3PLAC

Crystal structure of a catalytically active substrate-bound box c/d rnp from sulfolobus solfataricus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
122
structure length
122
Chain Sequence
b'ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre mRNA splicing protein
publication title Structural basis for site-specific ribose methylation by box C/D RNA protein complexes.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase/rna
total genus 36
structure length 122
sequence length 122
chains with identical sequence D, L
ec nomenclature
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3plaC00
2OHWA 3JAMM 1X7OA 1QVGF 1ZWZA 3NK7A 3CC2F 3WXMB 5A2QM 3RA6A 1Q82H 2I6DA 3MCAB 3E1YA 3ON1A 1N8RH 1Q86H 1CN7A 3GYQA 3CMAF 1NMUB 2OTLF 1RLGA 5GAPK 3O85A 3LWVC 1X52A 3CG6A 5FLXM 4BW0B 1YJ9F 4X3MA 3VI6A 3HAXD 3CPWF 1XBIA 3FFMA 3CCEF 3LWQC 1YIJF 3V7QA 1E7KA 3CD6F 1VQKF 3G71F 3SIUA 2VGNA 1W42A 1YI2F 1GZ0A 3J81M 3NMUC 2LBXA 3G4SF 1VQ7F 1PXWA 3PLAC 1VQ5F 2OZBA 1IPAA 2CZWA 3IR9A 3SIVA 1YHQF 3NVKE 1M90H 1VQ4F 1SDSA 2WALA 3NK6A 1YITF 5GIPC 1KD1H 3CCMF 1Q7YH 4C4WC 3CCQF 3LWOC 1H7MA 1K8AH 3OBYA 1W41A 2KTUA 3CXCF 3LFOA 3CCVF 3CC4F 1KC8H 4LCKA 3PAFA 5GINC 1YJWF 1S72F 1GO1A 5G4VC 5IT9M 2QA4F 4TZZA 1CK2A 3AGKA 3CPQA 1RA4A 3J7AR 2JNBA 3CMEF 5G4UC 5EO3A 1VQOF 1K9MH 1X7PA 3LWRC 1W40A 1YJNF 2KG4A 3VMFB 1VQNF 3CCJF 1NJIH 2VGMA 5GIOC 3LWPC 2LBWA 1K73H 2FC3A 3CCRF 1W2BF 3OW2F 3CCSF 3CCUF 2BO1A 3N4ZA 3JCMM 1VQMF 4X3LA 1QVFF 3HJWC 2OTJF 3NVIB 5EWRA 3N4YA 3I55F 3G6EF 2QEXF 4BY9D 3J80M 1VQ6F 2QI2A 3CCLF 1VQ9F 1VQLF 3E20B 2AIFA 1VQ8F 1GO0A 2HVYD 1VQPF 4NUTA 5FJ4C 1DT9A 1M1KH 3I56F 3RA5A 5DCVA 3OBWA 3V7EA 1KQSF 1W3EX 3CC7F 1T0KB 2ALEA 1Q81H 2KTVA 5GANK 1JJ2F
chains in the Genus database with same CATH superfamily
3I7TA 3JAMM 3QUWA 1QAHA 4B45A 1QVGF 5MN5A 1KNKA 1OAPA 2GZLA 3TD3A 3NK7A 2CW4A 5LXTB 3WXMB 1U3PA 1H48A 3HTNA 1Q82H 2I6DA 2RHJA 3MCAB 3E1YA 1W5AA 4EB6A 5HY0A 3ESJA 4WBNA 2RHOA 3LWVC 1OFUA 2DT4A 4BW0B 3JATA 3S03A 4I50B 2P6YA 4BVRA 3IKEA 4X1KB 3CCEF 4TUYB 1YIJF 4BVTA 5EYPA 5HY2A 3GHZA 3F0GA 1R1MA 4PWTA 1VQKF 5EIBC 