3PO3I

Arrested rna polymerase ii reactivation intermediate
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3I02
2R92I 3I4NI 2NVQI 3GTLI 3RZOI 1R9TI 1X3ZA 1WCMI 4NBDA 2R93I 2F4MA 1WW9A 3K7AI 4NBAA 3S14I 4A3BI 1USPA 4BY7I 1L1OC 2AKLA 4NBHA 4A93I 2E2JI 3S1NI 2R7ZI 4NBEA 1K83I 1RLYA 1Y1WI 2JR6A 4A3FI 5CM2M 3I07A 2JA8I 2K5RA 3S2HI 4MH4A 3VMHA 3GTMI 3HOZI 3GKQA 3HOUI 2NVYI 3ESWA 1ML8A 3HOVI 5IP9I 2DE7A 1I6HI 2JNYA 4QTTA 1I50I 1PFTA 1QYPA 3CQZI 1X3WA 4NBGA 2VUMI 1TWAI 2HF1A 2E2HI 1SFOI 2JS4A 4NOZA 2DE6A 4X6AI 1USPB 2JA7I 4A3MI 1DL6A 3PO3S 3GTGI 4A3LI 2PK7A 4NBBA 1VLAA 2F4OA 2KPIA 2NVTI 4A3CI 2BJOA 1Y1VI 3S2DI 2J6AA 1N2FA 3RZDI 4A3JI 3S1RI 1NUIA 1ZB9A 2DE5A 3S15I 4NB9A 1Y1VS 3HOXI 3GTJI 2JA6I 3U50C 4NBFA 3VMGA 3S17I 2RBLA 3GTKI 4A3GI 3HOWI 2B63I 4BY1I 5C4XI 1RO4A 1I3QI 3FKII 1TWFI 1YUAA 1TWCI 1TFIA 1TWGI 3EERA 4BBRI 4XX2A 2JA5I 3LUSA 1ZB8A 3VB9A 5IP7I 5C44I 4BXXI 4A3EI 4QTUA 4A3II 3GTOI 3H0GI 3HOYI 3H3VJ 3PO2I 2YU9I 3M4OI 3GCFA 3M3YI 3I4MI 4BBSI 4Y7NI 2NVXI 3S16I 3S1MI 3GTMS 3Q87A 5C4JI 4A3KI 4Y52I 3GTQI 3PO3I 1TWHI 3S1QI 4NB8A 1LQLA 5FLMI 3D6WA 4A3DI 5C3EI 2P3YA 4NBCA 3VMIA 2E2II 3GTPI
chains in the Genus database with same CATH superfamily
3GTLI 1JJ2Z 3RZOI 1K9M1 3NDIA 3CMAZ 2Q51A 1VQM1 3TDHB 1VQKZ 1P9NA 2WAQA 4CL1A 4NBDA 3K7AI 4MD7A 3G711 4E2ZA 2IV2X 3CPWZ 4BY7I 1L1OC 2OZKA 3S1NI 3CCEZ 1RLYA 1K731 4MXUA 2VF1A 3CCUZ 1KD11 2QA41 1M902 2ZAEB 2JA8I 3VMHA 3MZKB 4E2YA 2VPWA 4HGZA 2QKDA 3HOUI 3HOVI 1QVGY 3F3PC 1M1K1 4QTTA 1VQ61 2OTL1 1FDIA 3CCR1 5AN9F 4NBGA 5A2Qf 2OTJZ 1VQ91 2E2HI 2DE6A 3JAMf 3G4S1 1YJ91 3G71Z 2PK7A 4NBBA 4A3CI 3CXCY 3CCJZ 1YHQ1 3S2DI 2J6AA 1Q811 2IZ4A 3QWUA 3S15I 3BG1B 3HOXI 3GTJI 3U50C 4DQYB 4RVDA 3HOWI 4E32A 2B63I 4BY1I 1RO4A 1JJ2Y 3D9XA 3CCV1 3EERA 3CCJ1 1RNIA 1X0TA 2VUGA 3VB9A 5IP7I 5C44I 4BXXI 4QTUA 3CC2Z 4RS4A 1YJNZ 3PO2I 2YU9I 2E7ZA 5T6BA 4HGYA 2HU9A 4Y7NI 2NVXI 3S16I 2G2KA 4RVGA 1ZH1A 3CCE1 1TWHI 5FLXf 4NB8A 1LQLA 2VPXA 4A3DI 5C3EI 4NBCA 1FDOA 5T67A 1VQ4Z 3FQQA 3I4NI 2NVQI 1VQK1 3CCVZ 1VQLZ 1R9TI 