A;  4F67 A;  5CXT A;  3MPU B;  1WEZ A;  5MAO A;  2BOA A;  4F2S A;  4TQR A;  3POT A;  2XQC A;  1QE1 A;  3QSI A;  4C0O C;  2POK A;  3VF0 B;  3THT A;  5F8M A;  3PZP A;  1OYD A;  3DI6 B;  2F63 A;  4LRD A;  3IR5 B;  5EWG A;  1IXK A;  2KM8 B;  3PIP Q;  3TX8 A;  3KUH A;  4MMO A;  2EFP A;  2OTL S;  3QRR A;  2KDO A;  4NI2 B;  3F0N A;  1SXL A;  2XY6 A;  1BQN B;  1HHT P;  5GOV A;  1S9G A;  1PJ5 A;  1I94 F;  2DNG A;  5KT4 A;  4YR0 A;  3EUN A;  2WHO A;  4TVA B;  1BE4 A;  3NOG A;  4I56 A;  2DNK A;  1VOM A;  1JLA B;  5E7O B;  3CUN A;  1BWV A;  2HFS A;  1HLW A;  1QSY A;  3C3L A;  1G7C B;  1JWW A;  1NSA A;  1EAY C;  2CQB A;  1R0A B;  2DR9 A;  2PFF B;  2CPD A;  3OTC A;  4YR3 A;  4OFZ A;  4C0B A;  4NLD A;  3M6W A;  4U9R A;  4PWW A;  4F8R A;  1IKW B;  3AA9 A;  3QGG A;  3PFO A;  4FDJ A;  1F1B B;  4BLG A;  4Q44 A;  4LFC J;  3GYX B;  1MML A;  3Q8P B;  2ZBQ A;  4O3O A;  1WOS A;  4Y28 C;  4MFB B;  3BQ2 A;  5FLX Y;  1UCN A;  1ZBT A;  2FJX A;  1WC4 A;  2RSQ A;  2MTL A;  4K4X A;  1R6V A;  2UXD J;  3OHA A;  2ZUA A;  2BJ1 A;  5ETL A;  4QW8 A;  3ZFV A;  5A8R B;  1JIH A;  1SJ4 P;  1L3K A;  2UUB F;  1FT8 A;  1NJI T;  3T41 A;  3TA2 A;  2H48 B;  3HSG A;  3VAG A;  5KT6 A;  2DXF A;  2VF3 A;  2R8K A;  4J9S A;  4R8U A;  1NHK L;  2XLI A;  5KT7 A;  2HQD A;  3OR2 B;  4URS A;  1BGX T;  2XHC A;  4HEA 9;  2QFI A;  2NXE A;  3DRP B;  3B82 A;  1O5J A;  3TVZ A;  4F2R A;  4ZVE A;  1ZAV A;  4FXV A;  1M0S A;  3DU6 A;  3HF5 A;  4RWX A;  4J9P A;  5DQI A;  2JDJ A;  1VRQ C;  3DOL B;  3OSN A;  1RAG B;  1Y3J A;  3ZZZ A;  2XRG A;  1S48 A;  3G96 A;  2DNR A;  3DRY A;  2HZA A;  2BRK A;  2VBW A;  2QSF A;  3OR1 B;  3IAM 9;  2EW9 A;  2F4F A;  4Y2I A;  1BWE A;  4M8L A;  2Y0S D;  2RH3 A;  2JWN A;  1RAH B;  3E51 A;  5BYQ A;  1KLM B;  3MEC A;  1FHT A;  3H2V E;  1CJV B;  4K2J A;  1S6P B;  4EBC A;  1J5E J;  1BLU A;  3MPV A;  1YBT A;  1B8J A;  1TL3 B;  2FLO A;  3GYG A;  3GCX P;  1RTD B;  3ET6 B;  3LP1 A;  3D0G E;  2PEB A;  3CO0 P;  3T9N A;  2KTQ A;  3ZNU A;  1X5S A;  4UQT A;  4LR2 A;  6AT1 B;  2PMW A;  3SFU A;  1JLB B;  3AHP A;  2V2Q A;  3JB9 k;  1NK8 A;  2PA3 A;  2ATL A;  4I0W A;  2IYI A;  4OYA A;  1V5V A;  2YQ1 A;  2ZH3 A;  2V8D A;  3CCS S;  5HRT A;  1U1K A;  1IBK F;  5KXA A;  2EFN A;  3HK2 A;  3NKN A;  1O0P A;  2QYG A;  1KLN A;  3UW1 A;  1KHJ A;  5KOW A;  1C1B B;  3G9C A;  5E5N A;  2DHS A;  2UUC F;  5D15 A;  4YUD A;  2V0N A;  5F9N A;  2OPS A;  4AXJ A;  3GJS B;  1FKO A;  1RJJ A;  3MM8 B;  4GKJ J;  2CPH A;  4LIW A;  1CJK A;  2O66 A;  2PGC A;  2KG0 A;  1CC8 A;  4JI3 J;  1UP1 A;  4KAI A;  3BN4 A;  1U8S A;  4NLX A;  3HXM A;  5B0C A;  1N0U A;  2QL9 B;  2WK4 A;  3P3D A;  2YNI A;  2ZVI A;  3NBP A;  4HDG A;  4F4Y A;  1CUL A;  3BSA A;  4DN0 A;  4M95 A;  2F4V F;  4QIV A;  4DV1 J;  2M5Y A;  4JB8 B;  1WC3 A;  3DM2 A;  2GVZ B;  4N41 A;  1PAE X;  1RAJ A;  5CZX A;  4R0J A;  2JNJ A;  2FZK B;  5CD4 A;  2ZHA A;  3TA0 A;  2CPX A;  2Y0B B;  2EK6 A;  1FXD A;  2MY7 A;  3OL8 A;  2XHW A;  1YDL A;  2IHR 1;  3K89 A;  3V2U C;  4JV5 J;  5M2P A;  1NJX A;  3FCV A;  1S97 A;  1UEK A;  4KAV A;  3QWP A;  1L3T A;  5KFQ A;  1CQM A;  2B5J A;  3ILI A;  1N5V A;  2ASL A;  2ILZ A;  3OVA A;  2EPI A;  3NKP A;  3A8E A;  3GG0 A;  2F8E X;  5G4D A;  4GMK A;  5LMU J;  3HJV A;  2RS8 A;  1XMQ F;  2ZBP A;  3H25 A;  3RR8 A;  3ZTO A;  1YJT A;  1YRU A;  2HNY A;  3OTB A;  4ZA1 A;  3HMJ G;  2V8P A;  3C6T B;  3ZZR A;  3I0S B;  3VAL A;  2HVE A;  1RP5 A;  1FX2 A;  3M32 A;  2R7S A;  4DV0 J;  4W4M A;  3A8K A;  4BWJ A;  2ZDO A;  2QC3 A;  4J9M A;  3FBF A;  2RDD A;  3D0H E;  3KLF A;  1JNR B;  3HHL A;  5ADZ A;  3TZZ A;  3WAX A;  4RNM A;  1VBK A;  3WX8 A;  1WNE A;  2ZE2 B;  1NH8 A;  1VQ8 S;  3BYP A;  2HHV A;  4RW8 B;  1N54 B;  1TMM A;  2IMO A;  1QVG R;  3CCW A;  4CLT A;  2VJU A;  3OJU A;  1HFE L;  4RU2 A;  1Q79 A;  4HHJ A;  4ZIT A;  1WJ9 A;  5HAT A;  1H2T Z;  4ZLP A;  4K59 A;  2QT7 A;  2G9O A;  3EGV A;  1MSW D;  5J2N A;  2W2M P;  4U8Y A;  2GCF A;  3BGO P;  1WKK A;  1HDH A;  5KFU A;  1LEO A;  1Q82 T;  2DT9 A;  4WFN Q;  4RR5 A;  2XUL A;  2DVI A;  3E3X A;  4DU7 A;  3NMR A;  4A8M P;  3CW2 C;  3MM6 A;  5DM6 Q;  3KNA A;  3OTD A;  5K8P A;  2HMI B;  2L48 A;  4PWD B;  4OYI A;  4NXM J;  1KHN A;  3JAM U;  2O01 C;  1JJ4 A;  2QRR A;  1XR6 A;  4E0D A;  1TVR B;  5H9E J;  2GHW A;  3G87 A;  3FMW A;  3W8P A;  3DCA A;  2NXC A;  2YNF A;  1X9W A;  4KHP J;  3ZZP A;  1MN7 A;  1S57 A;  4X4N A;  3BPD A;  2BJE A;  1FTR A;  3ZC4 A;  3NGS A;  1D9A A;  3NEK A;  1AW0 A;  1JLG B;  1YQH A;  3QYY A;  1MU2 B;  2QA1 A;  3CD6 S;  3MMC A;  3NCP A;  1RUS A;  2DO4 A;  2RRN A;  2CQ2 A;  1F5C A;  4WFY A;  4W98 A;  5DDQ C;  1D9F A;  3M2U B;  4OHY A;  2KYZ A;  2ZOG A;  4FPR A;  2MQL A;  1FWK A;  4KC5 A;  2OFH X;  2HSE B;  4HHU A;  3HO1 A;  3N6L A;  1S77 D;  3HFV A;  4B3M J;  4YB6 A;  3VWS A;  1DBD A;  2A2D A;  2MKS A;  2Z57 B;  1Z2L A;  3OFG A;  2YQ0 A;  4KAY A;  4X4S A;  4K7Q A;  3T5J A;  4ZVU B;  1H73 A;  4MIW A;  1VQL S;  2OEL A;  3MD1 A;  1BQN A;  1B0P A;  3T00 A;  1DJ0 A;  2FQQ B;  2ZH6 A;  2NR0 A;  4U96 A;  2UUA F;  3SXL A;  3KHG A;  2BQ3 A;  1SQG A;  4P52 A;  4B9U A;  4DV3 J;  1Y10 A;  3BZQ A;  3VGS A;  1KN6 A;  5F0W A;  3GB0 A;  1VS3 A;  1R8H A;  3WIU A;  1JLA A;  1FCA A;  3EJM A;  3D9B A;  4I69 A;  3ENQ A;  4J7C A;  2BAC A;  5HMY A;  1R0A A;  4B9T A;  4CTA A;  4DS4 A;  5KFJ A;  3ZTQ A;  1PO6 A;  3S8S A;  3M9M B;  2X51 A;  3HD1 A;  2CNO B;  1ZM4 A;  4B56 A;  1OY6 A;  2GQ2 A;  2D9O A;  4YR1 A;  4PQA A;  3W2V B;  3G86 A;  4LF9 F;  5F8N A;  2YNG B;  3I0R A;  4KYZ A;  3KLG A;  3T02 A;  1F3F A;  2B9E A;  1NB7 A;  1U1P A;  4B3R J;  5L8R C;  2L9W A;  2MMY A;  4OI6 A;  1RSC A;  4NAS A;  1WOO A;  5ETP A;  3T6B A;  2Q6B A;  3BBC A;  3V6D A;  3MDF A;  2GJ2 A;  3A4T A;  3EGW B;  1SL0 A;  3K5M A;  1X7V A;  2MKY A;  1YKW A;  2VA3 A;  4CM0 A;  3NGK A;  3UN2 A;  3TG0 A;  3HVA A;  1LFP A;  4EYI B;  1C4A A;  4HVZ A;  3J7Y U;  1KH7 A;  1Y3K A;  4DL0 C;  3OR2 A;  3MCN A;  