3SIUA 1W42A 4O2BA 3J81M 3G4SF 4ZK7A 1VQ7F 2UZHA 1IPAA 3JALA 3SIVA 3VOAA 2FGYA 2LCAA 3S06A 4I55A 1M90H 3WGJA 1JFFB 4BT6A 4O2AB 5JVDA 3HKCA 5BMVA 4ZOLB 2AIZP 3LFOA 2CSLA 3N2KA 1YJWF 3D01A 3ZP4A 5MN6A 5IT9M 2UYNA 4EB6B 5AVMA 2JNBA 3RYHA 5G4UC 1W5EA 2H8CA 1K9MH 4WBNB 1X7PA 3P10A 3FD6A 1FFXA 3HKDA 3GTZA 2IQQA 1W57A 3IKFA 1K73H 2LBWA 1Q8RA 4C8IA 1W2BF 1JY8A 3OW2F 2BO1A 1W5FA 5EAZA 2CHTA 2H8EA 2Z1EA 1VQMF 1QU9A 3TD4A 4RHAA 3I55F 2QEXF 5LA6A 5LOVA 2Z1UA 3P0ZA 3C9SA 3RYFA 3EORA 1VQLF 3DDNA 4LNUA 3DC2A 4M8IA 1GO0A 3JALB 2HVYD 5KMGB 5HXZA 4B5CA 5FJ4C 4IHJA 3F6MA 3WGNA 1W581 2CHSA 3KE1A 3WPXA 4NWOB 1SZQA 1KQSF 4O4JA 5JVDB 1DBFA 5CA0A 3CC7F 2EWCA 5GANK 1JJ2F 1XHOA 4X20A 3UT5A 3N2KB 3C9UA 3K2XA 2HRUA 3RYHB 2HS3A 3LMEA 5ITZA 3JARA 1CLIA 4ZHVA 1X25A 1Q86H 3HKDB 5HP7A 4O4LB 2ZVYA 3V4DA 2N48A 5KX5B 3IMPA 3MDOA 2HS4A 4HNAB 2OTLF 3P4EA 1RLGA 4FFBA 4G4VA 5HP8A 4IIJA 3T80A 5FLXM 4X3MA 3VI6A 5EZYA 3VYUC 3CPWF 3HAXD 1SA0B 2QTPA 3HKEA 2V9YA 2ZODA 3Q8HA 5LA6B 5LOVB 2HP3A 3HWUA 2VAPA 3MCQA 3G71F 3C8LA 2Z1TA 5IYZB 1PXWA 4IHJB 3WJQA 4XCQA 2VAMA 4BVQA 1IV1A 3B6NA 2CZWA 1IV3A 2L26A 3JAKA 3CYPB 5CA0B 2WALA 1TUBA 3NK6A 5JCOA 1UI9A 5GIPC 1Q7YH 3JASA 3UT5B 1H7MA 3TD5A 1K8AH 5FNVA 3OBYA 3V3TA 4ZHWA 2HP0A 4TV8A 4EI9A 1W41A 1W55A 5ITZB 3PAFA 3JARB 1CK2A 3CPQA 1RA4A 4B62A 3J7AR 3VYSC 3CMEF 1YQNA 2PHNA 4R40B 5EO3A 5JQGA 1FNKA 2KG4A 4FFBB 3VIUA 3U0OA 4IIJB 5JH7A 2RHLA 5CB4A 2UYJA 3HKEB 4DRXA 3CCSF 4X1YB 3WJPA 2R751 2I6RA 3N4ZA 4B46A 2OTJF 2CVLA 3QHDA 3F0EA 4X1IA 4C8EA 3VCZA 2VAWA 1VQ9F 2AIFA 3VO8A 3KJJA 3VYTC 1FNJA 5DCVA 3S0YA 3JASB 5LP6A 3JATB 3D00A 4BT5A 5FNVB 4F6RA 3F0FA 2ALEA 1Q81H 2HP0B 1Z5WA 4TV8B 1XV2A 3VOBA 2OHWA 3K12A 3KHNA 4O4HA 5EYPB 1X7OA 3VTIC 1ZWZA 5CA1A 3R0PA 4BT2A 2IAFA 4RQOA 3CC2F 1J7HA 2LBTA 2GVIA 5A2QM 4O2BB 1W59A 2B33A 2F9ZC 1FSZA 4I4TA 3ON1A 1N8RH 1CN7A 4I55B 3GYQA 3LYBA 5EB1B 4G4WA 2KGWA 1RQ2A 3JAWA 4DRXB 4G4YA 3CYQA 3CG6A 1YJ9F 1U40A 2NMUA 3HKCB 1XBIA 2ZF8A 5BMVB 3FFMA 4BT7A 3IEQA 4X1IB 2R6R1 3LWQC 3ZOPA 4ZI7A 3V7QA 2UYNB 4U3JA 2H6LA 2VGNA 3C9RA 5LXTA 2K1SA 1IV2A 1GZ0A 3NMUC 2LBXA 1VQ5F 1FFXB 2OZBA 3IR9A 3NVKE 