3CXCZ 2R93I 2QLVB 1WW9A 3CCRZ 4A3BI 1KC82 1USPA 1VQPZ 3HKZA 2GTIA 1YJ9Z 3CCU1 4A3FI 2LFUA 5CM2M 4TNUA 2QREB 1NJI2 4E31A 1YHQZ 1YI2Z 1QVFY 1ML8A 5IP9I 1VQO1 3EEDA 3IR7A 1W2BY 1I50I 1Q862 1M901 2V8IA 2EGTA 2K3RA 1VQ5Z 3CC21 2VUMI 2O53A 3CC71 2V8KA 2QRCB 1Q812 1QF8A 2JS4A 1K8A1 2VPYA 1VQP1 3PO3S 1KC81 1VQN1 2V45A 2KPIA 1Z01A 3CC41 2O4HA 3NH8A 3D2LA 3J80b 3RZDI 3J81f 1NUIA 3IFUA 2RBLA 2RT9A 2R6MA 2WB1A 2QRDB 4E33A 1K9M2 1TWCI 5A2Qb 1Q7Y2 1YJWZ 1TWGI 4BBRI 3CCMZ 3FQMA 1VQ81 3I56Z 4A3EI 2OTJ1 1Q16A 3H3VJ 1W2BZ 1Q822 3GCFA 1VQL1 3M3YI 1S721 4DK1A 1QVGZ 4E2WA 3I55Z 5C4JI 1WZNA 1VQ8Z 1RQFA 1VQ71 3D6WA 1KRLA 3IF8A 4AYBA 3VMIA 2R92I 3NFZA 2W03A 1YITZ 4DGLA 1K732 1X3ZA 2GTHA 1WCMI 1AA6A 2F4MA 3JAMb 2JIPA 3MONA 2AKLA 4NBHA 2E2JI 2R7ZI 4NBEA 1K83I 2LIYA 1Y1WI 2M6NA 2JR6A 4S1TA 3CME1 3T4NB 1WIIA 1Q861 2K5RA 4MD9A 3NDJA 3HOZI 1YIJ1 3ESWA 1S7MA 2Q4ZA 2JNYA 1PFTA 3CC4Z 1KD12 1NP6A 1X3WA 1TWAI 1SFOI 4MD8A 1QVFZ 4NOZA 4X6AI 1USPB 4E2XA 2JA7I 4A3MI 3NH5A 5D1OA 1Y8CA 1DL6A 3KIHA 2F4OA 2NVTI 2BJOA 2JIMA 1Q7Y1 1N8R1 2V8JA 3CMA1 2DE5A 3G6EZ 1Y1VS 2M48A 1KQSY 2JA6I 4NBFA 1YI21 4A3GI 2I3CA 1I3QI 1TWFI 1YUAA 2JIOA 2RPRA 2JA5I 2JIRA 2IZ3A 1ZB8A 1VQNZ 3MZLB 4A3II 2V3VA 3H0GI 1WJ2A 3M4OI 3I4MI 1Z03A 3I551 3J7A4 1QXFA 3GTMS 2QEX1 1Z02A 3CCL1 3CCSZ 1Q821 3S1QI 3CMEZ 5FLMI 2JIQA 2Y0SA 3BG0B 1YIJZ 3OW2Y 2P3YA 3NH4A 3GTPI 1M1K2 1RO0A 1YUKA 2QR1B 2QEXZ 3CCQZ 2AYDA 3CC7Z 3S14I 4NBAA 1S72Z 2RIQA 5D1PA 2RHBA 1YJW1 1VQ7Z 1VQOZ 4A93I 3J81b 3CD61 4NFRA 1VQ9Z 3I561 5T64A 5LL6f 3OW2Z 3P5JB 3I07A 2KI7B 3CCLZ 3S2HI 4MH4A 3GTMI 3GKQA 2NVYI 2GU2A 5FLXb 2DE7A 1VQMZ 5D1OB 1I6HI 4RVFA 1QYPA 1JWHC 3CQZI 1YIT1 2QA4Z 3TE5B 2H85A 3F3FC 2HF1A 5IT9f 4NH1C 1N8R2 3IX0A 2JMOA 1VQ6Z 3GTGI 4A3LI 1VLAA 2PM9A 1VQ41 3CD6Z 4RVHA 3CCM1 1Y1VI 3G6E1 1N2FA 1KQSZ 4MONA 2PMZA 4A3JI 3S1RI 1ZB9A 4NB9A 3CPWY 3J80f 4HH4A 2E9HA 4E30A 3VMGA 1K8A2 3S17I 3GTKI 2P28A 4RV9A 5C4XI 3FKII 1TFIA 2OOYB 4XX2A 3LUSA 2LEXA 1YJN1 1VQ51 3GTOI 2W04A 1SIWA 3HOYI 4MRIA 3CCQ1 3G4SZ 2OTLZ 2VPZA 4BBSI 4EWCA 1NJI1 3S1MI 5IT9b 2OOXB 1RO2A 3Q87A 4A3KI 2YADA 4Y52I 3GTQI 3PO3I 2NAPA 3CCS1 2JUBA 3VTNA 3KIFA 2E2II