1DTQ B;  3C15 A;  2HND B;  5KG2 A;  5I3P A;  5I42 B;  2CQ0 A;  4X65 J;  4WFZ A;  2MZR A;  4NA2 A;  4MKY A;  2CDQ A;  1AA1 B;  4EGL A;  1DAX A;  4WTO B;  4LFA J;  4OZJ A;  1S6O A;  1U49 A;  4CT9 A;  1HBM B;  4O44 B;  2EFG A;  2EI5 A;  3BO2 A;  5F41 A;  4WF9 Q;  4L6V 3;  3IO1 A;  1KH9 A;  1DAR A;  4DR5 J;  4X66 J;  2KT5 A;  4DSJ A;  4O0I A;  2BYC A;  1P27 B;  1HNV A;  1YGY A;  2FC8 A;  4CLU A;  1N52 B;  2BJ9 A;  3R2C J;  2N7Y A;  2ZUG A;  2XNR A;  3D1H A;  5K14 B;  4P72 A;  4KT0 C;  3MFH A;  4KTQ A;  2LDI A;  3T1Y F;  2E66 A;  2VZ9 A;  3SBM A;  1TMJ A;  2GFF A;  4OJ1 A;  5BYS A;  3TQ1 A;  1RIS A;  1HBU B;  2ACY A;  3P8B B;  3HSZ A;  4WJB A;  1IWA A;  2ZVS A;  3O5T B;  2LLZ A;  3IRX A;  1HNX F;  4N7T A;  3U7J A;  3OXG A;  1RTD A;  2HW3 A;  1PC4 A;  2P5V A;  2CJX B;  4NRU A;  3QSY B;  3Q89 A;  2I5J B;  3CJ4 A;  3K5O A;  5EX3 A;  4A8W A;  3ILO A;  5HQL A;  1R6Y A;  2OEJ A;  5KOX A;  3K0J A;  4N8N A;  4CLP A;  2VDH A;  1CJU B;  2BE2 A;  1UWB B;  2HBZ B;  4X64 J;  4P6Q A;  2V2V A;  1FKP B;  1FFG B;  1WHY A;  4GVB B;  1OSC A;  3NGU A;  1GX6 A;  3K7R A;  2CJQ A;  3FRY A;  3I31 A;  3GIJ A;  3CCE S;  4RL1 A;  3HI9 A;  4LF6 F;  2PI5 A;  2ZDP A;  3MM8 A;  2WVD A;  1RQ0 A;  3GV7 B;  4PXB A;  4K0K J;  4Q8E A;  2VB6 A;  1U25 A;  3W5Z A;  5LXY A;  3KHH A;  3GJR B;  3EGZ A;  3AT1 B;  5AJ9 A;  4IRD A;  2WTF A;  1FA0 A;  4C8O A;  4ZIW A;  4LBP A;  4RNH A;  4ZN1 A;  3JSB A;  2H54 B;  1Y4Z B;  5IT0 A;  5AE1 A;  3HDS A;  4OX8 A;  4IFV A;  4HTJ A;  3P6Y C;  4IO1 A;  3DU5 A;  4DUY J;  2YH0 A;  2HG4 A;  1HKA A;  2M7S A;  4E8U A;  4EYH B;  2CQP A;  5KFX A;  4GC6 A;  4DL3 A;  3A3N B;  4HH1 A;  2LXU A;  5C42 A;  1U1O A;  2R8G A;  1A0O B;  1H7W A;  3CCQ S;  2R7R A;  4Z7Y A;  2R7V A;  1N34 J;  4Q0B A;  2HFZ A;  5INH A;  4TLQ A;  2XMK A;  5DGB A;  3I9Z A;  2DY9 A;  4RBV A;  1IBC B;  1FNX H;  3BKU A;  2RHQ B;  3M8P B;  3BBF A;  1RI7 A;  1NM2 A;  2C2E A;  3H42 A;  4X84 A;  2K7K A;  2BBE A;  1Y6V A;  2Z56 B;  3V81 B;  4ZP7 A;  3U1M A;  2EFO A;  2KVI A;  3D0I E;  3OXL A;  4X4V A;  2EFV A;  3MZI A;  3QGH A;  2NXU A;  3AXK A;  1U4B A;  2YWG A;  2LEB A;  2XMW A;  1YRT A;  2V9K A;  4C0H A;  4DQS A;  4ES1 A;  1W2B R;  5C25 A;  2HIQ A;  1SJF A;  2ZWO A;  1UW4 A;  5L1I A;  3HHD A;  3I4H X;  4HH0 A;  1HQE B;  4DX5 A;  4N47 A;  5HQM A;  5LRM A;  4HI1 A;  4LF8 J;  5KT3 A;  4DQP A;  5L1L A;  4DSF A;  1TL5 A;  2CKW A;  1UFW A;  2IRX A;  1U48 A;  4FKX A;  1LW0 A;  4F7V A;  4QYZ K;  3QZ7 A;  2VFS A;  1EQ0 A;  2QA4 S;  1T95 A;  2FVS A;  2ZWP A;  1Y0H A;  3SI8 A;  5BR8 J;  2HGL A;  4DR3 F;  2JC0 A;  5H1S V;  2LQB A;  5DM7 Q;  1FK9 A;  3UDC A;  4I6W A;  2BVZ A;  4JV1 A;  1P9Q C;  4OHZ A;  1VQS A;  4QW9 A;  1ICE B;  4QCL A;  2R2T A;  2AF6 A;  2CNK B;  2HBY B;  2WOM B;  3RW6 A;  3T5H A;  4P73 A;  2Z2L A;  3CJR A;  4PRF A;  3J81 U;  1SL1 A;  1LWC B;  3GWC A;  1FVS A;  3IR6 B;  1IUJ A;  4NLR A;  3NWG A;  1NPK A;  3CNQ P;  1TAU A;  3DDK A;  2GW8 A;  2IAJ A;  1M1G A;  1HD1 A;  3PEJ A;  3VAI A;  3DRS A;  3AJ2 A;  4OYO A;  3PYF A;  2QX0 A;  4ZVQ B;  5CD4 H;  1N2K A;  4BS2 A;  4UQG A;  5DS7 A;  1JQG A;  1TVR A;  4TKT A;  4C48 A;  3BPS P;  4JI2 F;  4NX9 A;  4WYL A;  4H4M B;  3PDN A;  2I0X A;  4IOC Q;  2F65 A;  2X1F A;  1RT7 A;  3ISZ A;  1Q95 G;  2ZJQ Q;  2FVP A;  3PFE A;  2DPI A;  1MN9 A;  3R9L A;  3WC2 A;  1IBL F;  1EP4 A;  2BUN A;  2IA0 A;  2B7B B;  5KFY A;  3CCT A;  1DUR A;  4UUX A;  3SFG A;  4Y65 A;  3KNG A;  1JJH A;  2IRY A;  3WAV A;  2DJW A;  4U67 Q;  2GS8 A;  4A8F A;  1IKV B;  5C5J A;  4TY9 A;  3D6H B;  2H51 B;  3OFF A;  3GFX A;  2X1A A;  1RKI A;  2PFD A;  2OHD A;  1FVQ A;  4OZN A;  4OYW A;  4B3S J;  4O4G B;  4G1P A;  2W2N P;  2P9G A;  4ES3 A;  2MEW A;  5ETQ A;  4UPI A;  5A2Q U;  2XB2 D;  4YHH F;  4A8X A;  3B5Q A;  1MG7 A;  4XDC A;  1Q7Y T;  4L72 B;  3ZTS A;  1RE1 B;  1XNQ J;  2Q3P A;  4JBC A;  3UR3 C;  1ZA2 B;  5H9F K;  2XWY A;  3DYA A;  3K5N A;  3FEX B;  5L9N A;  1M5H A;  3GCW P;  4WIQ A;  2WSF C;  2CQI A;  1R0C B;  3M2R A;  4BBY A;  1WI8 A;  2CYY A;  1O8B A;  1IBM F;  3WAY A;  1FRX A;  1NKB A;  4QPT A;  2R3V A;  4ZVG A;  3VAH A;  4CO4 A;  1HWI A;  3FSI A;  3HJF A;  5DGA A;  4QWE A;  4OYP A;  5AE3 A;  4RLE A;  4S0M A;  4ZOS A;  1NSP A;  4IDK A;  5AXL A;  2H9Z A;  4A8S A;  3KG0 A;  1TUV A;  3QQC D;  4R5P A;  5LSL A;  4WE1 B;  1UW9 A;  1F60 B;  3GPA A;  2G4B A;  1WC1 A;  3VAF A;  2BKO A;  1TK0 A;  1V3R A;  3CJT A;  1FFS B;  4PUO A;  1P49 A;  3N28 A;  4FVM A;  4CLW A;  3Q3Q A;  1RLD A;  1RHM B;  3LUY A;  3K58 A;  3T1H J;  4M5I A;  1LV5 A;  2M9K A;  3HKW A;  2DHG A;  4DF8 A;  3U27 A;  4URG A;  1NPP A;  3LF0 A;  3M8Y A;  2GC8 A;  4X4R A;  4HT7 A;  3B54 A;  3BO3 A;  1CLF A;  2ACM A;  3NNA A;  4WU3 A;  1J5O A;  1REV B;  2ZKU A;  3RW7 A;  3SDE A;  3JSR A;  1VQN S;  2CVE A;  3CJK B;  2MJU A;  3TI0 A;  4J5O A;  4DZD A;  3M9N B;  3SCL E;  1SH3 A;  2IRU A;  3JAM Y;  4NCG B;  1WHV A;  3RG6 A;  4MK9 A;  2M0G B;  3EDQ B;  3FQL A;  3A8J A;  1LW2 B;  2QFJ A;  1YJN S;  1ELX A;  1HWU A;  3FEY B;  4YY3 J;  1DTQ A;  4Y2A A;  4B17 A;  1HNI A;  3D7S B;  2C42 A;  1HQA A;  1OJ4 A;  4ZPD A;  5AJ3 J;  4CYS A;  2FZG B;  2FD2 A;  4LF7 J;  1PYS B;  1GX5 A;  3KJF B;  2YY3 A;  2IFY A;  1NND A;  3GQC A;  4HI2 A;  3PRD A;  1EB0 A;  1N36 J;  1XMO J;  2DIT A;  4FN5 A;  1VHI A;  4LFC F;  3QAE A;  2O3D A;  4DR6 J;  2KJW A;  5HVG A;  3SQO P;  2KXF A;  3BKT A;  4UPH A;  4WP8 A;  2MLY A;  2A1B A;  4ED2 A;  3P96 A;  3BM7 A;  2ZD1 A;  4X2B A;  3G82 B;  1S1X A;  3KG1 A;  4LRF A;  2UXD F;  2EBG A;  4PXC A;  4NLS A;  1FJC A;  1WTF A;  5KG3 A;  3W2W B;  3JQJ A;  3C6U A;  3RYL A;  4A48 A;  1DLO A;  5IM0 B;  3ENA A;  4F3Q A;  1UTA A;  5A8K A;  1QSS A;  2CVI A;  2ZH2 A;  3EVW A;  3VGU A;  2HQG A;  2FHJ D;  4DPY A;  4K4U A;  2KJV A;  1RT5 B;  2QMX A;  5J1N A;  2BX6 A;  3N01 A;  5ETR A;  2L9D A;  3HCX A;  4KGM A;  2VBX A;  1YJ9 S;  2W8D A;  1F2H A;  3I87 A;  2KB2 A;  3LTO A;  3DMJ B;  2AX1 