2RHHA 1SDSA 1RLUA 2PMPA 1KD1H 1Z5VA 5J2TA 3CCMF 2BTUA 4C4WC 3CCQF 4O4HB 3LWOC 3KIZA 4I50A 5JCOC 5CA1B 3ELCA 4X1KA 2HS0A 2KTUA 4TUYA 3CCVF 3RYFB 3CC4F 3C9TA 5IJ9A 5GINC 1S72F 5G4VC 2QA4F 4LNUB 4TZZA 1VQVA 3AGKA 4O4IA 5MN4A 2YXZA 1W40A 3JAWB 4U39A 1JN1A 1NJIH 4O4JB 2VGMA 3LWPC 3LDTA 3N2GA 1TVKA 1JFFA 4X20B 4O2AA 4BT3A 4ZI7B 4X3LA 1QVFF 3M84A 3HJWC 4C81A 3NVIB 5EWRA 4U3JB 1QD9A 5GONA 4ZOLA 5J2UA 4YJ2A 1YGYA 3IEWA 3E22A 2Z01A 2UYKA 2VXYA 3E20B 4EI8A 1VQ8F 3F0DA 4C8GA 3D54A 4YJ3A 1VK3A 1M1KH 1GX1A 2ZOVA 2GLZA 1COMA 5J2TB 3RA5A 3WJRA 3V7EA 5EZYB 3BYQA 3QTYA 2G9IA 4ERHA 1W3EX 2KTVA 1RQ7A 3RYIA 3M1XA 2RB9A 2HQSC 2Q1XA 5LP6C 5EIBD 3ERNA 5IJ9B 3OONA 5IJ0A 2W8BC 2Z1FA 4O4IB 4KWEA 2CWJA 1PF5A 3KJKA 3RA6A 2OTMA 3S02A 3JAKB 3CMAF 5KMGA 4EI7A 1NMUB 1TUBB 3N2GB 1TVKB 1H47A 2HRYA 3O85A 5GAPK 1X52A 2AMTA 4BVSA 1KNJA 3RE3A 2ZVZA 5J2UB 5GONB 4YJ2B 4BT4A 3S0WA 1UFYA 3E22B 1E7KA 3CD6F 3FD5A 3MQWA 4ZHQA 1T0AA 3FPIA 5LYJA 5C8YA 4YJ3B 5JQGB 3K14A 1YI2F 3PLAC 4TV9A 3RYCA 3WGKA 4C82A 2YYEA 1YHQF 1VH8A 4O4LA 1ODEA 1VQ4F 5JH7B 5CB4B 5KX5A 4E6EA 4HNAA 1YITF 3RYIB 5HWEA 3ZP7A 5HY1A 1VHAA 3I3FA 1SA0A 2IG8A 3HKBA 3CXCF 4G4XA 5IJ0B 1KC8H 4LCKA 3ZO8A 1GO1A 2HX0A 1NQ3A 1IV4A 1VQOF 3WPWA 5IYZA 4DXDA 3LWRC 4G88A 1JD1A 1YJNF 3VMFB 1VQNF 3WGLA 5LP6B 3CCJF 4F6RB 5GIOC 2FC3A 3CCRF 5B8FA 3CCUF 3JVHA 3MBMA 2Q1YA 3K0TA 3M4SA 3L7QA 3JCMM 1W5BA 4ZHQB 3N4YA 5LYJB 3G6EF 3CB2A 3FBAA 4BY9D 1XRGA 5C8YB 3J80M 2UYPA 2BTOA 2ZAUA 1VQ6F 2QI2A 3CCLF 4TV9B 3RYCB 4I4TB 3S0HA 3WGMA 1VQPF 1ONIA 4G4ZA 1U3LA 2BTQB 4NUTA 1DT9A 2DYYA 2MQEA 5HXUA 3I56F 1U43A 5EB0A 5HY4A 3OBWA 4ZHYB 1T0KB 3HKBB 4NQ3A 4X1YA
chains in the Genus database with same CATH topology
2OHWA 3JAMM 1X7OA 1QVGF 1ZWZA 3NK7A 3CC2F 3WXMB 5A2QM 3RA6A 1Q82H 2F9ZC 2I6DA 3MCAB 3E1YA 3ON1A 1N8RH 5HY0A 1Q86H 1CN7A 3GYQA 3CMAF 4EI7A 1NMUB 2OTLF 1RLGA 3O85A 5GAPK 3LWVC 1X52A 3CG6A 5FLXM 4BW0B 4BVSA 1YJ9F 4X3MA 3VI6A 3HAXD 3CPWF 1XBIA 3FFMA 4BVRA 3CCEF 3LWQC 1YIJF 4BVTA 3V7QA 5HY2A 1E7KA 3CD6F 1VQKF 3G71F 3SIUA 2VGNA 1W42A 1YI2F 1GZ0A 3J81M 3NMUC 2LBXA 3G4SF 1VQ7F 1PXWA 3PLAC 1VQ5F 4XCQA 4BVQA 2OZBA 