chains in the Genus database with same CATH topology
3GTLI 1JJ2Z 3RZOI 1K9M1 3NDIA 3CMAZ 2Q51A 1VQM1 3TDHB 1VQKZ 1P9NA 2WAQA 4CL1A 4NBDA 3K7AI 4MD7A 3G711 4E2ZA 3CPWZ 4BY7I 1L1OC 2OZKA 3S1NI 3CCEZ 1RLYA 1K731 4MXUA 2VF1A 3CCUZ 1KD11 2QA41 1M902 2ZAEB 2JA8I 3VMHA 3MZKB 4E2YA 4HGZA 2QKDA 3HOUI 3HOVI 1QVGY 3F3PC 1M1K1 4QTTA 1VQ61 2OTL1 3CCR1 5AN9F 4NBGA 5A2Qf 2OTJZ 1VQ91 2E2HI 2DE6A 3JAMf 3G4S1 1YJ91 3G71Z 2PK7A 4NBBA 4A3CI 3CXCY 3CCJZ 1YHQ1 3S2DI 2J6AA 1Q811 2IZ4A 3QWUA 3S15I 3BG1B 3HOXI 3GTJI 3U50C 4DQYB 4RVDA 3HOWI 4E32A 2B63I 4BY1I 1RO4A 1JJ2Y 3D9XA 3CCV1 3EERA 3CCJ1 1RNIA 1X0TA 2VUGA 3VB9A 5IP7I 5C44I 4BXXI 4QTUA 3CC2Z 4RS4A 1YJNZ 3PO2I 2YU9I 5T6BA 4HGYA 2HU9A 4Y7NI 2NVXI 3S16I 2G2KA 4RVGA 1ZH1A 3CCE1 1TWHI 5FLXf 4NB8A 1LQLA 4A3DI 5C3EI 4NBCA 5T67A 1VQ4Z 3FQQA 3I4NI 2NVQI 1VQK1 3CCVZ 1VQLZ 1R9TI 3CXCZ 2R93I 2QLVB 1WW9A 3CCRZ 4A3BI 1KC82 1USPA 1VQPZ 3HKZA 2GTIA 1YJ9Z 3CCU1 4A3FI 2LFUA 5CM2M 4TNUA 2QREB 1NJI2 4E31A 1YHQZ 1YI2Z 1QVFY 1ML8A 5IP9I 1VQO1 3EEDA 1W2BY 1I50I 1Q862 1M901 2V8IA 2EGTA 2K3RA 1VQ5Z 3CC21 2VUMI 2O53A 3CC71 2V8KA 2QRCB 1Q812 1QF8A 2JS4A 1K8A1 1VQP1 3PO3S 1KC81 1VQN1 2KPIA 1Z01A 3CC41 2O4HA 3NH8A 3J80b 3RZDI 3J81f 1NUIA 3IFUA 2RBLA 2RT9A 2R6MA 2WB1A 2QRDB 4E33A 1K9M2 1TWCI 5A2Qb 1Q7Y2 1YJWZ 1TWGI 4BBRI 3CCMZ 3FQMA 1VQ81 3I56Z 4A3EI 2OTJ1 3H3VJ 1W2BZ 1Q822 3GCFA 1VQL1 3M3YI 1S721 4DK1A 1QVGZ 4E2WA 3I55Z 5C4JI 1VQ8Z 1RQFA 1VQ71 3D6WA 1KRLA 3IF8A 4AYBA 3VMIA 2R92I 3NFZA 2W03A 1YITZ 4DGLA 1K732 1X3ZA 2GTHA 1WCMI 2F4MA 3JAMb 3MONA 2AKLA 4NBHA 2E2JI 2R7ZI 4NBEA 1K83I 2LIYA 1Y1WI 2M6NA 2JR6A 4S1TA 3CME1 3T4NB 1WIIA 1Q861 2K5RA 4MD9A 3NDJA 3HOZI 1YIJ1 3ESWA 1S7MA 2Q4ZA 2JNYA 1PFTA 3CC4Z 1KD12 1NP6A 1X3WA 1TWAI 1SFOI 4MD8A 1QVFZ 4NOZA 4X6AI 1USPB 4E2XA 2JA7I 4A3MI 3NH5A 5D1OA 1DL6A 3KIHA 2F4OA 2NVTI 2BJOA 1Q7Y1 1N8R1 2V8JA 3CMA1 2DE5A 3G6EZ 1Y1VS 2M48A 1KQSY 2JA6I 4NBFA 1YI21 4A3GI 2I3CA 1I3QI 1TWFI 1YUAA 2RPRA 2JA5I 