3PO2I

Arrested rna polymerase ii elongation complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po2I02
1N2FA 3D6WA 3I4NI 5C4XI 3EERA 3S16I 3GCFA 4A3II 4A93I 3K7AI 2JA5I 3HOVI 1TWGI 1DL6A 1SFOI 2JR6A 3VMGA 4BBRI 1X3WA 3HOWI 1VLAA 3H0GI 3M3YI 5CM2M 3HOUI 2JNYA 3GTOI 2JA8I 4Y52I 3I07A 4NOZA 4A3FI 3HOXI 4A3CI 4BY1I 2DE6A 2DE7A 1LQLA 5IP9I 2DE5A 3GKQA 1X3ZA 4A3JI 3S14I 3FKII 1YUAA 4BY7I 1I3QI 2P3YA 1RO4A 4A3KI 3U50C 3S1NI 2JA6I 1ZB9A 3PO2I 2JS4A 4A3EI 1L1OC 1ZB8A 4NBAA 1TWAI 2AKLA 5C3EI 3S1QI 4XX2A 4QTUA 2R93I 5FLMI 1TFIA 3M4OI 2F4MA 2E2HI 4NBFA 1I6HI 4NBBA 3PO3S 1TWFI 5C4JI 1R9TI 3GTQI 2NVXI 3VB9A 2RBLA 3GTPI 3S15I 3RZOI 3S2HI 3PO3I 1Y1VI 3I4MI 2R92I 2VUMI 4BXXI 3RZDI 3S1MI 4NBEA 4NBDA 3S1RI 4NB8A 1NUIA 1Y1VS 3GTJI 1Y1WI 4Y7NI 2JA7I 2HF1A 1WCMI 4A3BI 3HOZI 2F4OA 1USPA 2NVYI 4X6AI 3LUSA 5IP7I 2BJOA 1QYPA 4NB9A 2E2JI 2B63I 3Q87A 2J6AA 3ESWA 3S2DI 4A3MI 1PFTA 1USPB 1WW9A 3S17I 5C44I 1TWHI 3CQZI 2NVTI 4MH4A 3VMHA 2NVQI 2R7ZI 3HOYI 4NBHA 3GTLI 4BBSI 3GTKI 2K5RA 1ML8A 2PK7A 1I50I 3GTMS 1TWCI 1K83I 2YU9I 2E2II 4A3DI 3GTMI 3GTGI 4A3GI 4NBGA 3VMIA 4QTTA 4A3LI 2KPIA 4NBCA 3H3VJ 1RLYA
chains in the Genus database with same CATH superfamily
3D6WA 5C4XI 3EERA 4A93I 3K7AI 2AYDA 1W2BY 2IZ4A 3J81b 3JAMf 1RNIA 1QF8A 3G711 1VQ81 4E33A 3TDHB 1FDOA 2W04A 3P5JB 3GKQA 4A3JI 3CC21 3IR7A 3CCQ1 4BY7I 2KI7B 3NH4A 2P3YA 2JUBA 1QVGY 4EWCA 3U50C 4E2ZA 3CCUZ 2JS4A 2JIPA 4NBAA 5C3EI 3CCSZ 3S1QI 1M902 4XX2A 3CCE1 2E7ZA 1TFIA 5D1OB 2OTL1 5C4JI 1ZH1A 2G2KA 2I3CA 3S2HI 5D1OA 2QEX1 1Y1VI 1KD12 1SIWA 3J81f 1YJN1 1Q861 2RIQA 3S1MI 3CCU1 1NUIA 3GTJI 4Y7NI 4E30A 1WCMI 4A3BI 1S721 3CCEZ 1USPA 1YI2Z 2YADA 2NVYI 4NH1C 1Q7Y1 3CPWY 2BJOA 1QYPA 3G6EZ 3CXCY 2E2JI 2B63I 2J6AA 1RO0A 1USPB 4RS4A 1WW9A 1VQ71 2NVTI 1VQO1 4NBHA 1YJNZ 4MD9A 3F3PC 1K9M2 2OZKA 4MRIA 3D2LA 1NJI2 2E2II 2RPRA 3QWUA 3OW2Y 1VQK1 1RO2A 1S72Z 1YI21 3VMIA 4A3LI 2OTJ1 1AA6A 2O53A 1Y8CA 3H3VJ 3BG0B 3CMAZ 2JIRA 3GCFA 3IX0A 4MD7A 3HOVI 2VPWA 1DL6A 2JR6A 2V3VA 1X3WA 1VQOZ 3EEDA 3M3YI 5CM2M 1VQNZ 3NDJA 1W2BZ 4Y52I 3I07A 4A3FI 2LEXA 1YJWZ 1WIIA 4A3CI 5IP9I 3CCR1 3CCLZ 1VQ5Z 1X3ZA 3CMA1 5T67A 3FQQA 3S14I 1Q16A 3FKII 1QVGZ 1YIJ1 4A3KI 