1IPAA 2CZWA 3IR9A 3SIVA 1YHQF 3NVKE 2FGYA 1M90H 1VQ4F 1SDSA 2WALA 3NK6A 1YITF 5GIPC 1KD1H 3CCMF 1Q7YH 5HWEA 4C4WC 3CCQF 3LWOC 1H7MA 5HY1A 1K8AH 3OBYA 3V3TA 4EI9A 1W41A 2KTUA 3CXCF 3LFOA 3CCVF 3CC4F 1KC8H 4LCKA 3PAFA 5GINC 1YJWF 1S72F 1GO1A 5G4VC 5IT9M 2QA4F 4TZZA 1CK2A 3AGKA 3CPQA 1RA4A 3J7AR 2JNBA 3CMEF 5G4UC 5EO3A 1VQOF 1K9MH 1X7PA 3LWRC 1W40A 1YJNF 2KG4A 3VMFB 1VQNF 3CCJF 1NJIH 2VGMA 5GIOC 3LWPC 2LBWA 1K73H 2FC3A 3CCRF 1W2BF 3OW2F 3CCSF 3CCUF 2BO1A 3N4ZA 3JCMM 1VQMF 4X3LA 1QVFF 3HJWC 2OTJF 3NVIB 5EWRA 3N4YA 3I55F 3G6EF 2QEXF 4BY9D 3J80M 1VQ6F 2QI2A 3CCLF 1VQ9F 1VQLF 3E20B 2AIFA 4EI8A 1VQ8F 1GO0A 2HVYD 1VQPF 5HXZA 4NUTA 5FJ4C 1DT9A 1M1KH 3I56F 2GLZA 5HXUA 5HY4A 3RA5A 5DCVA 3OBWA 3V7EA 1KQSF 3D00A 1W3EX 3CC7F 1T0KB 2ALEA 1Q81H 2KTVA 4NQ3A 5GANK 1JJ2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OHW A;  3JAM M;  1X7O A;  1QVG F;  1ZWZ A;  3NK7 A;  3CC2 F;  3WXM B;  5A2Q M;  3RA6 A;  1Q82 H;  2I6D A;  3MCA B;  3E1Y A;  3ON1 A;  1N8R H;  1Q86 H;  1CN7 A;  3GYQ A;  3CMA F;  1NMU B;  2OTL F;  1RLG A;  5GAP K;  3O85 A;  3LWV C;  1X52 A;  3CG6 A;  5FLX M;  4BW0 B;  1YJ9 F;  4X3M A;  3VI6 A;  3HAX D;  3CPW F;  1XBI A;  3FFM A;  3CCE F;  3LWQ C;  1YIJ F;  3V7Q A;  1E7K A;  3CD6 F;  1VQK F;  3G71 F;  3SIU A;  2VGN A;  1W42 A;  1YI2 F;  1GZ0 A;  3J81 M;  3NMU C;  2LBX A;  3G4S F;  1VQ7 F;  1PXW A;  3PLA C;  1VQ5 F;  2OZB A;  1IPA A;  2CZW A;  3IR9 A;  3SIV A;  1YHQ F;  3NVK E;  1M90 H;  1VQ4 F;  1SDS A;  2WAL A;  3NK6 A;  1YIT F;  5GIP C;  1KD1 H;  3CCM F;  1Q7Y H;  4C4W C;  3CCQ F;  3LWO C;  1H7M A;  1K8A H;  3OBY A;  1W41 A;  2KTU A;  3CXC F;  3LFO A;  3CCV F;  3CC4 F;  1KC8 H;  4LCK A;  3PAF A;  5GIN C;  1YJW F;  1S72 F;  1GO1 A;  5G4V C;  5IT9 M;  2QA4 F;  4TZZ A;  1CK2 A;  3AGK A;  3CPQ A;  1RA4 A;  3J7A R;  2JNB A;  3CME F;  5G4U C;  5EO3 A;  1VQO F;  1K9M H;  1X7P A;  3LWR C;  1W40 A;  1YJN F;  2KG4 A;  3VMF B;  1VQN F;  3CCJ F;  1NJI H;  2VGM A;  5GIO C;  3LWP C;  2LBW A;  1K73 H;  2FC3 A;  3CCR F;  1W2B F;  3OW2 F;  3CCS F;  3CCU F;  2BO1 A;  3N4Z A;  3JCM M;  1VQM F;  4X3L A;  1QVF F;  