A;  1UWB A;  3TX0 A;  4A47 A;  4U7U D;  2CXE A;  1KQF B;  2YKO A;  4DV7 F;  3GU0 A;  4KPC A;  5CCM A;  4EBE A;  3SSR A;  9ATC B;  4J9K A;  2BJ7 A;  2MB0 B;  1T3N A;  2OLW A;  4ZG7 A;  3OW2 R;  2YWE A;  2HQF A;  1IBK J;  4IKA A;  2BW7 A;  1U47 A;  4F3O A;  3R27 A;  1M90 T;  2VIH A;  1H98 A;  1DZ5 A;  1RCO B;  1TZ0 A;  2GO8 A;  1S1V B;  1NKE A;  1EKS A;  2K3K A;  4X4O A;  3EXY A;  2MKH A;  1OY8 A;  2BJ3 A;  1SV5 A;  2FC9 A;  2UV8 G;  2J6S A;  2R7U A;  1OO0 B;  3PW4 A;  2M4M A;  4OZL A;  4FP9 A;  5M2U A;  3DXB A;  4C7Q A;  5I4M A;  3KFW X;  2Y1I A;  2HS3 A;  4DX8 H;  4B3T F;  3PRV A;  2KU7 A;  3CDW A;  1DTT B;  4CO0 A;  1TEL A;  1IQT A;  4DV6 J;  4I67 A;  3A8I A;  1Q0N A;  1JKH B;  1TUW A;  4CYU B;  2UXB J;  3R8Y A;  5CYJ A;  3M8P A;  3MCS A;  4CH7 A;  1N33 J;  4H4O A;  3C16 A;  5J1E B;  1O98 A;  4N5S A;  3CDU A;  3JXO A;  5KG0 A;  3OSP A;  5HRO B;  3PAC A;  3R7B B;  5IQ6 A;  1UKU A;  4GKJ F;  4USH A;  1HBN A;  3BF4 A;  3AB2 B;  5ETV A;  3R97 A;  2HGN A;  4EMD A;  2IBK A;  4CYR A;  1QDU B;  2RT3 A;  3M2V B;  3US5 A;  2OH2 A;  2RU9 A;  4JI3 F;  2D3U A;  4ECV A;  1TK5 A;  2Y3Y A;  1KTQ A;  3TUJ C;  3EVO A;  4PPZ A;  3EDR B;  1XMQ J;  2PII A;  2G9Y A;  3CXC R;  5B7W A;  4HDH A;  1DY3 A;  4DV1 F;  3QT6 A;  1D8Z A;  3MCM A;  3H98 A;  2XMV A;  3DLE B;  5DQG A;  2MSS A;  5DG7 A;  1M5O C;  3AA8 A;  1UZH A;  1PCA A;  1IM4 A;  3Q8R B;  3VAJ A;  1UVN A;  4F3M A;  2EFQ A;  3J81 j;  2EG1 A;  3DLH A;  5KT5 A;  4JV5 F;  2MGZ B;  4FXW A;  4ED8 A;  4I64 A;  2QMU B;  5B0E A;  3RB6 A;  4B02 A;  1QM9 A;  1KTV A;  2E9Z A;  5KT2 A;  4OZ0 A;  3B6B A;  4LBH A;  4NEZ A;  4FF2 A;  1HHQ A;  3AFG A;  2BRL A;  4QPX A;  1HW8 A;  4KQZ A;  1X0F A;  2E7X A;  2LQJ A;  3LWM A;  1S9F A;  1VQ7 S;  2GSU A;  5B09 A;  1AZS A;  1FO1 A;  5LMU F;  1NK6 A;  3PYD A;  2RQ4 A;  4QIW D;  2EXU A;  2XZT B;  2GSO A;  1YRX A;  4AFF A;  3RBD A;  2AZ3 A;  4QBU A;  4FZV A;  1E33 P;  4OZ5 A;  2B4V A;  5KTQ A;  3MMA B;  2NSB A;  1IWG A;  3GJT B;  4G6V B;  2QLB B;  3LAL A;  5T41 A;  2XI2 A;  2KHC A;  3ADA C;  3CUL A;  2J6T A;  3FBC A;  1TP7 A;  1TL1 A;  2VKZ G;  2L08 A;  1C1C B;  4O3R A;  2DR7 A;  1S12 A;  4GTW A;  4Q2L A;  2BR0 A;  1HI0 P;  4DL2 A;  2UU9 J;  5GVQ A;  1U7L A;  1YG0 A;  1Z4U A;  1U1L A;  2LYV A;  4KHR A;  3DOM A;  4IQX A;  4GTZ A;  2XMU A;  1FI4 A;  4JI6 F;  3VTI A;  1UVJ A;  2H4Y B;  1YBU A;  4ICL A;  3LWL A;  3FEZ A;  1SHN A;  2MKI A;  1RT2 B;  2RIL A;  3MTK A;  2YNH B;  1S9E B;  3P4U B;  2WSC C;  2CQ4 A;  1U0S A;  2C1E B;  3HZG A;  3PIO Q;  4HTI A;  4C8K A;  4O4R A;  2QGF B;  4MIV A;  1RTH B;  3HLU A;  1B0V A;  2JEI A;  4CLL A;  3Q8U A;  1BQM A;  3SMZ A;  5GAE I;  3BRE A;  1TKT B;  4OI3 A;  4ANC A;  4KV8 A;  3AXM A;  4RBU A;  3C8Y A;  3UNG C;  1F2G A;  2PE8 A;  3EGN A;  4NXM F;  5CQG A;  4C3M A;  1OQ3 A;  3TEH B;  2AHO B;  2AEF A;  1VFJ A;  2HS4 A;  1CVJ A;  3MTJ A;  2DNO A;  2MQQ A;  1TV6 B;  4KHP F;  3HHN B;  4FNH A;  3D3B J;  5C24 A;  3OLB A;  3R6G B;  1NSQ A;  3W62 A;  3FMB A;  3FNN A;  1JJC B;  4UW2 A;  2AGQ A;  3KLI B;  4P2S A;  1UJ4 A;  2ZZT A;  2J0X A;  3LGM A;  3WIV A;  4L3K A;  4CO3 A;  1KRP A;  3RB3 A;  2XWX A;  2OJ3 A;  1OPI A;  4P2X A;  1F6T A;  3S7R A;  4BCA A;  1S0M A;  1WEY A;  2CWK A;  2QE5 A;  2WBR A;  6FD1 A;  1E1Z P;  1KD1 T;  3MK0 A;  1NME B;  1WDT A;  1FJE B;  4B3M F;  5SUH A;  5JMN A;  1HBO B;  2JH3 A;  4ANE A;  2NYH A;  5A8W A;  2YBV A;  5DLF A;  4JI4 J;  1QE1 B;  1SKU B;  2RQK A;  2EG2 A;  1R7I A;  3K8W A;  1NK7 A;  1U6F A;  2NLW A;  5K8O A;  5C66 A;  5B0A A;  2PC6 A;  3ETM A;  1LW2 A;  1N0V C;  2VQE J;  4FF3 A;  1M5K C;  2R8H A;  1Y7A A;  4MY4 A;  1VRU B;  2NSC A;  1VMB A;  2KT2 A;  4KFB A;  5DLG A;  2NQP A;  4N77 A;  1E6Y A;  3MEE A;  1S9G B;  1QAY A;  3L7O A;  4FYV B;  3SV4 A;  4FNI A;  2MZT A;  3A3O B;  4WXW A;  1RU1 A;  3Q2S C;  2MXY A;  2D3Z A;  1BUX A;  5HP1 B;  4DUT A;  3HX9 A;  2XMM A;  1ZS6 A;  3GSI A;  1VQ5 S;  3KLV A;  1YJ7 A;  2DNQ A;  1VJQ A;  3MCO A;  3N0V A;  5KFH A;  4TQS A;  1VQY A;  4PG4 A;  4B3R F;  3I32 A;  4L73 A;  1M1K T;  3MPD A;  4Y00 A;  1VBZ A;  1MRO A;  2DGW A;  3TAM A;  4U8V A;  4ELV A;  1U8W A;  2I8E A;  2YVS A;  2K3I A;  2M70 A;  2XMT A;  4LRB A;  2QA4 G;  2QZ8 A;  1AB8 A;  1OSD A;  4NLG A;  2J7U A;  2VA2 A;  2KRR A;  4DR2 J;  4OHX A;  3PNI A;  2C2O B;  4CLS A;  3HHK A;  2CDR B;  1CG2 A;  4DZ6 A;  4IH5 A;  2VJV A;  1RAI B;  2GVD A;  3WC0 A;  4DCP B;  2IVY A;  3SIP B;  2VFT A;  2GJF A;  1NJW A;  5EGY A;  3KK1 A;  2E5H A;  1F9H A;  4MAK A;  4DV5 J;  2RNE A;  1HNX J;  4ZCL A;  4X65 F;  1I1G A;  2J0W A;  3TAP A;  2VG6 B;  3ONQ A;  2IJF A;  2CRL A;  2QO3 A;  1ZA1 B;  5CCL A;  4F25 A;  3UDE A;  3BBB A;  1K44 A;  4LFA F;  1SUQ B;  1VIX A;  2KFZ A;  3BKF A;  3JQM A;  3DOK B;  1S0N A;  3KLE A;  4NRT A;  1LXJ A;  4DR5 F;  3N9U C;  1BY9 A;  1C0U A;  3GII A;  4LF6 J;  1EW8 A;  1XR5 A;  4Y6I A;  5EGE A;  1Y9O A;  2CPE A;  1EIY B;  4FDF A;  1YJW S;  5DDO C;  4RWW A;  3TEG A;  2J9D E;  1DQ9 A;  2M88 A;  1REG X;  3OTE A;  1HI8 A;  7FD1 A;  1S5Z A;  4NLV A;  1H7X A;  3RRK A;  5ETM A;  3E8O A;  1KH4 A;  5AE2 A;  4DL4 A;  2E44 A;  1I51 B;  2HHU A;  3MEC B;  4XPC A;  4PYA A;  4ZG6 A;  1KFS A;  3R5B A;  3ENV A;  3RRH A;  2AU0 A;  2XLK A;  2D69 A;  2VG7 A;  3D4J A;  5CAB A;  3ZO7 A;  3LP1 B;  4YDX A;  4LRC A;  2IDL A;  2YX1 A;  2NZC A;  1CJT A;  1YLX A;  3FFI A;  2KZZ A;  4U7C A;  2DR6 A;  1NK9 A;  1WHX A;  2JJ4 D;  4CLF A;  2V67 A;  3DLJ A;  2OP5 A;  4WCE Q;  4K0K F;  3UN5 A;  5D8H B;  3PRB A;  1WKJ A;  3TJ8 A;  3JQK A;  4H4K C;  1N32 J;  4M5H A;  1J27 A;  1ZOT A;  5E2Q A;  5E0O A;  2I2Y A;  2DTJ A;  3M2V A;  2CAJ A;  5KFR A;  4QR2 A;  2H5E A;  2OPS B;  3NNH A;  4F36 A;  1FKO B;  4EK2 A;  1RB0 A;  5GRR A;  5A6W A;  3TZY A;  1S7I A;  1SQF A;  4OX7 A;  2JFD A;  1CJK B;  5T14 A;  3KMS A;  1N2L A;  1NK4 A;  1RT4 B;  2CIM A;  3FVY A;  3K59 A;  3QJP A;  4OL8 A;  3MM9 A;  2CQG A;  3OVB A;  2BM1 A;  