2Y0SA 1ZB9A 1YJ91 3KIFA 4MD8A 2R93I 1VQP1 1KC82 5FLMI 1Q822 1Q821 2QLVB 1VQ91 1K9M1 3CCL1 1JJ2Y 2E2HI 4NBFA 1VQ51 1TWFI 3I55Z 2NVXI 2GTIA 2IZ3A 2RBLA 2QKDA 1N8R1 3S15I 3PO3I 1QVFZ 3T4NB 2R92I 2EGTA 4BXXI 1YITZ 2QRCB 4NBEA 3S1RI 2P28A 2W03A 2QRDB 1VQLZ 2JA7I 2IV2X 4CL1A 3MONA 1VQ9Z 2OOXB 2VPYA 3FQMA 2LFUA 2VUGA 2Q51A 3ESWA 3S2DI 3CC41 3S17I 4MH4A 3J80f 2OOYB 4DGLA 3CCVZ 3CXCZ 1VQMZ 3GTMI 3CMEZ 3GTGI 1M901 4QTTA 3OW2Z 4RV9A 4RVDA 1N2FA 3S16I 3CD61 5A2Qb 2JA5I 1TWGI 1SFOI 3VMGA 4BBRI 3HOWI 3NDIA 2JMOA 1WZNA 4E2XA 3CCV1 3GTOI 1K732 4MONA 2K3RA 3HOXI 2PM9A 4BY1I 2DE6A 2DE7A 2GU2A 5LL6f 3CCJZ 5FLXf 2RHBA 2GTHA 1M1K1 2M48A 3CD6Z 5IT9b 1K8A2 1Q862 3S1NI 2JA6I 3PO2I 4A3EI 1L1OC 3CCMZ 2O4HA 2AKLA 1K8A1 4MXUA 4HH4A 3JAMb 1YUKA 3G4S1 3MZKB 1I6HI 4NBBA 3PO3S 3GTQI 2WB1A 2V8IA 4RVGA 3CC2Z 3GTPI 3CCQZ 3HKZA 1VQ41 2VUMI 1VQ6Z 2Q4ZA 4NBDA 2RT9A 4NB8A 1JJ2Z 3KIHA 3CCM1 1Q812 3CCS1 2HF1A 2F4OA 1KC81 3LUSA 1QVFY 3G4SZ 2OTJZ 4S1TA 1RQFA 2HU9A 4NB9A 2OTLZ 3Q87A 2LIYA 4A3MI 1PFTA 2JIMA 3CQZI 1NP6A 3VMHA 2QEXZ 3HOYI 4BBSI 1YHQ1 1VQ4Z 3J80b 2PK7A 1VQ61 1KRLA 3GTMS 2JIOA 1Z03A 2YU9I 2NAPA 4NFRA 2QA4Z 4A3GI 4NBGA 3J7A4 1P9NA 2KPIA 4RVFA 3CCRZ 3G6E1 2ZAEB 3I4NI 2VPXA 4A3II 2V8JA 3IF8A 1VQ7Z 1KQSZ 2M6NA 1VLAA 4DQYB 3H0GI 1YHQZ 1Z02A 1KQSY 4HGYA 3HOUI 2JNYA 4RVHA 2JA8I 3IFUA 4NOZA 3NFZA 2QA41 1VQKZ 1S7MA 4DK1A 1LQLA 3BG1B 2DE5A 1VQPZ 4E2YA 2QREB 2R6MA 1NJI1 2VPZA 1YUAA 3D9XA 1I3QI 1RO4A 1VQN1 3I56Z 3MZLB 1YIT1 2JIQA 3NH5A 5D1PA 1ZB8A 1TWAI 1YJW1 5T6BA 4QTUA 1JWHC 3M4OI 2F4MA 3F3FC 2PMZA 1R9TI 3CC4Z 5FLXb 2QR1B 3VB9A 1X0TA 1YIJZ 3RZOI 4E2WA 1Z01A 1FDIA 2VF1A 3I4MI 2V45A 1N8R2 3I561 3RZDI 2E9HA 1Y1VS 1YJ9Z 1VQM1 1Y1WI 3TE5B 1WJ2A 3CME1 3CPWZ 3HOZI 4E32A 5AN9F 5T64A 4X6AI 1Q811 3NH8A 5IP7I 4HGZA 3CC7Z 5A2Qf 1M1K2 3I551 5C44I 1TWHI 2NVQI 2R7ZI 1QXFA 3GTLI 2V8KA 1Q7Y2 3VTNA 3GTKI 5IT9f 1K731 2K5RA 1ML8A 1I50I 1TWCI 1K83I 3G71Z 1VQL1 1VQ8Z 2WAQA 4A3DI 4AYBA 2H85A 4TNUA 4E31A 4NBCA 3CCJ1 1KD11 3CC71 1RLYA
chains in the Genus database with same CATH topology