3HJW C;  2OTJ F;  3NVI B;  5EWR A;  3N4Y A;  3I55 F;  3G6E F;  2QEX F;  4BY9 D;  3J80 M;  1VQ6 F;  2QI2 A;  3CCL F;  1VQ9 F;  1VQL F;  3E20 B;  2AIF A;  1VQ8 F;  1GO0 A;  2HVY D;  1VQP F;  4NUT A;  5FJ4 C;  1DT9 A;  1M1K H;  3I56 F;  3RA5 A;  5DCV A;  3OBW A;  3V7E A;  1KQS F;  1W3E X;  3CC7 F;  1T0K B;  2ALE A;  1Q81 H;  2KTV A;  5GAN K;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 3I7T A;  3JAM M;  3QUW A;  1QAH A;  4B45 A;  1QVG F;  5MN5 A;  1KNK A;  1OAP A;  2GZL A;  3TD3 A;  3NK7 A;  2CW4 A;  5LXT B;  3WXM B;  1U3P A;  1H48 A;  3HTN A;  1Q82 H;  2I6D A;  2RHJ A;  3MCA B;  3E1Y A;  1W5A A;  4EB6 A;  5HY0 A;  3ESJ A;  4WBN A;  2RHO A;  3LWV C;  1OFU A;  2DT4 A;  4BW0 B;  3JAT A;  3S03 A;  4I50 B;  2P6Y A;  4BVR A;  3IKE A;  4X1K B;  3CCE F;  4TUY B;  1YIJ F;  4BVT A;  5EYP A;  5HY2 A;  3GHZ A;  3F0G A;  1R1M A;  4PWT A;  1VQK F;  5EIB C;  3SIU A;  1W42 A;  4O2B A;  3J81 M;  3G4S F;  4ZK7 A;  1VQ7 F;  2UZH A;  1IPA A;  3JAL A;  3SIV A;  3VOA A;  2FGY A;  2LCA A;  3S06 A;  4I55 A;  1M90 H;  3WGJ A;  1JFF B;  4BT6 A;  4O2A B;  5JVD A;  3HKC A;  5BMV A;  4ZOL B;  2AIZ P;  3LFO A;  2CSL A;  3N2K A;  1YJW F;  3D01 A;  3ZP4 A;  5MN6 A;  5IT9 M;  2UYN A;  4EB6 B;  5AVM A;  2JNB A;  3RYH A;  5G4U C;  1W5E A;  2H8C A;  1K9M H;  4WBN B;  1X7P A;  3P10 A;  3FD6 A;  1FFX A;  3HKD A;  3GTZ A;  2IQQ A;  1W57 A;  3IKF A;  1K73 H;  2LBW A;  1Q8R A;  4C8I A;  1W2B F;  1JY8 A;  3OW2 F;  2BO1 A;  1W5F A;  5EAZ A;  2CHT A;  2H8E A;  2Z1E A;  1VQM F;  1QU9 A;  3TD4 A;  4RHA A;  3I55 F;  2QEX F;  5LA6 A;  5LOV A;  2Z1U A;  3P0Z A;  3C9S A;  3RYF A;  3EOR A;  1VQL F;  3DDN A;  4LNU A;  3DC2 A;  4M8I A;  1GO0 A;  3JAL B;  2HVY D;  5KMG B;  5HXZ A;  4B5C A;  5FJ4 C;  4IHJ A;  3F6M A;  3WGN A;  1W58 1;  2CHS A;  3KE1 A;  3WPX A;  4NWO B;  1SZQ A;  1KQS F;  4O4J A;  5JVD B;  1DBF A;  5CA0 A;  3CC7 F;  2EWC A;  5GAN K;  1JJ2 F;  1XHO A;  4X20 A;  3UT5 A;  3N2K B;  3C9U A;  3K2X A;  2HRU A;  3RYH B;  2HS3 A;  3LME A;  5ITZ A;  3JAR A;  1CLI A;  4ZHV A;  1X25 A;  1Q86 H;  3HKD B;  5HP7 A;  4O4L B;  2ZVY A;  3V4D