4IUF A;  2A6O A;  1C4C A;  3NLC A;  2OTJ S;  5DO2 A;  3QAT A;  4UOG A;  1G2E A;  2W5V A;  1H2V Z;  1PBU A;  4LVO P;  4KPY A;  2YNI B;  2PEH A;  3FSY A;  1N34 F;  5F3Z A;  5KFW A;  3G8Q A;  2AX0 A;  4PG7 A;  1CUL B;  5CYM A;  3NWR A;  4LMZ A;  1AXQ A;  2ZOF A;  4LSL A;  1LXN A;  2X1B A;  3DM2 B;  1S6U A;  3ICL A;  1VC6 A;  3KJN B;  1Y5N B;  1RHQ B;  4B08 A;  5LSO A;  1C0T A;  5HSP A;  2OIH A;  3B4M A;  2MHE A;  6FDR A;  1L3U A;  4IYQ A;  2ZJP Q;  2AJ0 A;  1D1U A;  4NWB A;  2GIQ A;  3ZXW A;  4QU6 A;  3RZA A;  1S6Q A;  2E1A A;  3H2L A;  2B56 A;  4B9M A;  2EVZ A;  2YXL A;  2MQO A;  1VRT A;  2B5J B;  3UD3 P;  1RAB B;  1FNM A;  4RW7 A;  1WC5 A;  5LQQ A;  2FJD B;  4C8Z A;  3PEH A;  3T6J A;  4ZP8 A;  2A3J A;  2YKN A;  2XTJ P;  4KO0 A;  3BQ0 A;  2R2R A;  4LF8 F;  1EW2 A;  3O6Q A;  1N5T A;  1YJR A;  4ER8 A;  1VC5 A;  2BW2 A;  2LP4 A;  1K0T A;  4M5D A;  3PVX A;  2HNY B;  1E2S P;  3R6L B;  2YH1 A;  2D1G A;  1H6K X;  4OYX A;  2EKY A;  2LQ5 A;  1S0O A;  2W4C A;  4DPO A;  4ETZ A;  5BR8 F;  3QT5 A;  1P9Y A;  2EC2 A;  2HWH A;  4NLO A;  2HRT A;  2VL1 A;  4DSK A;  3SV3 A;  2HUR A;  4A8Q A;  4I7F A;  3HHL B;  3M8S A;  2ZBR A;  3PX6 A;  1H74 A;  3PW7 A;  3KJQ B;  4P2M A;  3MUM P;  4G1Q A;  2XY7 A;  4ZLJ A;  4QIF A;  2HFV A;  3I82 A;  3MOZ A;  4OV6 A;  4MYT A;  1FRL A;  5J2P A;  2PMH A;  2YWF A;  1TKT A;  2DCU B;  5IV4 A;  2FJW A;  3NGT A;  3P5B P;  2CJK A;  5J2N B;  3ILJ A;  4ZP9 A;  4ZLL A;  1R0B G;  2F9J A;  1VQM S;  4N8O A;  3CMQ A;  1XC9 A;  2B8Q A;  1T9X A;  3MM6 B;  2MJN A;  3GIL A;  4ZS6 A;  1PGZ A;  3AJD A;  4PAA A;  2QL5 B;  2ILY A;  3T19 A;  3SZ2 A;  1MWY A;  2BKN A;  2YNF B;  3OLA A;  2DEJ A;  2PN6 A;  4MKV A;  1JXL A;  3TWZ A;  4DFK A;  3HZE A;  4RW4 B;  2HHQ A;  4RW9 A;  4CO2 A;  2BA9 A;  5ETT A;  3UE2 A;  1G1X A;  1DQ8 A;  4MK8 A;  1KVI A;  3UFC X;  3SEO A;  4B3S F;  1UA0 A;  2JEG A;  5D4N A;  1TFW A;  1R8B A;  3CCL S;  2HZV A;  4ECW A;  3NKQ A;  1GEH A;  3OJS A;  3LPY A;  4BC7 A;  2SXL A;  4PG6 A;  4K4Z A;  5D4O A;  3KK3 A;  3TJ9 A;  5JVG Q;  2ZH9 A;  2YKQ A;  4AL7 A;  2IM3 A;  1XNQ F;  3GV8 B;  2WB1 D;  2HHX A;  3IN5 A;  1GNK A;  2X3G A;  1GFW B;  3AB4 B;  5HLF A;  5KFP A;  4PPD A;  2DIS A;  4URQ U;  1FDB A;  1F5B A;  3W3S A;  1NJZ A;  2PDA A;  1URR A;  5LJ3 Y;  4OZ1 A;  2KZM A;  4I2P A;  3GTY X;  3QID A;  3DPC A;  2L41 A;  2HHW A;  2EC0 A;  1VRU A;  2JSX A;  2V4Q A;  4NXN J;  3D5M A;  4RPF A;  3KDO A;  3MM5 A;  3MED A;  4QOT A;  2HAI A;  1Y5L B;  5HI7 A;  4PXD A;  2M8H A;  1U09 A;  5C2G A;  3PHE A;  4WBF A;  3FK4 A;  4DX6 A;  1U2F A;  5KFS A;  2V63 A;  5J2M A;  5HP1 A;  4ZVR B;  1OY9 A;  3GSD A;  3T1H F;  1PKU A;  2RB7 A;  2HPU A;  3W60 A;  2VBZ A;  1U1N A;  3BH7 B;  4LR8 A;  4CTA B;  4DL5 A;  1XIQ A;  1Q5V A;  3M4X A;  3RBE A;  5EN1 A;  4Q45 A;  4DDF A;  1JK9 B;  2MY8 A;  2ASJ A;  3SYZ A;  4LJM A;  1JXV A;  1XNR J;  2PI4 A;  3I0R B;  4C97 A;  2BKP A;  4HT5 A;  1R27 B;  3KLG B;  3GFY A;  1K1S A;  2N4D A;  3O8W A;  3P49 B;  4ZCK A;  1KP6 A;  1I5O B;  3HFZ B;  2XLJ A;  2OD4 A;  1KS2 A;  2DXD A;  1ZTT A;  3H5S A;  5D4L A;  4LF1 A;  2UVR A;  2EBE A;  1VQP S;  1N5S A;  4ZPT R;  4DCO B;  5EUH A;  3V6D B;  4YY3 F;  3R5C A;  5B0G A;  1FDN A;  3ITH A;  2XCP A;  3VVU A;  5AJ3 F;  5KG7 A;  2VD3 A;  2JZ5 A;  1FTC A;  2CPZ A;  3KDN A;  3L7P A;  3N4W A;  2VG6 A;  2YKM B;  4Y0F A;  2WVE A;  2FJV A;  4LF7 F;  2WON A;  4ZG9 A;  2K1R A;  4PXE A;  1Q78 A;  1T9W A;  4C8N A;  1NKC A;  1SUQ A;  3KUE A;  2OO4 A;  3MR5 A;  1N36 F;  1XMO F;  2P8I A;  1GTE A;  3C15 B;  1WHW A;  3DOK A;  4RNF A;  2CQC A;  1LNQ A;  1RDR A;  2BJD A;  4OQJ A;  1UEV A;  3QLH A;  2R4F A;  4DR6 F;  4DX7 A;  1VLY A;  3ETO A;  4DV7 J;  4JYA J;  2ZEJ A;  4YOE A;  2V34 A;  2AYB A;  4DR4 J;  3QFW A;  1ZH5 A;  1Q53 A;  3MOJ B;  4RW6 A;  2XR9 A;  2W2O P;  3SQG A;  4DJB A;  2BXJ A;  1ANJ A;  1RT6 A;  4HAC A;  3CJ8 A;  4IFY A;  4IG3 B;  2GGP A;  4IOB A;  3JSM A;  3P5T L;  1ZAX A;  3ILL A;  1HNV B;  4L76 A;  3MR7 A;  3GP9 A;  4NLY A;  4TY8 A;  5A0Y A;  4LR7 A;  2I38 A;  3PCO B;  4DPW A;  5IWA J;  1XER A;  1K9M T;  5L46 A;  3N6M A;  3BDE A;  2C2D A;  3ENW A;  2AJF E;  3LGH A;  3UWT A;  1ANI A;  1DRZ A;  3W9J A;  1UFK A;  1W25 A;  1PYO B;  2CZV C;  4ZJQ A;  4ZKA A;  4D3G A;  3IRX B;  2XMJ A;  4WKR A;  2D9P A;  4F02 A;  4ECT A;  2QG9 B;  2XYP B;  2XS5 A;  2VFU A;  4NYO A;  4B3T J;  1NLK L;  3TZW A;  5DLW A;  4ZPV R;  1VR6 A;  1R8P A;  2Z2Z A;  3TP2 A;  4OX9 J;  2E7V A;  1VDH A;  4OHV A;  3CD5 A;  3BV8 A;  4KY3 A;  1CEZ A;  4JI8 J;  2FDN A;  4EO8 A;  2CQD A;  2BE2 B;  3K5P A;  4K2X A;  5FLX U;  5EHH A;  3G6X A;  2O67 A;  2V2Z A;  1X0P A;  1KHL A;  1T94 A;  5L1K A;  1A9N B;  4D3H A;  2CG8 A;  1HNW J;  2NRE A;  4F4W A;  3GIK A;  4WYW A;  3MPW A;  3ZZO A;  2O5D A;  1RT4 A;  3AD9 C;  5DG8 A;  3SZY A;  4IR1 A;  3U1L A;  1C2P A;  5DZ6 A;  1EJ7 L;  1RTJ A;  2Q6C A;  4TU8 A;  5LIA A;  4IFV B;  4E2F B;  1B0T A;  2VPX B;  3OVS A;  2RF2 B;  2W5S A;  1TKX A;  4DV6 F;  5FD1 A;  3TUI C;  4CI0 B;  4ELU A;  1RU2 A;  2B4O A;  3QNW B;  3LGN A;  4QWA A;  2UXB F;  4Y2C A;  2B43 A;  4UST A;  2D7S A;  5L0E A;  5C42 B;  3NL0 A;  4DV2 J;  2N7C A;  1RAA B;  3G6V A;  1YSJ A;  1N33 F;  3B8H A;  4KGK A;  2C3M A;  4CT8 A;  4QWD A;  4JV0 A;  4Q0B B;  1WKL A;  3QFH A;  4U7U K;  1QAJ A;  1WSR A;  2VQR A;  1GMU A;  3GON A;  1U1M A;  4KHM A;  3H7H B;  1U24 A;  4DBQ A;  3EM1 A;  1RA7 A;  5HAN A;  3DRX A;  2GA7 A;  3F44 A;  5M2R A;  1LQ9 A;  1NZ8 A;  3WZ0 A;  1RCX B;  2MQP A;  2HZC A;  4ED7 A;  3Q0A A;  3HT3 A;  2X98 A;  4HL9 A;  1Q81 T;  1SJ3 P;  3UDV A;  2JVO A;  1GMW D;  4LSZ B;  2RQC A;  2HQI A;  4NYZ A;  4LQ9 A;  1SBR A;  1GXT A;  5C25 B;  1XR7 A;  2YKA A;  1XMB A;  1N8R T;  2AJ1 A;  2E5L J;  1I6J A;  5EWF A;  2KG1 A;  1HPZ B;  1HYS A;  1RAD B;  4ERD A;  3BH6 B;  1X4D A;  4N76 A;  2OML A;  2QLF B;  1FRI A;  1KHK A;  3S1T A;  2IIH A;  3AH6 A;  5HVF A;  4FYX B;  2DGX A;  1YZ7 A;  4JI7 