3D6WA 5C4XI 3EERA 4A93I 3K7AI 1W2BY 2IZ4A 3J81b 3JAMf 1RNIA 1QF8A 3G711 1VQ81 4E33A 3TDHB 2W04A 3P5JB 3GKQA 4A3JI 3CC21 3CCQ1 4BY7I 2KI7B 3NH4A 2P3YA 2JUBA 1QVGY 4EWCA 3U50C 4E2ZA 3CCUZ 2JS4A 4NBAA 5C3EI 3CCSZ 3S1QI 1M902 4XX2A 3CCE1 1TFIA 5D1OB 2OTL1 5C4JI 1ZH1A 2G2KA 2I3CA 3S2HI 5D1OA 2QEX1 1Y1VI 1KD12 3J81f 1YJN1 1Q861 2RIQA 3S1MI 3CCU1 1NUIA 3GTJI 4Y7NI 4E30A 1WCMI 4A3BI 1S721 3CCEZ 1USPA 1YI2Z 2YADA 2NVYI 4NH1C 1Q7Y1 3CPWY 2BJOA 1QYPA 3G6EZ 3CXCY 2E2JI 2B63I 2J6AA 1RO0A 1USPB 4RS4A 1WW9A 1VQ71 2NVTI 1VQO1 4NBHA 1YJNZ 4MD9A 3F3PC 1K9M2 2OZKA 4MRIA 1NJI2 2E2II 2RPRA 3QWUA 3OW2Y 1VQK1 1RO2A 1S72Z 1YI21 3VMIA 4A3LI 2OTJ1 2O53A 3H3VJ 3BG0B 3CMAZ 3GCFA 3IX0A 4MD7A 3HOVI 1DL6A 2JR6A 1X3WA 1VQOZ 3EEDA 3M3YI 5CM2M 1VQNZ 3NDJA 4Y52I 3I07A 4A3FI 1YJWZ 1WIIA 4A3CI 5IP9I 3CCR1 3CCLZ 1VQ5Z 1X3ZA 3CMA1 5T67A 3FQQA 3S14I 3FKII 1QVGZ 1YIJ1 4A3KI 2Y0SA 1ZB9A 1YJ91 3KIFA 4MD8A 2R93I 1VQP1 1KC82 5FLMI 1Q822 1Q821 2QLVB 1VQ91 1K9M1 3CCL1 1JJ2Y 2E2HI 4NBFA 1VQ51 1TWFI 3I55Z 2NVXI 2GTIA 2IZ3A 2RBLA 2QKDA 1N8R1 3S15I 3PO3I 1QVFZ 3T4NB 2R92I 2EGTA 4BXXI 1YITZ 2QRCB 4NBEA 3S1RI 2P28A 2W03A 2QRDB 1VQLZ 2JA7I 4CL1A 3MONA 1VQ9Z 2OOXB 3FQMA 2LFUA 2VUGA 2Q51A 3ESWA 3S2DI 3CC41 3S17I 4MH4A 3J80f 2OOYB 4DGLA 3CCVZ 3CXCZ 1VQMZ 3GTMI 3CMEZ 3GTGI 1M901 4QTTA 3OW2Z 4RV9A 4RVDA 1N2FA 3S16I 3CD61 5A2Qb 2JA5I 1TWGI 1SFOI 3VMGA 4BBRI 3HOWI 3NDIA 2JMOA 4E2XA 3CCV1 3GTOI 1K732 4MONA 2K3RA 3HOXI 2PM9A 4BY1I 2DE6A 2DE7A 2GU2A 5LL6f 3CCJZ 5FLXf 2RHBA 2GTHA 1M1K1 2M48A 3CD6Z 5IT9b 1K8A2 1Q862 3S1NI 2JA6I 3PO2I 4A3EI 1L1OC 3CCMZ 2O4HA 2AKLA 1K8A1 4MXUA 4HH4A 3JAMb 1YUKA 3G4S1 3MZKB 1I6HI 4NBBA 3PO3S 3GTQI 2WB1A 2V8IA 4RVGA 3CC2Z 3GTPI 3CCQZ 3HKZA 1VQ41 2VUMI 1VQ6Z 2Q4ZA 4NBDA 2RT9A 4NB8A 1JJ2Z 3KIHA 3CCM1 1Q812 3CCS1 2HF1A 2F4OA 1KC81 3LUSA 1QVFY 3G4SZ 2OTJZ 4S1TA 1RQFA 2HU9A 4NB9A 2OTLZ 3Q87A 2LIYA 4A3MI 1PFTA 3CQZI 1NP6A 3VMHA 2QEXZ 3HOYI 4BBSI 1YHQ1 1VQ4Z 3J80b 2PK7A 1VQ61 1KRLA 3GTMS 1Z03A 2YU9I 4NFRA 2QA4Z 4A3GI 4NBGA 3J7A4 1P9NA 2KPIA 4RVFA 3CCRZ 3G6E1 2ZAEB 3I4NI 4A3II 2V8JA 3IF8A 1VQ7Z 1KQSZ 2M6NA 1VLAA 4DQYB 3H0GI 1YHQZ 1Z02A 1KQSY 4HGYA 3HOUI 2JNYA 4RVHA 2JA8I 3IFUA 4NOZA 3NFZA 2QA41 1VQKZ 1S7MA 4DK1A 1LQLA 3BG1B 2DE5A 1VQPZ 4E2YA 2QREB 2R6MA 1NJI1 1YUAA 3D9XA 1I3QI 1RO4A 1VQN1 3I56Z 3MZLB 1YIT1 3NH5A 