2IZ3A 1ZB8A 1VQNZ 3MZLB 4A3II 3H0GI 3M4OI 3I4MI 1Z03A 3I551 3J7A4 3GTMS 2QEX1 1Z02A 3CCL1 3CCSZ 1Q821 3S1QI 3CMEZ 5FLMI 2Y0SA 3BG0B 1YIJZ 3OW2Y 2P3YA 3NH4A 3GTPI 1M1K2 1RO0A 1YUKA 2QR1B 2QEXZ 3CCQZ 3CC7Z 3S14I 4NBAA 1S72Z 2RIQA 5D1PA 2RHBA 1YJW1 1VQ7Z 1VQOZ 4A93I 3J81b 3CD61 4NFRA 1VQ9Z 3I561 5T64A 5LL6f 3OW2Z 3P5JB 3I07A 2KI7B 3CCLZ 3S2HI 4MH4A 3GTMI 3GKQA 2NVYI 2GU2A 5FLXb 2DE7A 1VQMZ 5D1OB 1I6HI 4RVFA 1QYPA 1JWHC 3CQZI 1YIT1 2QA4Z 3TE5B 2H85A 3F3FC 2HF1A 5IT9f 4NH1C 1N8R2 3IX0A 2JMOA 1VQ6Z 3GTGI 4A3LI 1VLAA 2PM9A 1VQ41 3CD6Z 4RVHA 3CCM1 1Y1VI 3G6E1 1N2FA 1KQSZ 4MONA 2PMZA 4A3JI 3S1RI 1ZB9A 4NB9A 3CPWY 3J80f 4HH4A 2E9HA 4E30A 3VMGA 1K8A2 3S17I 3GTKI 2P28A 4RV9A 5C4XI 3FKII 1TFIA 2OOYB 4XX2A 3LUSA 1YJN1 1VQ51 3GTOI 2W04A 3HOYI 4MRIA 3CCQ1 3G4SZ 2OTLZ 4BBSI 4EWCA 1NJI1 3S1MI 5IT9b 2OOXB 1RO2A 3Q87A 4A3KI 2YADA 4Y52I 3GTQI 3PO3I 3CCS1 2JUBA 3VTNA 3KIFA 2E2II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 I;  3I4N I;  2NVQ I;  3GTL I;  3RZO I;  1R9T I;  1X3Z A;  1WCM I;  4NBD A;  2R93 I;  2F4M A;  1WW9 A;  3K7A I;  4NBA A;  3S14 I;  4A3B I;  1USP A;  4BY7 I;  1L1O C;  2AKL A;  4NBH A;  4A93 I;  2E2J I;  3S1N I;  2R7Z I;  4NBE A;  1K83 I;  1RLY A;  1Y1W I;  2JR6 A;  4A3F I;  5CM2 M;  3I07 A;  2JA8 I;  2K5R A;  3S2H I;  4MH4 A;  3VMH A;  3GTM I;  3HOZ I;  3GKQ A;  3HOU I;  2NVY I;  3ESW A;  1ML8 A;  3HOV I;  5IP9 I;  2DE7 A;  1I6H I;  2JNY A;  4QTT A;  1I50 I;  1PFT A;  1QYP A;  3CQZ I;  1X3W A;  4NBG A;  2VUM I;  1TWA I;  2HF1 A;  2E2H I;  1SFO I;  2JS4 A;  4NOZ A;  2DE6 A;  4X6A I;  1USP B;  2JA7 I;  4A3M I;  1DL6 A;  3PO3 S;  3GTG I;  4A3L I;  2PK7 A;  4NBB A;  1VLA A;  2F4O A;  2KPI A;  2NVT I;  4A3C I;  2BJO A;  1Y1V I;  3S2D I;  2J6A A;  1N2F A;  3RZD I;  4A3J I;  3S1R I;  1NUI A;  1ZB9 A;  2DE5 A;  3S15 I;  4NB9 A;  1Y1V S;  3HOX I;  3GTJ I;  2JA6 I;  3U50 C;  4NBF A;  3VMG A;  3S17 I;  2RBL A;  3GTK I;  4A3G I;  3HOW I;  2B63 I;  4BY1 I;  5C4X I;  1RO4 A;  1I3Q I;  3FKI I;  1TWF I;  1YUA A;  1TWC I;  1TFI