J;  1KFD A;  2G0J A;  2OPR A;  1LW0 B;  5IFM A;  3HVT B;  1K73 T;  2C2K B;  2LU1 A;  4KRW A;  4JI6 J;  4LUB A;  4A8K A;  1FK9 B;  2W2Q P;  4P2F A;  3NOC A;  4J90 A;  2QJ3 A;  3H5U A;  4UUW A;  3TVY A;  4M63 A;  1RBL A;  3RB4 A;  3BDH A;  3CD0 A;  3VGV A;  2R7Q A;  5LL6 d;  1UVL A;  2W8L A;  3A3P B;  1VQ9 S;  1HAR A;  4Q8F A;  2CFX A;  2IAJ B;  2LMI A;  2IUC A;  1BHN A;  1FJ7 A;  3LP2 B;  3DRS B;  5L9X A;  3THV A;  4ECX A;  4C3K A;  3M8W A;  1EET B;  5GAE U;  3M8R A;  2A10 A;  1SJR A;  1QUP A;  1L5U A;  4UOR A;  2UU9 F;  5DET A;  4DR7 F;  3TAN A;  4QYZ J;  1V3Z A;  3VAM A;  2NZ4 A;  2QSW A;  4WTY A;  2DH8 A;  2MPU A;  2RHS B;  1RT7 B;  4ED3 A;  4EZ6 A;  2RUG A;  4RW4 A;  3PYE A;  5J2Q A;  5HAO A;  1R43 A;  3MEG B;  3M30 A;  1EP4 B;  1ZM3 A;  3EMT A;  1T3O A;  3CB4 A;  5I3U A;  2AJ2 A;  4P71 A;  4TN0 A;  3V6H A;  3QAU A;  2B8P A;  2HFN A;  2BQR A;  4C9D A;  4UY8 5;  4FVC A;  2R7O A;  3PHT A;  3UI3 A;  3H40 A;  2F5G A;  1K8A T;  3X1L B;  1URB A;  4DHV A;  3J80 U;  2BAB A;  2AEM A;  1RWP B;  1T05 B;  3QIP A;  4IG0 A;  4B9N A;  1IJF B;  3LA0 A;  4J9U E;  5KFK A;  1U2R A;  1VIS A;  4DR1 J;  1XQI A;  3WDO A;  1IN0 A;  2BQU A;  4K4T A;  5TJ3 A;  3DYA B;  3NKM A;  5KG4 A;  2LFV A;  2LEC A;  2C2Z B;  2AQ4 A;  2VIC A;  3HKZ D;  5DLV A;  3M2R B;  5F8H A;  2W25 A;  1HW9 A;  1YJV A;  1KQK A;  3HVW A;  2NXN A;  4EUV A;  2I6W A;  1UFL A;  1T9U A;  5KG5 A;  5K8N A;  4ES2 A;  1RBO B;  1JLC A;  4XPE A;  3IS9 A;  4DL6 A;  2YQ3 A;  2C3Y A;  2QLJ B;  4HKQ A;  4OV1 A;  3HHL C;  4M94 A;  3MMB B;  3OUY A;  2OPP A;  2DGU A;  2W01 A;  4IDK B;  2HVI A;  4R5P B;  4JP8 A;  4JI5 J;  2EKN A;  2CZ4 A;  1ZM9 A;  3SSS A;  4OZ3 A;  3KLH A;  3IP0 A;  1E6V A;  4PUO B;  2F8H A;  5KAK A;  5GME A;  2E1C A;  3CTR A;  4UOP A;  2Z30 B;  2G0I A;  2Y9H A;  4JI4 F;  2VDI A;  2WB4 A;  3KMQ A;  2CNL B;  1KVJ A;  5H9F J;  2DB1 A;  2GIF A;  3P45 B;  1PAU B;  3PR4 A;  3TAQ A;  1X60 A;  2KVQ E;  3GZ7 A;  4RUB A;  5FJ4 A;  1RZM A;  2QTW A;  3D67 A;  5EX0 A;  1J5O B;  2W7P A;  2MST A;  1GQE A;  2VQE F;  3E01 A;  3SDE B;  2ABY A;  1Q7L B;  4DXL A;  5ETO A;  4FS1 A;  1YIJ S;  3EPI A;  4FDI A;  1JMT A;  5LM7 E;  3G71 S;  2YKM A;  2KI2 A;  5LXR A;  1P8G A;  1WF2 A;  3C14 B;  1Q8B A;  3RU0 A;  2UVU A;  3FQK A;  2MKJ A;  2J8A A;  4YN3 B;  4B9L A;  4WZQ A;  1S1W B;  1YJU A;  1EX8 A;  1HNI B;  3NCR A;  3Q8V A;  1F9E B;  1XEZ A;  1HMV A;  1TL7 A;  5LRN A;  4PKD B;  2FVC A;  4FXD A;  4ZDN A;  5IT9 U;  4QYR A;  3H59 A;  1UZD A;  3KYL A;  4K4Y A;  1RWW B;  5CAA A;  1H72 C;  1RLC L;  1SC1 B;  1VI7 A;  2B6A A;  1RTI A;  4P74 A;  5B08 A;  2J0S D;  1FWL A;  4IG3 A;  2BE9 B;  1O6X A;  2P2C B;  2ASY A;  2RQM A;  3U02 A;  2ZD1 B;  1S1X B;  2B4U A;  4DR2 F;  4J9Q A;  3DYC A;  3CGI A;  4EU0 A;  2ROP A;  2V5H G;  2HQ3 A;  2KM8 C;  1SJ1 A;  1B70 B;  2FJA B;  3C6U B;  5KFT A;  2XYG B;  3UVJ A;  3LAM A;  2CPI A;  1DLO B;  3PXG a;  1Q1K A;  1F0X A;  5D0E A;  3PV8 A;  2PSZ A;  5A8K B;  2HIY A;  1X4C A;  4DV5 F;  3RR7 A;  5KFZ A;  3VCD A;  4CO1 A;  5HVH A;  2V8V A;  1F3V A;  1IQZ A;  4KGV B;  4I4B A;  1WOR A;  4F26 A;  2V4J A;  4KB7 A;  5JVH Q;  5J1P A;  4IQM A;  3DRR B;  3C46 A;  3LO3 A;  3DLG A;  1ALI A;  1TKD A;  1FDD A;  4TNO A;  5D4P A;  3W63 A;  2FLL A;  2V4R A;  5D78 A;  4LSN B;  5LJ5 Y;  2PMZ D;  1KEK A;  4KJG A;  2F40 A;  2H5I B;  2AMC B;  4RX6 A;  3CJ0 A;  2CZ9 A;  2B7C B;  2P6T A;  2AGP A;  3CCZ A;  2VFR A;  2GAH C;  4OIX A;  3X3U A;  2IJR A;  3GJQ B;  2HWT A;  4C6A A;  4F4X A;  3PX4 A;  2ASD A;  3OL6 A;  4QWC A;  1Z2Z A;  4AL6 A;  4MK7 A;  4DPX A;  3OXF A;  4GO7 X;  5E33 A;  1TR0 A;  3MWB A;  5A6P A;  4BHQ A;  1RT1 A;  4UZC A;  2ATC B;  3BO4 A;  3KOA A;  1W26 A;  3MAH A;  5FDL B;  3AOC A;  3H5Y A;  5D3G A;  1SV5 B;  4NYP A;  3HP6 A;  2W9C A;  1KQS R;  3DNC A;  2FGO A;  4Z2X A;  3PR5 B;  3CPW R;  2CG4 A;  1VHF A;  3THP A;  1MMD A;  2RF2 A;  5EGH A;  2MLX A;  1U1R A;  4OLO A;  1H38 A;  3DXS X;  3V6K A;  3PYG A;  3IDD A;  2GLQ A;  2Y1J A;  3LP0 A;  2E29 A;  3LAK A;  1M5V C;  2DNN A;  5MLC V;  2AEJ A;  3MM7 B;  1ZZF A;  1GTH A;  5T7L B;  2CJ9 A;  4GKK J;  3O3L A;  3Q24 A;  2W5X A;  4AQY J;  2RIJ A;  4OI0 A;  3NKR A;  2VV5 A;  4C11 A;  2Q79 A;  2HKE A;  1N32 F;  2YPY A;  4H4O B;  3C16 B;  1NO8 A;  1NH7 A;  2AW0 A;  2KN4 A;  2WBM A;  1Z1Z A;  4H54 A;  4TLR A;  5DQH A;  1ED9 A;  2XSJ A;  4OI2 A;  1KC8 T;  1WG5 A;  1FDA A;  3NXZ A;  1HBN B;  1BD6 A;  1A6L A;  1KSP A;  3D66 A;  2CWX A;  2VQF J;  4KJI A;  3H2U B;  4LRE A;  3O44 A;  1HPZ A;  1B64 A;  1QLN A;  4PQU A;  4GTY A;  3VHQ A;  2Z0G A;  4ECQ A;  2QEX S;  5F8G A;  3PJ9 A;  4HHH A;  5HJX A;  1X8D A;  2CNN B;  1YWX A;  3HVT A;  1HWL A;  1TKZ A;  2RRA A;  3BR8 A;  4DFP A;  1FER A;  4Z37 A;  4ZVF A;  1V5I B;  2K7J A;  1UVK A;  1X5T A;  2G1H A;  1WC0 A;  3AD8 C;  1RWX B;  1SQE A;  1ALH A;  3AOA A;  2BJ8 A;  3I56 S;  3MK2 A;  1JLF B;  5KFO A;  3WHI A;  3OT9 A;  1NK5 A;  4WP9 A;  2GZO A;  1ULR A;  1MMN A;  4X4P A;  1RYS A;  2DNY A;  1RHU B;  3LP2 A;  5HBM A;  2QN6 B;  1WSV A;  3RUB L;  1AZS B;  2IDE A;  4B9V A;  4MJK A;  4DU8 A;  1EET A;  4PR6 A;  1AUD A;  3NY0 A;  4ZLN A;  2OFG X;  4Y34 A;  1QD1 A;  3EXC X;  2DGO A;  1TL1 B;  1SC4 B;  3GYN A;  3JTO A;  1ARO P;  2OAU A;  2KFN A;  3WBH A;  4I68 A;  3KK2 A;  2CJA A;  4ZMM A;  3TA1 A;  1EJJ A;  3FDS A;  1S59 A;  3OFH A;  3MEG A;  1UL3 A;  2HWI A;  2UVW A;  1KBR A;  3LW5 C;  3EZ5 A;  3KXD A;  1ALJ A;  1EI6 A;  2JOQ A;  3MAA A;  8AT1 B;  3DOM B;  5CHC B;  1UWA A;  2MKC A;  5F8J A;  2ERR A;  2GHV C;  1RWU A;  4ICL B;  3EZO A;  2J5A A;  2ZH8 A;  3JS9 A;  3QJJ A;  4ILL A;  2C3U A;  1SCJ B;  4TU9 A;  2L9N A;  4NA1 A;  4MIB A;  1N5Y A;  2DCL A;  3QWU A;  4G1I A;  1GMV A;  1HQU A;  3ED4 A;  1T05 A;  4USM A;  1BQM B;  4EO6 A;  1AFI A;  3UPF A;  2Q43 A;  4KJD A;  2UUT A;  1YIT S;  1AT1 B;  4IH6 A;  1EZZ B;  1OIA A;  2ZJR Q;  2LA4 A;  4KV8 B;  2J0Q D;  4N56 A;  2XMA A;  2E7W A;  