5D1PA 1ZB8A 1TWAI 1YJW1 5T6BA 4QTUA 1JWHC 1RLYA 3M4OI 2F4MA 3F3FC 2PMZA 1R9TI 3CC4Z 5FLXb 2QR1B 3VB9A 1X0TA 1YIJZ 3RZOI 4E2WA 1Z01A 2VF1A 3I4MI 1N8R2 3I561 3RZDI 2E9HA 1Y1VS 1YJ9Z 1VQM1 1Y1WI 3TE5B 3CME1 3CPWZ 3HOZI 4E32A 5AN9F 5T64A 4X6AI 1Q811 3NH8A 5IP7I 4HGZA 3CC7Z 5A2Qf 1M1K2 3I551 5C44I 1TWHI 2NVQI 2R7ZI 3GTLI 2V8KA 1Q7Y2 3VTNA 3GTKI 5IT9f 1K731 2K5RA 1ML8A 1I50I 1TWCI 1K83I 3G71Z 1VQL1 1VQ8Z 2WAQA 4A3DI 4AYBA 2H85A 4TNUA 4E31A 4NBCA 3CCJ1 1KD11 3CC71 1W2BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  3D6W A;  3I4N I;  5C4X I;  3EER A;  3S16 I;  3GCF A;  4A3I I;  4A93 I;  3K7A I;  2JA5 I;  3HOV I;  1TWG I;  1DL6 A;  1SFO I;  2JR6 A;  3VMG A;  4BBR I;  1X3W A;  3HOW I;  1VLA A;  3H0G I;  3M3Y I;  5CM2 M;  3HOU I;  2JNY A;  3GTO I;  2JA8 I;  4Y52 I;  3I07 A;  4NOZ A;  4A3F I;  3HOX I;  4A3C I;  4BY1 I;  2DE6 A;  2DE7 A;  1LQL A;  5IP9 I;  2DE5 A;  3GKQ A;  1X3Z A;  4A3J I;  3S14 I;  3FKI I;  1YUA A;  4BY7 I;  1I3Q I;  2P3Y A;  1RO4 A;  4A3K I;  3U50 C;  3S1N I;  2JA6 I;  1ZB9 A;  3PO2 I;  2JS4 A;  4A3E I;  1L1O C;  1ZB8 A;  4NBA A;  1TWA I;  2AKL A;  5C3E I;  3S1Q I;  4XX2 A;  4QTU A;  2R93 I;  5FLM I;  1TFI A;  3M4O I;  2F4M A;  2E2H I;  4NBF A;  1I6H I;  4NBB A;  3PO3 S;  1TWF I;  5C4J I;  1R9T I;  3GTQ I;  2NVX I;  3VB9 A;  2RBL A;  3GTP I;  3S15 I;  3RZO I;  3S2H I;  3PO3 I;  1Y1V I;  3I4M I;  2R92 I;  2VUM I;  4BXX I;  3RZD I;  3S1M I;  4NBE A;  4NBD A;  3S1R I;  4NB8 A;  1NUI A;  1Y1V S;  3GTJ I;  1Y1W I;  4Y7N I;  2JA7 I;  2HF1 A;  1WCM I;  4A3B I;  3HOZ I;  2F4O A;  1USP A;  2NVY I;  4X6A I;  3LUS A;  5IP7 I;  2BJO A;  1QYP A;  4NB9 A;  2E2J I;  2B63 I;  3Q87 A;  2J6A A;  3ESW A;  3S2D I;  4A3M I;  1PFT A;  1USP B;  1WW9 A;  3S17 I;  5C44 I;  1TWH I;  3CQZ I;  2NVT I;  4MH4 A;  3VMH A;  2NVQ I;  2R7Z I;  3HOY I;  4NBH A;  3GTL I;  4BBS I;  3GTK I;  2K5R A;  1ML8 A;  2PK7 A;  1I50 I;  3GTM S;  1TWC I;  1K83 I;  2YU9 I;  2E2I I;  4A3D I;  3GTM I;  3GTG I;  4A3G I;  4NBG A;  3VMI A;  4QTT A;  4A3L I;  2KPI A;  4NBC A;  3H3V J;  1RLY A; 
#chains in the Genus database with same CATH topology