A;  2N48 A;  5KX5 B;  3IMP A;  3MDO A;  2HS4 A;  4HNA B;  2OTL F;  3P4E A;  1RLG A;  4FFB A;  4G4V A;  5HP8 A;  4IIJ A;  3T80 A;  5FLX M;  4X3M A;  3VI6 A;  5EZY A;  3VYU C;  3CPW F;  3HAX D;  1SA0 B;  2QTP A;  3HKE A;  2V9Y A;  2ZOD A;  3Q8H A;  5LA6 B;  5LOV B;  2HP3 A;  3HWU A;  2VAP A;  3MCQ A;  3G71 F;  3C8L A;  2Z1T A;  5IYZ B;  1PXW A;  4IHJ B;  3WJQ A;  4XCQ A;  2VAM A;  4BVQ A;  1IV1 A;  3B6N A;  2CZW A;  1IV3 A;  2L26 A;  3JAK A;  3CYP B;  5CA0 B;  2WAL A;  1TUB A;  3NK6 A;  5JCO A;  1UI9 A;  5GIP C;  1Q7Y H;  3JAS A;  3UT5 B;  1H7M A;  3TD5 A;  1K8A H;  5FNV A;  3OBY A;  3V3T A;  4ZHW A;  2HP0 A;  4TV8 A;  4EI9 A;  1W41 A;  1W55 A;  5ITZ B;  3PAF A;  3JAR B;  1CK2 A;  3CPQ A;  1RA4 A;  4B62 A;  3J7A R;  3VYS C;  3CME F;  1YQN A;  2PHN A;  4R40 B;  5EO3 A;  5JQG A;  1FNK A;  2KG4 A;  4FFB B;  3VIU A;  3U0O A;  4IIJ B;  5JH7 A;  2RHL A;  5CB4 A;  2UYJ A;  3HKE B;  4DRX A;  3CCS F;  4X1Y B;  3WJP A;  2R75 1;  2I6R A;  3N4Z A;  4B46 A;  2OTJ F;  2CVL A;  3QHD A;  3F0E A;  4X1I A;  4C8E A;  3VCZ A;  2VAW A;  1VQ9 F;  2AIF A;  3VO8 A;  3KJJ A;  3VYT C;  1FNJ A;  5DCV A;  3S0Y A;  3JAS B;  5LP6 A;  3JAT B;  3D00 A;  4BT5 A;  5FNV B;  4F6R A;  3F0F A;  2ALE A;  1Q81 H;  2HP0 B;  1Z5W A;  4TV8 B;  1XV2 A;  3VOB A;  2OHW A;  3K12 A;  3KHN A;  4O4H A;  5EYP B;  1X7O A;  3VTI C;  1ZWZ A;  5CA1 A;  3R0P A;  4BT2 A;  2IAF A;  4RQO A;  3CC2 F;  1J7H A;  2LBT A;  2GVI A;  5A2Q M;  4O2B B;  1W59 A;  2B33 A;  2F9Z C;  1FSZ A;  4I4T A;  3ON1 A;  1N8R H;  1CN7 A;  4I55 B;  3GYQ A;  3LYB A;  5EB1 B;  4G4W A;  2KGW A;  1RQ2 A;  3JAW A;  4DRX B;  4G4Y A;  3CYQ A;  3CG6 A;  1YJ9 F;  1U40 A;  2NMU A;  3HKC B;  1XBI A;  2ZF8 A;  5BMV B;  3FFM A;  4BT7 A;  3IEQ A;  4X1I B;  2R6R 1;  3LWQ C;  3ZOP A;  4ZI7 A;  3V7Q A;  2UYN B;  4U3J A;  2H6L A;  2VGN A;  3C9R A;  5LXT A;  2K1S A;  1IV2 A;  1GZ0 A;  3NMU C;  2LBX A;  1VQ5 F;  1FFX B;  2OZB A;  3IR9 A;  3NVK E;  2RHH A;  1SDS A;  1RLU A;  2PMP A;  1KD1 H;  1Z5V A;  5J2T A;  3CCM F;  2BTU A;  4C4W C;  3CCQ F;  4O4H B;  3LWO C;  3KIZ A;  4I50 A;  5JCO C;  5CA1 B;  