3MR3 A;  3PO4 A;  1FEE A;  4NA3 A;  4DWI A;  1M1H A;  4OJG A;  3CJ5 A;  3OD2 A;  2CPF A;  2XBP A;  3GIM A;  4WFX A;  1PIL A;  1X5O A;  1Y11 A;  2KYX A;  4QQB A;  3IAS 9;  2ZZM A;  1NK0 A;  3QRP A;  1IKX A;  4R25 A;  5KFA A;  2RKI A;  5C24 B;  5KFF A;  1U02 A;  4YB7 A;  4M5M A;  2ZH7 A;  2AJQ A;  3MMB A;  4ECY A;  1S79 A;  2OSR A;  1RGV A;  3N6N A;  4PZV A;  4AL5 A;  3JYT A;  1O99 A;  4UOF A;  4L3N A;  1M5P C;  1HNZ J;  3R5A A;  3D54 A;  2HLU A;  3ELH A;  1G3O A;  3WX4 A;  5GAH I;  2HHP A;  1Y5I B;  2RRB A;  2ZHB A;  1LWF B;  3CCU S;  5K5M A;  3C66 A;  4DOZ A;  4B3O A;  5DG9 A;  3HM9 A;  1MLA A;  3UN3 A;  1D09 B;  3EX7 B;  2ZC4 A;  2HHT A;  4DFJ A;  2MZQ A;  2VOD A;  5A8W B;  3BGR A;  4LT6 A;  1FES A;  2LA6 A;  3HFK A;  1KWM A;  2D3O R;  4NXN F;  4FF4 A;  2CUY A;  4ZHR B;  3H90 A;  3CJQ A;  5L39 A;  2RS2 A;  2XM3 A;  1G4C A;  4NOH A;  4M5L A;  1AJD A;  2DK2 A;  4WXO A;  3EIC A;  3Q8S B;  4YQW A;  2IYG A;  1S1U B;  4QR0 A;  2G0C A;  3C14 A;  2KRB A;  2CQH A;  2IBO A;  1S1W A;  4LF4 J;  4NPO A;  4KFB B;  1UET A;  3VZH A;  1B99 A;  4CXU A;  2W5Q A;  4I2Q A;  4L74 A;  1E6Y B;  2LKZ A;  3MEE B;  3W1Y C;  2UUW A;  1CBK A;  3FJ2 A;  4ECS A;  3HHL D;  2JLG A;  1ALK A;  1JLE A;  5EWE A;  4RO0 A;  2BAN A;  3DLK A;  3QT8 A;  1U26 A;  1UVM A;  4GVL A;  3AOB A;  1AYE A;  1CQN A;  1U0H A;  2BDP A;  1WWH A;  4X62 J;  3DHX A;  2U1A A;  4CXS A;  2OMO A;  4QZV B;  1XNR F;  2MQ8 A;  4UOC A;  2QV6 A;  3DGP B;  5GAG I;  3J7Z 5;  3CDB A;  1NRK A;  4DEZ A;  5KG6 A;  2G13 A;  2O1P A;  3BDG A;  2DKO B;  3V4I A;  4E98 A;  3J80 Y;  5C7P A;  3UD5 A;  1TUG B;  3ZZ0 A;  1MRO B;  3LAN A;  3HHE A;  4P75 A;  3TAM B;  4DUZ J;  1ELO A;  2FLN A;  3IG1 A;  2YPZ A;  2XI3 A;  3M05 A;  1GXL A;  2QA2 A;  3OTO J;  4UOH A;  1U2C A;  2AIR B;  3LOU A;  2BE7 D;  2GVD B;  4ZVO B;  1UAW A;  3DRR A;  2JC1 A;  3C19 A;  3W7B A;  3FRZ A;  4KKO A;  3QGP A;  3KK1 B;  4YB5 A;  1V3S A;  3R2D J;  4LSN A;  1N4L A;  4O0N A;  2AYG A;  1SIW B;  4CIO A;  5F8L A;  4QWB A;  4RBT A;  4DQI A;  4Y3C A;  1LWE A;  3VR1 A;  5F9L A;  3KHR A;  2J76 E;  4ED0 A;  3Q86 A;  4ZN3 A;  5AXN A;  4ECZ A;  4JYA F;  4NML A;  3VV2 B;  2XGQ A;  4DR4 F;  4NWJ A;  3BSN A;  4K50 A;  2WW4 A;  1N5Q A;  2HBQ B;  4KH0 B;  5U47 A;  4KE5 A;  3PO5 A;  3J7A 1;  2P9E A;  3KLE B;  1NDK A;  3CC4 S;  2M2B A;  1QUV A;  2ZBC A;  2NUU G;  2FHJ A;  3QZ8 A;  3BB5 A;  2KXN B;  2X1G A;  4NE9 C;  1C0U B;  3QGI A;  5FDL A;  3BR9 A;  1NXI A;  5IWA F;  2HRU A;  1JLQ A;  3QO9 A;  3FSX A;  3PW2 A;  2X7I A;  5FII A;  4F04 B;  1U45 A;  2IMW P;  4ED1 A;  2W8S A;  3NRB A;  2LQ9 A;  3L95 X;  3Q83 A;  2DO0 A;  4OLP A;  3TZX A;  4ENO A;  2DR8 A;  2VG5 B;  3W5X A;  4LF5 J;  1HA1 A;  1ROF A;  3MM7 A;  4FF1 A;  5T7L A;  4MKA A;  5E3P A;  4XDD A;  2JEF A;  2Y8Y A;  5AT1 B;  4OX9 F;  3NAH A;  1RAE B;  2P9C A;  4ZJL A;  5D0H A;  4ZVT B;  3BGU A;  1N88 A;  4BWM A;  3ZTR A;  2VG7 B;  4JI8 F;  1R89 A;  5HK4 A;  3M1V B;  1MNE A;  1CJT B;  4JV2 A;  3U1N A;  2W5W A;  3FFI B;  1QY7 A;  2DHA A;  3D1O A;  1FX4 A;  1RAF B;  3DI6 A;  1HNW F;  2H3E B;  1I3O B;  4BC9 A;  4ZPC A;  5IT9 Y;  2U2F A;  5HMX A;  3BDF A;  1T0T V;  2EEY A;  4J9R A;  3NG8 A;  4ZP6 A;  1YX2 A;  4NI2 A;  3UR0 A;  3IXQ A;  1NSK L;  3G4S S;  3CMA S;  4IR9 A;  1RWV B;  3I5A A;  2DYA A;  2GMH A;  1R3N A;  2VOO A;  3PKM A;  1GH8 A;  1KHV A;  2ZH1 A;  1LFW A;  3NGD A;  3D1Q A;  8RUC A;  2DGS A;  3HT0 A;  3MM9 B;  1NB2 A;  2DR5 A;  2GSN A;  4J37 A;  3IM9 A;  2ZKT A;  1NAQ A;  4UF4 A;  5K8M A;  3VVT A;  2KHD A;  5EDW A;  4ZCI A;  3M8Q B;  4DV2 F;  2P6S A;  3M6U A;  3QMQ A;  1HJK A;  5CYM B;  1T11 A;  4DLE A;  1W2I A;  4K4V A;  4LSL B;  3UD4 P;  4HLB A;  3OL7 A;  5GMK a;  2W7A A;  3BDP A;  2OD6 A;  3KUG A;  3MPY A;  1IKW A;  2OSQ A;  2WVF A;  1D9D A;  4LIR A;  1L3V A;  4FYD A;  1C0T B;  1P1L A;  3MUV P;  1JLF A;  1WI6 A;  1S4E A;  2LDY A;  4MFB A;  2COL A;  4CH0 S;  3R7S B;  3JTP A;  2KO1 A;  4AUK A;  4QAX A;  1S6Q B;  2LU2 A;  3IBC B;  3MAQ A;  2V8G A;  1VLO A;  5A8R A;  2DRD A;  2GJI A;  2HVZ A;  2AKW B;  3MXH P;  4JI0 J;  2FY1 A;  1YTY A;  5LMN J;  7FDR A;  1NEE A;  1VRT B;  2V9W A;  4RW7 B;  4KR0 B;  5DDP C;  4NLW A;  2IC3 B;  1HIY A;  1RK8 A;  3C2P A;  2E5L F;  1VK8 A;  4MIA A;  2YKN B;  4KO0 B;  3D68 A;  2ZM6 F;  3FBE A;  1NU4 A;  1URN A;  4KGX B;  4OYM A;  2A0F B;  4U6P A;  4M5D B;  2RU3 A;  4JI7 F;  3R5J B;  3MK1 A;  4F4K A;  4DR7 J;  3CVK A;  2H65 B;  3DGV A;  9RUB A;  1RWK B;  3DRP A;  1NHU A;  2B4P A;  5IXU A;  3FUY A;  3G2X A;  2FHM A;  2LQ8 A;  4I7F B;  1GAO A;  1IKY B;  3BSO A;  4QR1 A;  5F0U A;  3DOL A;  4G1Q B;  2VUG A;  2GMJ A;  1WG1 A;  5LSR A;  4LR9 A;  5DJB A;  1CC7 A;  2DPJ A;  1IM6 A;  3OR1 A;  3IGY B;  2GNK A;  5IT4 A;  4LRA A;  5J2P B;  4OMF G;  1HHS A;  4OZ2 A;  5JJB A;  4ZGA A;  1B7Y B;  4ZJO A;  2ROG A;  1KLM A;  4ZIV A;  1CJV A;  2ALY B;  1S6P A;  3IC1 A;  1AFJ A;  3I5B A;  2HNZ B;  3FZB A;  1TL3 A;  2UP1 A;  1X4B A;  1KOH A;  2Y8W A;  2XS2 A;  2KL8 A;  3D6F B;  3ET6 A;  3NS7 B;  4LFB J;  2HS0 A;  2JLF A;  2OGU A;  3W61 A;  2QL7 B;  2VON A;  3AAW B;  2DGT A;  1JLB A;  2V2K A;  3D28 A;  5LOQ A;  2J9D A;  4JI1 F;  2XGP A;  4ED4 A;  1FXR A;  1EKR A;  4YB1 P;  1BC6 A;  2HHH J;  1C1B A;  1X9M A;  1SI9 A;  5IS2 A;  4CWB A;  1D0E A;  4RW9 B;  2DXE A;  2IVM A;  2M3D A;  3NKY A;  5BJR A;  4I6A A;  2CAD A;  2XC9 A;  1LWF A;  1BQX A;  5IQQ A;  4NLQ A;  1UJ5 A;  3NKO A;  5GAD I;  1XN9 A;  1RBA A;  2D3O 1;  4LQ3 A;  1BXN A;  3BN7 A;  3IGN A;  4NZ6 A;  4YP3 A;  5D0G A;  3MF5 A;  1EQM A;  3J81 Y;  3VQT A;  2W9A A;  2YWH A;  3B78 A;  1NDL A;  1FJG J;  4DR1 F;  1NHV A;  3KK3 B;  2W24 A;  2FJB B;  3NS5 A;  3H8Y A;  5HMZ A;  3CCM S;  1ED8 A;  5HLF B;  4ZHR A;  5ETK A;  1S0V A;  2Y1R I;  2IPO B;  1KH5 A;  3TW0 A;  3R5G A;  3Q8Y A;  1HR0 J;  2GVZ A;  3DFE A;  4OYB A;  5DRK A;  4I2P B;  3PY8 A;  2XS7 A;  1N6Q B;  1S1U A;  4KH1 B;  3L3C A;  1ZET A;  3PJW