 3D6W A;  5C4X I;  3EER A;  4A93 I;  3K7A I;  2AYD A;  1W2B Y;  2IZ4 A;  3J81 b;  3JAM f;  1RNI A;  1QF8 A;  3G71 1;  1VQ8 1;  4E33 A;  3TDH B;  1FDO A;  2W04 A;  3P5J B;  3GKQ A;  4A3J I;  3CC2 1;  3IR7 A;  3CCQ 1;  4BY7 I;  2KI7 B;  3NH4 A;  2P3Y A;  2JUB A;  1QVG Y;  4EWC A;  3U50 C;  4E2Z A;  3CCU Z;  2JS4 A;  2JIP A;  4NBA A;  5C3E I;  3CCS Z;  3S1Q I;  1M90 2;  4XX2 A;  3CCE 1;  2E7Z A;  1TFI A;  5D1O B;  2OTL 1;  5C4J I;  1ZH1 A;  2G2K A;  2I3C A;  3S2H I;  5D1O A;  2QEX 1;  1Y1V I;  1KD1 2;  1SIW A;  3J81 f;  1YJN 1;  1Q86 1;  2RIQ A;  3S1M I;  3CCU 1;  1NUI A;  3GTJ I;  4Y7N I;  4E30 A;  1WCM I;  4A3B I;  1S72 1;  3CCE Z;  1USP A;  1YI2 Z;  2YAD A;  2NVY I;  4NH1 C;  1Q7Y 1;  3CPW Y;  2BJO A;  1QYP A;  3G6E Z;  3CXC Y;  2E2J I;  2B63 I;  2J6A A;  1RO0 A;  1USP B;  4RS4 A;  1WW9 A;  1VQ7 1;  2NVT I;  1VQO 1;  4NBH A;  1YJN Z;  4MD9 A;  3F3P C;  1K9M 2;  2OZK A;  4MRI A;  3D2L A;  1NJI 2;  2E2I I;  2RPR A;  3QWU A;  3OW2 Y;  1VQK 1;  1RO2 A;  1S72 Z;  1YI2 1;  3VMI A;  4A3L I;  2OTJ 1;  1AA6 A;  2O53 A;  1Y8C A;  3H3V J;  3BG0 B;  3CMA Z;  2JIR A;  3GCF A;  3IX0 A;  4MD7 A;  3HOV I;  2VPW A;  1DL6 A;  2JR6 A;  2V3V A;  1X3W A;  1VQO Z;  3EED A;  3M3Y I;  5CM2 M;  1VQN Z;  3NDJ A;  1W2B Z;  4Y52 I;  3I07 A;  4A3F I;  2LEX A;  1YJW Z;  1WII A;  4A3C I;  5IP9 I;  3CCR 1;  3CCL Z;  1VQ5 Z;  1X3Z A;  3CMA 1;  5T67 A;  3FQQ A;  3S14 I;  1Q16 A;  3FKI I;  1QVG Z;  1YIJ 1;  4A3K I;  2Y0S A;  1ZB9 A;  1YJ9 1;  3KIF A;  4MD8 A;  2R93 I;  1VQP 1;  1KC8 2;  5FLM I;  1Q82 2;  1Q82 1;  2QLV B;  1VQ9 1;  1K9M 1;  3CCL 1;  1JJ2 Y;  2E2H I;  4NBF A;  1VQ5 1;  1TWF I;  3I55 Z;  2NVX I;  2GTI A;  2IZ3 A;  2RBL A;  2QKD A;  1N8R 1;  3S15 I;  3PO3 I;  1QVF Z;  3T4N B;  2R92 I;  2EGT A;  4BXX I;  1YIT Z;  2QRC B;  4NBE A;  3S1R I;  2P28 A;  2W03 A;  2QRD B;  1VQL Z;  2JA7 I;  2IV2 X;  4CL1 A;  3MON A;  1VQ9 Z;  2OOX B;  2VPY A;  3FQM A;  2LFU A;  2VUG A;  2Q51 A;  3ESW A;  3S2D I;  3CC4 1;  3S17 I;  4MH4 A;  3J80 f;  2OOY B;  4DGL A;  3CCV Z;  3CXC Z;  1VQM Z;  3GTM I;  3CME Z;  3GTG I;  1M90 1;  4QTT A;  3OW2 Z;  4RV9 A;  4RVD A;  1N2F A;  3S16 I;  3CD6 1;  5A2Q b;  2JA5 I;  1TWG I;  1SFO I;  3VMG A;  