3ELC A;  4X1K A;  2HS0 A;  2KTU A;  4TUY A;  3CCV F;  3RYF B;  3CC4 F;  3C9T A;  5IJ9 A;  5GIN C;  1S72 F;  5G4V C;  2QA4 F;  4LNU B;  4TZZ A;  1VQV A;  3AGK A;  4O4I A;  5MN4 A;  2YXZ A;  1W40 A;  3JAW B;  4U39 A;  1JN1 A;  1NJI H;  4O4J B;  2VGM A;  3LWP C;  3LDT A;  3N2G A;  1TVK A;  1JFF A;  4X20 B;  4O2A A;  4BT3 A;  4ZI7 B;  4X3L A;  1QVF F;  3M84 A;  3HJW C;  4C81 A;  3NVI B;  5EWR A;  4U3J B;  1QD9 A;  5GON A;  4ZOL A;  5J2U A;  4YJ2 A;  1YGY A;  3IEW A;  3E22 A;  2Z01 A;  2UYK A;  2VXY A;  3E20 B;  4EI8 A;  1VQ8 F;  3F0D A;  4C8G A;  3D54 A;  4YJ3 A;  1VK3 A;  1M1K H;  1GX1 A;  2ZOV A;  2GLZ A;  1COM A;  5J2T B;  3RA5 A;  3WJR A;  3V7E A;  5EZY B;  3BYQ A;  3QTY A;  2G9I A;  4ERH A;  1W3E X;  2KTV A;  1RQ7 A;  3RYI A;  3M1X A;  2RB9 A;  2HQS C;  2Q1X A;  5LP6 C;  5EIB D;  3ERN A;  5IJ9 B;  3OON A;  5IJ0 A;  2W8B C;  2Z1F A;  4O4I B;  4KWE A;  2CWJ A;  1PF5 A;  3KJK A;  3RA6 A;  2OTM A;  3S02 A;  3JAK B;  3CMA F;  5KMG A;  4EI7 A;  1NMU B;  1TUB B;  3N2G B;  1TVK B;  1H47 A;  2HRY A;  3O85 A;  5GAP K;  1X52 A;  2AMT A;  4BVS A;  1KNJ A;  3RE3 A;  2ZVZ A;  5J2U B;  5GON B;  4YJ2 B;  4BT4 A;  3S0W A;  1UFY A;  3E22 B;  1E7K A;  3CD6 F;  3FD5 A;  3MQW A;  4ZHQ A;  1T0A A;  3FPI A;  5LYJ A;  5C8Y A;  4YJ3 B;  5JQG B;  3K14 A;  1YI2 F;  3PLA C;  4TV9 A;  3RYC A;  3WGK A;  4C82 A;  2YYE A;  1YHQ F;  1VH8 A;  4O4L A;  1ODE A;  1VQ4 F;  5JH7 B;  5CB4 B;  5KX5 A;  4E6E A;  4HNA A;  1YIT F;  3RYI B;  5HWE A;  3ZP7 A;  5HY1 A;  1VHA A;  3I3F A;  1SA0 A;  2IG8 A;  3HKB A;  3CXC F;  4G4X A;  5IJ0 B;  1KC8 H;  4LCK A;  3ZO8 A;  1GO1 A;  2HX0 A;  1NQ3 A;  1IV4 A;  1VQO F;  3WPW A;  5IYZ A;  4DXD A;  3LWR C;  4G88 A;  1JD1 A;  1YJN F;  3VMF B;  1VQN F;  3WGL A;  5LP6 B;  3CCJ F;  4F6R B;  5GIO C;  2FC3 A;  3CCR F;  5B8F A;  3CCU F;  3JVH A;  3MBM A;  2Q1Y A;  3K0T A;  3M4S A;  3L7Q A;  3JCM M;  1W5B A;  4ZHQ B;  3N4Y A;  5LYJ B;  3G6E F;  3CB2 A;  3FBA A;  4BY9 D;  1XRG A;  5C8Y B;  3J80 M;  2UYP A;  2BTO A;  2ZAU A;  1VQ6 F;  2QI2 A;  3CCL F;  4TV9 B;  3RYC B;  4I4T B;  3S0H A;  3WGM A;  1VQP F;  1ONI A;  4G4Z A;  1U3L A;  2BTQ B;  4NUT A;  1DT9 A;  2DYY A;  2MQE A;  5HXU A;  3I56 F;  1U43 A;  5EB0 A;  5HY4 A;  3OBW A;  4ZHY B;  1T0K B;  3HKB B;  4NQ3 A;  4X1Y A; 