A;  1TWG I;  3EER A;  4BBR I;  4XX2 A;  2JA5 I;  3LUS A;  1ZB8 A;  3VB9 A;  5IP7 I;  5C44 I;  4BXX I;  4A3E I;  4QTU A;  4A3I I;  3GTO I;  3H0G I;  3HOY I;  3H3V J;  3PO2 I;  2YU9 I;  3M4O I;  3GCF A;  3M3Y I;  3I4M I;  4BBS I;  4Y7N I;  2NVX I;  3S16 I;  3S1M I;  3GTM S;  3Q87 A;  5C4J I;  4A3K I;  4Y52 I;  3GTQ I;  3PO3 I;  1TWH I;  3S1Q I;  4NB8 A;  1LQL A;  5FLM I;  3D6W A;  4A3D I;  5C3E I;  2P3Y A;  4NBC A;  3VMI A;  2E2I I;  3GTP I; 
#chains in the Genus database with same CATH topology
 3GTL I;  1JJ2 Z;  3RZO I;  1K9M 1;  3NDI A;  3CMA Z;  2Q51 A;  1VQM 1;  3TDH B;  1VQK Z;  1P9N A;  2WAQ A;  4CL1 A;  4NBD A;  3K7A I;  4MD7 A;  3G71 1;  4E2Z A;  2IV2 X;  3CPW Z;  4BY7 I;  1L1O C;  2OZK A;  3S1N I;  3CCE Z;  1RLY A;  1K73 1;  4MXU A;  2VF1 A;  3CCU Z;  1KD1 1;  2QA4 1;  1M90 2;  2ZAE B;  2JA8 I;  3VMH A;  3MZK B;  4E2Y A;  2VPW A;  4HGZ A;  2QKD A;  3HOU I;  3HOV I;  1QVG Y;  3F3P C;  1M1K 1;  4QTT A;  1VQ6 1;  2OTL 1;  1FDI A;  3CCR 1;  5AN9 F;  4NBG A;  5A2Q f;  2OTJ Z;  1VQ9 1;  2E2H I;  2DE6 A;  3JAM f;  3G4S 1;  1YJ9 1;  3G71 Z;  2PK7 A;  4NBB A;  4A3C I;  3CXC Y;  3CCJ Z;  1YHQ 1;  3S2D I;  2J6A A;  1Q81 1;  2IZ4 A;  3QWU A;  3S15 I;  3BG1 B;  3HOX I;  3GTJ I;  3U50 C;  4DQY B;  4RVD A;  3HOW I;  4E32 A;  2B63 I;  4BY1 I;  1RO4 A;  1JJ2 Y;  3D9X A;  3CCV 1;  3EER A;  3CCJ 1;  1RNI A;  1X0T A;  2VUG A;  3VB9 A;  5IP7 I;  5C44 I;  4BXX I;  4QTU A;  3CC2 Z;  4RS4 A;  1YJN Z;  3PO2 I;  2YU9 I;  2E7Z A;  5T6B A;  4HGY A;  2HU9 A;  4Y7N I;  2NVX I;  3S16 I;  2G2K A;  4RVG A;  1ZH1 A;  3CCE 1;  1TWH I;  5FLX f;  4NB8 A;  1LQL A;  2VPX A;  4A3D I;  5C3E I;  4NBC A;  1FDO A;  5T67 A;  1VQ4 Z;  3FQQ A;  3I4N I;  2NVQ I;  1VQK 1;  3CCV Z;  1VQL Z;  1R9T I;  3CXC Z;  2R93 I;  2QLV B;  1WW9 A;  3CCR Z;  4A3B I;  1KC8 2;  1USP A;  1VQP Z;  3HKZ A;  2GTI A;  1YJ9 Z;  3CCU 1;  4A3F I;  2LFU A;  5CM2 M;  4TNU A;  2QRE B;  1NJI 2;  4E31 A;  1YHQ Z;  1YI2 Z;  1QVF Y;  1ML8 A;  5IP9 I;  1VQO 1;  3EED A;  3IR7 A;  1W2B Y;  