4BBR I;  3HOW I;  3NDI A;  2JMO A;  1WZN A;  4E2X A;  3CCV 1;  3GTO I;  1K73 2;  4MON A;  2K3R A;  3HOX I;  2PM9 A;  4BY1 I;  2DE6 A;  2DE7 A;  2GU2 A;  5LL6 f;  3CCJ Z;  5FLX f;  2RHB A;  2GTH A;  1M1K 1;  2M48 A;  3CD6 Z;  5IT9 b;  1K8A 2;  1Q86 2;  3S1N I;  2JA6 I;  3PO2 I;  4A3E I;  1L1O C;  3CCM Z;  2O4H A;  2AKL A;  1K8A 1;  4MXU A;  4HH4 A;  3JAM b;  1YUK A;  3G4S 1;  3MZK B;  1I6H I;  4NBB A;  3PO3 S;  3GTQ I;  2WB1 A;  2V8I A;  4RVG A;  3CC2 Z;  3GTP I;  3CCQ Z;  3HKZ A;  1VQ4 1;  2VUM I;  1VQ6 Z;  2Q4Z A;  4NBD A;  2RT9 A;  4NB8 A;  1JJ2 Z;  3KIH A;  3CCM 1;  1Q81 2;  3CCS 1;  2HF1 A;  2F4O A;  1KC8 1;  3LUS A;  1QVF Y;  3G4S Z;  2OTJ Z;  4S1T A;  1RQF A;  2HU9 A;  4NB9 A;  2OTL Z;  3Q87 A;  2LIY A;  4A3M I;  1PFT A;  2JIM A;  3CQZ I;  1NP6 A;  3VMH A;  2QEX Z;  3HOY I;  4BBS I;  1YHQ 1;  1VQ4 Z;  3J80 b;  2PK7 A;  1VQ6 1;  1KRL A;  3GTM S;  2JIO A;  1Z03 A;  2YU9 I;  2NAP A;  4NFR A;  2QA4 Z;  4A3G I;  4NBG A;  3J7A 4;  1P9N A;  2KPI A;  4RVF A;  3CCR Z;  3G6E 1;  2ZAE B;  3I4N I;  2VPX A;  4A3I I;  2V8J A;  3IF8 A;  1VQ7 Z;  1KQS Z;  2M6N A;  1VLA A;  4DQY B;  3H0G I;  1YHQ Z;  1Z02 A;  1KQS Y;  4HGY A;  3HOU I;  2JNY A;  4RVH A;  2JA8 I;  3IFU A;  4NOZ A;  3NFZ A;  2QA4 1;  1VQK Z;  1S7M A;  4DK1 A;  1LQL A;  3BG1 B;  2DE5 A;  1VQP Z;  4E2Y A;  2QRE B;  2R6M A;  1NJI 1;  2VPZ A;  1YUA A;  3D9X A;  1I3Q I;  1RO4 A;  1VQN 1;  3I56 Z;  3MZL B;  1YIT 1;  2JIQ A;  3NH5 A;  5D1P A;  1ZB8 A;  1TWA I;  1YJW 1;  5T6B A;  4QTU A;  1JWH C;  3M4O I;  2F4M A;  3F3F C;  2PMZ A;  1R9T I;  3CC4 Z;  5FLX b;  2QR1 B;  3VB9 A;  1X0T A;  1YIJ Z;  3RZO I;  4E2W A;  1Z01 A;  1FDI A;  2VF1 A;  3I4M I;  2V45 A;  1N8R 2;  3I56 1;  3RZD I;  2E9H A;  1Y1V S;  1YJ9 Z;  1VQM 1;  1Y1W I;  3TE5 B;  1WJ2 A;  3CME 1;  3CPW Z;  3HOZ I;  4E32 A;  5AN9 F;  5T64 A;  4X6A I;  1Q81 1;  3NH8 A;  5IP7 I;  4HGZ A;  3CC7 Z;  5A2Q f;  1M1K 2;  3I55 1;  5C44 I;  1TWH I;  2NVQ I;  2R7Z I;  1QXF A;  3GTL I;  2V8K A;  1Q7Y 2;  3VTN A;  3GTK I;  5IT9 f;  1K73 1;  2K5R A;  1ML8 A;  1I50 I;  1TWC I;  1K83 I;  3G71 Z;  1VQL 1;  1VQ8 Z;  2WAQ A;  4A3D I;  4AYB A;  2H85 A;  4TNU A;  4E31 A;  4NBC A;  3CCJ 1;  1KD1 1;  3CC7 1;  1RLY A; 