#chains in the Genus database with same CATH homology
 2OHW A;  3JAM M;  1X7O A;  1QVG F;  1ZWZ A;  3NK7 A;  3CC2 F;  3WXM B;  5A2Q M;  3RA6 A;  1Q82 H;  2F9Z C;  2I6D A;  3MCA B;  3E1Y A;  3ON1 A;  1N8R H;  5HY0 A;  1Q86 H;  1CN7 A;  3GYQ A;  3CMA F;  4EI7 A;  1NMU B;  2OTL F;  1RLG A;  3O85 A;  5GAP K;  3LWV C;  1X52 A;  3CG6 A;  5FLX M;  4BW0 B;  4BVS A;  1YJ9 F;  4X3M A;  3VI6 A;  3HAX D;  3CPW F;  1XBI A;  3FFM A;  4BVR A;  3CCE F;  3LWQ C;  1YIJ F;  4BVT A;  3V7Q A;  5HY2 A;  1E7K A;  3CD6 F;  1VQK F;  3G71 F;  3SIU A;  2VGN A;  1W42 A;  1YI2 F;  1GZ0 A;  3J81 M;  3NMU C;  2LBX A;  3G4S F;  1VQ7 F;  1PXW A;  3PLA C;  1VQ5 F;  4XCQ A;  4BVQ A;  2OZB A;  1IPA A;  2CZW A;  3IR9 A;  3SIV A;  1YHQ F;  3NVK E;  2FGY A;  1M90 H;  1VQ4 F;  1SDS A;  2WAL A;  3NK6 A;  1YIT F;  5GIP C;  1KD1 H;  3CCM F;  1Q7Y H;  5HWE A;  4C4W C;  3CCQ F;  3LWO C;  1H7M A;  5HY1 A;  1K8A H;  3OBY A;  3V3T A;  4EI9 A;  1W41 A;  2KTU A;  3CXC F;  3LFO A;  3CCV F;  3CC4 F;  1KC8 H;  4LCK A;  3PAF A;  5GIN C;  1YJW F;  1S72 F;  1GO1 A;  5G4V C;  5IT9 M;  2QA4 F;  4TZZ A;  1CK2 A;  3AGK A;  3CPQ A;  1RA4 A;  3J7A R;  2JNB A;  3CME F;  5G4U C;  5EO3 A;  1VQO F;  1K9M H;  1X7P A;  3LWR C;  1W40 A;  1YJN F;  2KG4 A;  3VMF B;  1VQN F;  3CCJ F;  1NJI H;  2VGM A;  5GIO C;  3LWP C;  2LBW A;  1K73 H;  2FC3 A;  3CCR F;  1W2B F;  3OW2 F;  3CCS F;  3CCU F;  2BO1 A;  3N4Z A;  3JCM M;  1VQM F;  4X3L A;  1QVF F;  3HJW C;  2OTJ F;  3NVI B;  5EWR A;  3N4Y A;  3I55 F;  3G6E F;  2QEX F;  4BY9 D;  3J80 M;  1VQ6 F;  2QI2 A;  3CCL F;  1VQ9 F;  1VQL F;  3E20 B;  2AIF A;  4EI8 A;  1VQ8 F;  1GO0 A;  2HVY D;  1VQP F;  5HXZ A;  4NUT A;  5FJ4 C;  1DT9 A;  1M1K H;  3I56 F;  2GLZ A;  5HXU A;  5HY4 A;  3RA5 A;  5DCV A;  3OBW A;  3V7E A;  1KQS F;  3D00 A;  1W3E X;  3CC7 F;  1T0K B;  2ALE A;  1Q81 H;  2KTV A;  4NQ3 A;  5GAN K;  1JJ2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...