A;  2Z2M A;  3QBC A;  2V94 A;  3E2D A;  2H5J B;  1ZED A;  2W9B B;  4TN2 A;  1ITP A;  4CH1 A;  1X4E A;  3R7N B;  5KFB A;  2FB0 A;  3CME S;  3MM5 B;  3ULH A;  3MED B;  5HO4 A;  1OYE A;  1HWK A;  4JI5 F;  2AJ4 A;  3Q2T C;  2JEJ A;  3AY0 A;  2RVJ A;  2HK3 A;  3MR2 A;  3V6J A;  4DQR A;  3OPK A;  3FC9 A;  1GK8 A;  5J2M B;  4A4J A;  2R7T A;  2MQN A;  1NZA A;  3KJV B;  4NLU A;  1IR2 A;  1YBA A;  2VHG A;  1VQK S;  3O1L A;  3DGP A;  3TAR A;  2DEI A;  2UXC J;  1DFD A;  4BDP A;  1N56 A;  5KFN A;  1CS4 B;  3I96 A;  3C6T A;  3I0S A;  2R9L A;  2AP6 A;  3I6P A;  2CQ1 A;  1S72 S;  1VGY A;  5A2Q Y;  1CSJ A;  1UJ6 A;  1T8E A;  5RUB A;  4FPI A;  4DI6 A;  2LEA A;  3MD3 A;  5D6G A;  5THW A;  2FYX A;  3M6X A;  5H9E K;  1MW7 A;  3GLJ A;  2ZC3 A;  3Q23 A;  2ZE2 A;  4RUC A;  3TJA A;  2HAF A;  2L3M A;  2NYI A;  3ZZT A;  2XY5 A;  1MWQ A;  4YFU A;  3TYT A;  3HUL A;  1A7G E;  2W8K A;  2RML A;  3ITH B;  4QIE A;  4OI4 A;  4RW8 A;  1FWP A;  3MHY A;  3T01 A;  1Q8I A;  3QT7 A;  1EAR A;  2UVV A;  4RNN A;  1SKS A;  4CZC A;  2GML A;  2WON B;  1XJW B;  2K1R B;  4HYK A;  4WKY A;  1S99 A;  1X4F A;  2RUS A;  2ADB A;  2IM2 A;  4AXI A;  1KQG B;  1E3C P;  5GMD A;  3QLH B;  1EW9 A;  2C2N A;  2EK1 A;  1PJ6 A;  2A18 A;  1V9O A;  4WII A;  3KG4 A;  2KKH A;  2HMI A;  4PWD A;  3M6V A;  3G8T A;  2WSE C;  3FBB A;  1VQ4 S;  1KHW A;  4CNY A;  1B3T A;  4DSI A;  4RW6 B;  2V8H A;  3SQG B;  3CE8 A;  3IA0 A;  1RT6 B;  1YZ6 A;  4HAC B;  4IFY B;  3RTV A;  3IWL A;  5IJS A;  2GGP B;  3JSM B;  3JSY A;  3RJM B;  5B0B A;  4CDI A;  5AXM A;  4J9V A;  4TY8 B;  5A0Y B;  5HJY A;  2VG5 A;  2DBB A;  4WPA A;  2J7W A;  3VGT A;  2WVC A;  1ZAW A;  1JLG A;  1OS5 A;  2GA3 A;  1MU2 A;  3W9I A;  1NDP A;  4USK A;  4CLZ A;  3M2U A;  2Z8Q A;  3H4B A;  2F8M A;  1SH0 A;  4EZ9 A;  1VC0 A;  3M1V A;  1JJ2 R;  3HVR A;  3OBI A;  4UPL A;  1LKZ A;  1J2V A;  1B7F A;  2CPJ A;  2HQC A;  1UVI A;  4WP3 A;  3VQS A;  3IGZ B;  4DV4 J;  5JUM A;  2CJB A;  1Y7P A;  2VKR A;  5E3C A;  1SC6 A;  4NZ7 A;  2W4P A;  4OJH A;  1AUS L;  3GMG A;  4RU9 A;  2BM0 A;  2ZHO A;  4J9O A;  4CQ1 A;  2VPZ B;  5CH7 B;  4UT4 A;  5I3Q A;  4QIG A;  1Q4R A;  2C3P A;  2AZ1 A;  3O2I A;  5KFG A;  5IZH A;  3B4D A;  1G6B A;  3GFZ A;  3N79 A;  3CC2 S;  1RKJ A;  2MZ1 A;  1XTZ A;  3CT9 A;  3OFE A;  3BYR A;  2VPW B;  1K7H A;  3M8Q A;  2D74 B;  1RTJ B;  4O3N A;  1JX4 A;  1W7W A;  1HL6 A;  4KBI A;  5HQ8 A;  3QRQ A;  4DSE A;  1FE4 A;  2B0G A;  1I94 J;  4GKK F;  1TKX B;  3BGL A;  1VIO A;  3RBX A;  4AQY F;  2VC1 A;  3F73 A;  2H1Y A;  5L38 A;  4UY8 T;  5L0B A;  2DGV A;  2BZ2 A;  3CDE A;  1RAO A;  3WAW A;  3EWG A;  2DH7 A;  2WAQ D;  4WK1 A;  1N48 A;  1T02 A;  3M7V A;  1S1T B;  5IC4 B;  2RJZ A;  3W2V A;  1ELY A;  2YNG A;  4P10 A;  2HVH A;  2R7X A;  2E9R X;  1SJQ A;  3RGI A;  4UOO A;  4WK3 A;  4TYB A;  2MZS A;  3I55 S;  4FKY A;  3CMR A;  2GQQ A;  1X5P A;  2VQF F;  4KIA A;  4MTP A;  1PBA A;  1ZYQ A;  2IC3 A;  4X4U A;  2GO9 A;  2HK2 A;  2A2C A;  5KFV A;  4K4W A;  2R7W A;  1K47 A;  2YWW A;  4PG8 A;  1QVF R;  2NXJ A;  2UUB J;  2C3O A;  1LK5 A;  4IH7 A;  2JRS A;  1K0V A;  2HND A;  5I42 A;  2W7O A;  1VQ6 S;  8ATC B;  1HD0 A;  2V68 A;  2ANH A;  2CQ3 A;  3ISN C;  1SH2 A;  3MGJ A;  1QAI A;  1HYS B;  2M52 A;  4CO5 A;  3DDI A;  1HBM A;  1IKY A;  4O44 A;  1FKA F;  3TUZ C;  2ZH5 A;  1UPP A;  2OPR B;  2R8J A;  4FS2 A;  5D77 A;  1D3W A;  4ECR A;  3S01 A;  3CCJ S;  4OYZ A;  3HSD A;  3Q8Q B;  2ZOM A;  4WZM A;  2JLE A;  1SL2 A;  3M9O B;  1Q86 T;  2CA9 A;  5K14 A;  4V19 X;  2A6M A;  1T9T A;  2YTC A;  1ZZN A;  2E1M C;  5KFM A;  1HBU A;  5JXS A;  2DNL A;  2RAQ A;  1RWN B;  2HNZ A;  1OQ6 A;  4TXS A;  1KR4 A;  3ZZY A;  3NGR A;  2E1P A;  2IUC B;  4CLK A;  1HI1 A;  4MHX A;  2IFX A;  4CCH A;  2I5J A;  2UV8 A;  2F7V A;  4WFB Q;  2E5I A;  1X9S A;  2DNZ A;  1RHR B;  4MYU A;  2FJE B;  2JVR A;  3RB0 A;  1ZTW A;  5B0D A;  3UNY A;  3PTW A;  2J9C A;  1S4F A;  1Y00 A;  4I1T A;  4NEY A;  3GV5 B;  3FGV A;  1IJE B;  1CJU A;  1FKP A;  4EBD A;  4GVB A;  2CPY A;  4CLY A;  1JXE A;  4NWX A;  5KFE A;  4C4W A;  4L75 A;  5J2Q B;  5E3A A;  3K5L A;  3A13 A;  1RWO B;  4LF2 A;  3M30 B;  3NMA A;  2ZNY A;  4K5R A;  2R2U A;  2APO A;  2MYF A;  4YDD B;  5I3U B;  1Q8L A;  3R1L A;  1XBW A;  3BJY A;  2IY5 B;  4TYA A;  3IBF B;  2UUC J;  3I5C A;  1FD2 A;  4DPT A;  3FCH A;  2XG8 A;  3CJS A;  3PKY A;  3E2E A;  1ZPW X;  1WAC A;  4DN9 A;  3L4B C;  4ELT A;  5GAH U;  1LK7 A;  5F3T A;  5ITH A;  1J5E F;  1IR1 A;  2FIU A;  3QIP B;  4OHW A;  4IG0 B;  3BSC A;  4M5J A;  3FKB A;  3IGV A;  2AV5 A;  2RD5 C;  4USV A;  1N6Q A;  4M5N A;  3CF5 Q;  2ZNZ A;  3IM8 A;  3DC2 A;  3W65 A;  4ZVH A;  2HHS A;  4CNZ A;  2W9B A;  2VH7 A;  2F4V J;  5B0F A;  1GT8 A;  4I6Y A;  3RAM A;  3IMQ J;  3CCR S;  4USI A;  2MHN A;  2QLX A;  4TU7 A;  3EVM A;  4HR2 A;  1ZM2 A;  3SSQ A;  1HNZ F;  5KFI A;  3ZTP A;  1JLC B;  1R8A A;  2I9S A;  2PT0 A;  3IS9 B;  3V81 A;  2DRB A;  3HPO A;  1LWX A;  3I9V 9;  3OUY B;  2OPP B;  3KJV A;  1TAQ A;  5K9F A;  2Q1L A;  3DKD A;  4YS2 A;  5CYQ B;  1AUK A;  3KLH B;  4AE5 A;  4RKU C;  1X4A A;  3PW0 A;  1E6V B;  1CS4 A;  3UO0 A;  4YEA A;  3R1H A;  1FD8 A;  1JB0 C;  1SB6 A;  3CWJ A;  1HQE A;  2HFO A;  3DLB A;  1ELZ A;  3K2Y A;  2DHH A;  1QTM A;  3NAI A;  2W4D A;  2NUH A;  5GAG U;  1FE0 A;  4G65 A;  4A46 A;  3FCW A;  2YWK A;  3E01 B;  2KXH A;  2IA6 A;  1AJA A;  2OPQ B;  2B9Y A;  1RHK B;  1WG4 A;  4O3Q A;  2OI2 A;  4LF4 F;  4F0M A;  1FF2 A;  1LOU A;  2G2Y A;  1VK3 A;  3F56 A;  3T9Z A;  3W8G A;  2QIF A;  2QZU A;  2HLT A;  5SZT A;  1V6H A;  2WOM A;  3FZ2 A;  1WF0 A;  3IBW A;  2IVF B;  2WW8 A;  1LWC A;  1B4S A;  1HMV B;  3UCU P;  1X4H A;  1S10 A;  1VYA A;  4X62 F;  2XEX A;  4NZ0 A;  1KON A;  1TL7 B;  3SCJ E;  5KFL A;  2G2Z A;  4DS5 A;  3TRG A;  3G6Y A;  3RBZ A;  3EPG A;  2D1C A;  3RAQ A;  4GC7 A;  1D8Y A;  3KD8 A;  3T5K A;  2LXF A;  3D6T B;  3SZZ A;  2RDJ A;  4DUZ F;  3W5Y A;  2B6A B;  4CXK A;  4H4M A;  1RTI B;  