#chains in the Genus database with same CATH homology
 3D6W A;  5C4X I;  3EER A;  4A93 I;  3K7A I;  1W2B Y;  2IZ4 A;  3J81 b;  3JAM f;  1RNI A;  1QF8 A;  3G71 1;  1VQ8 1;  4E33 A;  3TDH B;  2W04 A;  3P5J B;  3GKQ A;  4A3J I;  3CC2 1;  3CCQ 1;  4BY7 I;  2KI7 B;  3NH4 A;  2P3Y A;  2JUB A;  1QVG Y;  4EWC A;  3U50 C;  4E2Z A;  3CCU Z;  2JS4 A;  4NBA A;  5C3E I;  3CCS Z;  3S1Q I;  1M90 2;  4XX2 A;  3CCE 1;  1TFI A;  5D1O B;  2OTL 1;  5C4J I;  1ZH1 A;  2G2K A;  2I3C A;  3S2H I;  5D1O A;  2QEX 1;  1Y1V I;  1KD1 2;  3J81 f;  1YJN 1;  1Q86 1;  2RIQ A;  3S1M I;  3CCU 1;  1NUI A;  3GTJ I;  4Y7N I;  4E30 A;  1WCM I;  4A3B I;  1S72 1;  3CCE Z;  1USP A;  1YI2 Z;  2YAD A;  2NVY I;  4NH1 C;  1Q7Y 1;  3CPW Y;  2BJO A;  1QYP A;  3G6E Z;  3CXC Y;  2E2J I;  2B63 I;  2J6A A;  1RO0 A;  1USP B;  4RS4 A;  1WW9 A;  1VQ7 1;  2NVT I;  1VQO 1;  4NBH A;  1YJN Z;  4MD9 A;  3F3P C;  1K9M 2;  2OZK A;  4MRI A;  1NJI 2;  2E2I I;  2RPR A;  3QWU A;  3OW2 Y;  1VQK 1;  1RO2 A;  1S72 Z;  1YI2 1;  3VMI A;  4A3L I;  2OTJ 1;  2O53 A;  3H3V J;  3BG0 B;  3CMA Z;  3GCF A;  3IX0 A;  4MD7 A;  3HOV I;  1DL6 A;  2JR6 A;  1X3W A;  1VQO Z;  3EED A;  3M3Y I;  5CM2 M;  1VQN Z;  3NDJ A;  4Y52 I;  3I07 A;  4A3F I;  1YJW Z;  1WII A;  4A3C I;  5IP9 I;  3CCR 1;  3CCL Z;  1VQ5 Z;  1X3Z A;  3CMA 1;  5T67 A;  3FQQ A;  3S14 I;  3FKI I;  1QVG Z;  1YIJ 1;  4A3K I;  2Y0S A;  1ZB9 A;  1YJ9 1;  3KIF A;  4MD8 A;  2R93 I;  1VQP 1;  1KC8 2;  5FLM I;  1Q82 2;  1Q82 1;  2QLV B;  1VQ9 1;  1K9M 1;  3CCL 1;  1JJ2 Y;  2E2H I;  4NBF A;  1VQ5 1;  1TWF I;  3I55 Z;  2NVX I;  2GTI A;  2IZ3 A;  2RBL A;  2QKD A;  1N8R 1;  3S15 I;  3PO3 I;  1QVF Z;  3T4N B;  2R92 I;  2EGT A;  4BXX I;  1YIT Z;  2QRC B;  4NBE A;  3S1R I;  2P28 A;  2W03 A;  2QRD B;  1VQL Z;  2JA7 I;  4CL1 A;  3MON A;  1VQ9 Z;  2OOX B;  3FQM A;  2LFU A;  2VUG A;  2Q51 A;  3ESW A;  3S2D I;  3CC4 1;  3S17 I;  4MH4 A;  3J80 f;  2OOY B;  4DGL A;  3CCV Z;  3CXC Z;  1VQM Z;  3GTM I;  3CME Z;  3GTG I;  1M90 1;  4QTT A;  3OW2 Z;  4RV9 A;  4RVD A;  1N2F A;  3S16 I;  3CD6 1;  5A2Q b;  2JA5 I;  1TWG I;  1SFO I;  3VMG A;  4BBR I;  