4F4A A;  5E3Q A;  1DQA A;  3MUT P;  2PO4 A;  4DV0 F;  4Q43 A;  5IC6 B;  3GG1 A;  3QJL A;  3A52 A;  1SKR A;  5F8I A;  3AOD A;  1H2U X;  1T9Y A;  3OTO F;  4LVN P;  1OMS A;  3GR0 A;  2QLW A;  2VBY A;  2VU5 A;  1WEL A;  3AD7 C;  3MI7 X;  2WVB A;  3UVJ B;  2FVQ A;  1R8C A;  2DRA A;  4EWT A;  4P7V A;  4XO0 A;  2W2P P;  3V4M A;  3LQV A;  1IKV A;  2V4J B;  3J7A N;  2J9E A;  1RT3 B;  3KWM A;  4RUA A;  3DLL Q;  3DLG B;  1S76 D;  2K2P A;  4ID8 A;  1XK8 A;  4O4G A;  2Y1L B;  3G6E S;  4MH8 A;  4DSL A;  5CZV A;  4DG1 B;  4KM4 A;  2ZIT A;  2E1R A;  1XWL A;  5E41 A;  3HSJ A;  2V6A A;  4DLG A;  4FYW B;  2C28 A;  3WQP A;  2N3O A;  2G1D A;  3F41 A;  4X4Q A;  4DF4 A;  1WDD A;  2GV1 A;  4OX6 A;  4ZK7 M;  1KDN A;  5G0R B;  2XZW A;  4G3I A;  4M5G A;  2F9D A;  1UEU A;  4ZVP B;  4USW A;  1FXL A;  1ZEB A;  1FFW B;  5LT5 A;  2WZ1 A;  1FRH A;  2AYE A;  1NDC A;  2ZFH A;  1RT1 B;  4J9N A;  3MR6 A;  1VJW A;  5D3G B;  3KKF A;  4Z7C A;  2W9C B;  1AJB A;  4LF5 F;  3UDL A;  4ID5 B;  3DHW C;  1T03 B;  2UUA J;  4WE1 A;  2HVD A;  2AYM A;  2NPF A;  3A1Y G;  3TNV A;  1KNZ A;  5ETS A;  2FPH X;  3LP0 B;  4DFM A;  4Y2M A;  2IJN A;  1S1T A;  3CC7 S;  5E3R A;  3MEK A;  2GAG C;  1RA6 A;  2BV3 A;  3TUP A;  2XO7 A;  2PA8 D;  1TK8 A;  2Z2Y B;  4PG5 A;  4B9S A;  3QPI A;  1REV A;  4C11 B;  3POT B;  3BQ1 A;  4ALZ A;  4WWS A;  2V50 A;  4LF9 J;  5AXK A;  2VAS A;  4UTG A;  3CJK A;  2E9T A;  2QMW A;  4IO9 Q;  2J8S A;  2BOP A;  2XSJ B;  3H20 A;  4NCG A;  3UQS A;  1P6T A;  4NCA A;  3NCQ A;  4P9S A;  1TQL A;  4GO5 X;  4LQY A;  2FGC A;  4A8Y A;  3TOQ A;  4AD6 A;  4DV3 F;  3MMJ A;  1HWJ A;  4J9L A;  4WU2 A;  3H4D A;  3RAX A;  2Q66 A;  4FBU A;  3GE9 A;  1U6B A;  5D0R A;  4IOA Q;  2VOP A;  4OI1 A;  4JUZ A;  2FTR A;  2FHO B;  4PQU B;  3CO9 A;  2R8I A;  1T7P A;  1SC3 B;  2ZM6 J;  1FNO A;  1F9F A;  2LXI A;  2YX4 A;  3SCI E;  2JL9 A;  3TVK A;  3KHL A;  5L1J A;  4PYD A;  3UCZ P;  1EHW A;  5KFD A;  4EEY A;  1QSL A;  4AYB D;  5KG1 A;  1R31 A;  3IWX A;  4PAB A;  1TKZ B;  3PM9 A;  4NL5 A;  2BEF A;  2VPY B;  4H4K A;  2AT1 B;  3W64 A;  1VCT A;  1NUE A;  3CJ3 A;  2B3T B;  2N3L A;  4ED6 A;  2OKQ A;  3EYZ A;  2Z4P A;  5K20 B;  3KTQ A;  2KFY A;  3G82 A;  3AQP A;  1GMW A;  3NS6 A;  3W2W A;  3EE3 A;  3NNC A;  4ILM A;  2B51 A;  1H3D A;  4Y2K A;  4JI0 F;  5IM0 A;  2NPI A;  5LMN F;  1CPZ A;  4X4T A;  4U95 A;  1ZPV A;  1JNZ B;  3J7Y I;  4O23 A;  1NCL A;  1VBX A;  2QYC A;  2HGM A;  1RT5 A;  1OWX A;  4XTT A;  5HBM B;  2XYH B;  1UPM B;  4F4Z A;  4GTX A;  2XO6 A;  1Q8K A;  5C2C A;  3Q22 A;  3T1Y J;  3CDA A;  3SCK E;  2OUG A;  3L09 A;  1Q16 B;  2FLP A;  2RH6 A;  2AD9 A;  3G8S A;  5KFC A;  4Q7A A;  3DMJ A;  3K8V A;  4ITS A;  4R8U B;  3R5D A;  4PCQ A;  3ISN D;  1RYR A;  3LXQ A;  3KK2 B;  4ZPW R;  4A8O A;  4JI1 J;  1URA A;  2BMB A;  4J91 A;  1SIZ A;  5HN0 A;  4JOU A;  2IM0 A;  2HRY A;  1TL4 A;  2GX8 A;  3MAA B;  1KOO A;  3D3C J;  2F3J A;  4X66 F;  3CED A;  1BMQ B;  1TTH B;  3J7Z T;  1S1V A;  2LEP A;  2KT3 A;  4RNO A;  3LPE A;  3M8Z A;  1TU0 B;  4NLT A;  4C8M A;  2NCK L;  3CIZ A;  4LBI A;  2ALZ A;  1N5Y B;  1TFY A;  4OJ3 A;  1HQU B;  2OEM A;  1RTZ A;  1S7H A;  4RJV A;  2UZA A;  3K57 A;  2AWZ A;  1NPR A;  5GAD U;  2GIR A;  1AJC A;  2IM1 A;  5ETN A;  3W9H A;  4LFB F;  1P1T A;  3CCV S;  4Q2M A;  3N5B A;  3DN9 A;  4XIU A;  1U1Q A;  5DLT A;  1RWM B;  2OEK A;  1DTT A;  4AND A;  4XAK A;  1EQJ A;  2GHP A;  4DL7 A;  1JKH A;  3NVL A;  2DH9 A;  4C2M A;  2W5T A;  4CYU A;  2FHK A;  2C2M B;  4RUH A;  4C8Y A;  2HHH F;  4X64 F;  2KH9 A;  3LH2 S;  5BXI A;  2B9X A;  2VC0 A;  4PEO A;  3GR1 A;  1IKX B;  5J1E A;  4QU7 A;  4CM2 A;  5DDR C;  1WEX A;  5CA5 A;  2ROE A;  2M8D B;  2RKI B;  1WOP A;  1WTB A;  4C3L A;  4DCJ B;  4EFA C;  3H5X A;  5HRO A;  1IVZ A;  1WUU A;  5BYR A;  4NCB A;  5IV3 A;  2DGQ A;  4NLP A;  3BS9 A;  1QAX A;  3L7U A;  4R0E A;  5CYQ A;  3JTN A;  3JYT B;  5HMW A;  1Q5Y A;  1X4G A;  3MUR P;  2RDI A; 
#chains in the Genus database with same CATH homology
 1FSU A;  4GTY A;  2VQR A;  4LR2 A;  3A52 A;  2ANH A;  3IDD A;  2GLQ A;  3BDF A;  1KHL A;  3T00 A;  4QAX A;  4LR9 A;  3UNY A;  1KH4 A;  2XR9 A;  4TN0 A;  3WAX A;  4ZG7 A;  1ALI A;  1EW2 A;  4UPI A;  1O98 A;  1SHN A;  3NKO A;  5IJQ A;  4LQY A;  3IGY B;  1AJA A;  3B5Q A;  4LRA A;  3UN2 A;  3M8Y A;  4UPH A;  3WBH A;  3TG0 A;  4ZG6 A;  5HRT A;  5L0B A;  1ANJ A;  1N2K A;  5KXA A;  4UPL A;  2W5V A;  1E3C P;  5LRN A;  1EJJ A;  3WAW A;  4N7T A;  4GTX A;  1E2S P;  3NKN A;  2X98 A;  4NWX A;  1AJB A;  1KH7 A;  1AJD A;  2D1G A;  3DPC A;  3BDH A;  4LRF A;  3M7V A;  2W5X A;  4KJG A;  4ZGA A;  1AJC A;  2W8S A;  1EW9 A;  1KHJ A;  3IGZ B;  4FDJ A;  5L0K A;  4UPK A;  1ELY A;  2QZU A;  5LRM A;  4MIV A;  1ALJ A;  1E1Z P;  1EI6 A;  3NKR A;  4LR7 A;  3SZY A;  1URB A;  3MK0 A;  4UOP A;  4LRC A;  5DLT A;  4KAV A;  2GSU A;  2RH6 A;  3BDG B;  4LRD A;  2IUC A;  2XRG A;  4CYR A;  1ED8 A;  4UOO A;  2GSO A;  1EQJ A;  4CXU A;  3WAY A;  2GSN A;  2W5Q A;  2ZKT A;  3NVL A;  1ANI A;  3TWZ A;  1ALH A;  3M8W A;  1KH5 A;  2W5R A;  1E33 P;  1O99 A;  2W5T A;  3NKP A;  1HDH A;  5LIA A;  5INH A;  1AUK A;  3LXQ A;  3CMR A;  1ELX A;  2W5S A;  3MK2 A;  1SHQ A;  1ALK A;  3MK1 A;  4B56 A;  1ED9 A;  4ZG9 A;  3UN5 A;  5IJS A;  4KM4 A;  3OT9 A;  4UOR A;  3DYC A;  2G9Y A;  4YR1 A;  1URA A;  3E2D A;  1ZED A;  5TJ3 A;  1HJK A;  3NKM A;  1HQA A;  3UO0 A;  3KD8 A;  4NWJ A;  5GOV A;  3WAV A;  4CYS A;  1EW8 A;  3ED4 A;  5DLW A;  1KHK A;  1KH9 A;  4LRB A;  4GTW A;  5C66 A;  3T02 A;  4KAY A;  5L0E A;  2W8D A;  5DLV A;  5EGE A;  1Y6V A;  1KHN A;  2IUC B;  3SZZ A;  3NKQ A;  4KJD A;  4MHX A;  1B8J A;  4FDI A;  4CXS A;  1ELZ A;  4LR8 A;  3UN3 A;  1K7H A;  2W5W A;  4CXK A;  2GA3 A;  4LRE A;  1P49 A;  3TX0 A;  5LQQ A;  5GRR A;  3T01 A;  2IFY A;  3Q3Q A;  5EGH A;  5K4P A;  1Y7A A;  3M8Z A;  3BDG A;  1N2L A;  4GTZ A;  1ZEB A;  4MY4 A;  5AJ9 A;  1ZEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...