3HOW I;  3NDI A;  2JMO A;  4E2X A;  3CCV 1;  3GTO I;  1K73 2;  4MON A;  2K3R A;  3HOX I;  2PM9 A;  4BY1 I;  2DE6 A;  2DE7 A;  2GU2 A;  5LL6 f;  3CCJ Z;  5FLX f;  2RHB A;  2GTH A;  1M1K 1;  2M48 A;  3CD6 Z;  5IT9 b;  1K8A 2;  1Q86 2;  3S1N I;  2JA6 I;  3PO2 I;  4A3E I;  1L1O C;  3CCM Z;  2O4H A;  2AKL A;  1K8A 1;  4MXU A;  4HH4 A;  3JAM b;  1YUK A;  3G4S 1;  3MZK B;  1I6H I;  4NBB A;  3PO3 S;  3GTQ I;  2WB1 A;  2V8I A;  4RVG A;  3CC2 Z;  3GTP I;  3CCQ Z;  3HKZ A;  1VQ4 1;  2VUM I;  1VQ6 Z;  2Q4Z A;  4NBD A;  2RT9 A;  4NB8 A;  1JJ2 Z;  3KIH A;  3CCM 1;  1Q81 2;  3CCS 1;  2HF1 A;  2F4O A;  1KC8 1;  3LUS A;  1QVF Y;  3G4S Z;  2OTJ Z;  4S1T A;  1RQF A;  2HU9 A;  4NB9 A;  2OTL Z;  3Q87 A;  2LIY A;  4A3M I;  1PFT A;  3CQZ I;  1NP6 A;  3VMH A;  2QEX Z;  3HOY I;  4BBS I;  1YHQ 1;  1VQ4 Z;  3J80 b;  2PK7 A;  1VQ6 1;  1KRL A;  3GTM S;  1Z03 A;  2YU9 I;  4NFR A;  2QA4 Z;  4A3G I;  4NBG A;  3J7A 4;  1P9N A;  2KPI A;  4RVF A;  3CCR Z;  3G6E 1;  2ZAE B;  3I4N I;  4A3I I;  2V8J A;  3IF8 A;  1VQ7 Z;  1KQS Z;  2M6N A;  1VLA A;  4DQY B;  3H0G I;  1YHQ Z;  1Z02 A;  1KQS Y;  4HGY A;  3HOU I;  2JNY A;  4RVH A;  2JA8 I;  3IFU A;  4NOZ A;  3NFZ A;  2QA4 1;  1VQK Z;  1S7M A;  4DK1 A;  1LQL A;  3BG1 B;  2DE5 A;  1VQP Z;  4E2Y A;  2QRE B;  2R6M A;  1NJI 1;  1YUA A;  3D9X A;  1I3Q I;  1RO4 A;  1VQN 1;  3I56 Z;  3MZL B;  1YIT 1;  3NH5 A;  5D1P A;  1ZB8 A;  1TWA I;  1YJW 1;  5T6B A;  4QTU A;  1JWH C;  1RLY A;  3M4O I;  2F4M A;  3F3F C;  2PMZ A;  1R9T I;  3CC4 Z;  5FLX b;  2QR1 B;  3VB9 A;  1X0T A;  1YIJ Z;  3RZO I;  4E2W A;  1Z01 A;  2VF1 A;  3I4M I;  1N8R 2;  3I56 1;  3RZD I;  2E9H A;  1Y1V S;  1YJ9 Z;  1VQM 1;  1Y1W I;  3TE5 B;  3CME 1;  3CPW Z;  3HOZ I;  4E32 A;  5AN9 F;  5T64 A;  4X6A I;  1Q81 1;  3NH8 A;  5IP7 I;  4HGZ A;  3CC7 Z;  5A2Q f;  1M1K 2;  3I55 1;  5C44 I;  1TWH I;  2NVQ I;  2R7Z I;  3GTL I;  2V8K A;  1Q7Y 2;  3VTN A;  3GTK I;  5IT9 f;  1K73 1;  2K5R A;  1ML8 A;  1I50 I;  1TWC I;  1K83 I;  3G71 Z;  1VQL 1;  1VQ8 Z;  2WAQ A;  4A3D I;  4AYB A;  2H85 A;  4TNU A;  4E31 A;  4NBC A;  3CCJ 1;  1KD1 1;  3CC7 1;  1W2B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...