1I50 I;  1Q86 2;  1M90 1;  2V8I A;  2EGT A;  2K3R A;  1VQ5 Z;  3CC2 1;  2VUM I;  2O53 A;  3CC7 1;  2V8K A;  2QRC B;  1Q81 2;  1QF8 A;  2JS4 A;  1K8A 1;  2VPY A;  1VQP 1;  3PO3 S;  1KC8 1;  1VQN 1;  2V45 A;  2KPI A;  1Z01 A;  3CC4 1;  2O4H A;  3NH8 A;  3D2L A;  3J80 b;  3RZD I;  3J81 f;  1NUI A;  3IFU A;  2RBL A;  2RT9 A;  2R6M A;  2WB1 A;  2QRD B;  4E33 A;  1K9M 2;  1TWC I;  5A2Q b;  1Q7Y 2;  1YJW Z;  1TWG I;  4BBR I;  3CCM Z;  3FQM A;  1VQ8 1;  3I56 Z;  4A3E I;  2OTJ 1;  1Q16 A;  3H3V J;  1W2B Z;  1Q82 2;  3GCF A;  1VQL 1;  3M3Y I;  1S72 1;  4DK1 A;  1QVG Z;  4E2W A;  3I55 Z;  5C4J I;  1WZN A;  1VQ8 Z;  1RQF A;  1VQ7 1;  3D6W A;  1KRL A;  3IF8 A;  4AYB A;  3VMI A;  2R92 I;  3NFZ A;  2W03 A;  1YIT Z;  4DGL A;  1K73 2;  1X3Z A;  2GTH A;  1WCM I;  1AA6 A;  2F4M A;  3JAM b;  2JIP A;  3MON A;  2AKL A;  4NBH A;  2E2J I;  2R7Z I;  4NBE A;  1K83 I;  2LIY A;  1Y1W I;  2M6N A;  2JR6 A;  4S1T A;  3CME 1;  3T4N B;  1WII A;  1Q86 1;  2K5R A;  4MD9 A;  3NDJ A;  3HOZ I;  1YIJ 1;  3ESW A;  1S7M A;  2Q4Z A;  2JNY A;  1PFT A;  3CC4 Z;  1KD1 2;  1NP6 A;  1X3W A;  1TWA I;  1SFO I;  4MD8 A;  1QVF Z;  4NOZ A;  4X6A I;  1USP B;  4E2X A;  2JA7 I;  4A3M I;  3NH5 A;  5D1O A;  1Y8C A;  1DL6 A;  3KIH A;  2F4O A;  2NVT I;  2BJO A;  2JIM A;  1Q7Y 1;  1N8R 1;  2V8J A;  3CMA 1;  2DE5 A;  3G6E Z;  1Y1V S;  2M48 A;  1KQS Y;  2JA6 I;  4NBF A;  1YI2 1;  4A3G I;  2I3C A;  1I3Q I;  1TWF I;  1YUA A;  2JIO A;  2RPR A;  2JA5 I;  2JIR A;  2IZ3 A;  1ZB8 A;  1VQN Z;  3MZL B;  4A3I I;  2V3V A;  3H0G I;  1WJ2 A;  3M4O I;  3I4M I;  1Z03 A;  3I55 1;  3J7A 4;  1QXF A;  3GTM S;  2QEX 1;  1Z02 A;  3CCL 1;  3CCS Z;  1Q82 1;  3S1Q I;  3CME Z;  5FLM I;  2JIQ A;  2Y0S A;  3BG0 B;  1YIJ Z;  3OW2 Y;  2P3Y A;  3NH4 A;  3GTP I;  1M1K 2;  1RO0 A;  1YUK A;  2QR1 B;  2QEX Z;  3CCQ Z;  2AYD A;  3CC7 Z;  3S14 I;  4NBA A;  1S72 Z;  2RIQ A;  5D1P A;  2RHB A;  1YJW 1;  1VQ7 Z;  1VQO Z;  4A93 I;  3J81 b;  3CD6 1;  4NFR A;  1VQ9 Z;  3I56 1;  5T64 A;  5LL6 f;  3OW2 Z;  3P5J B;  3I07 A;  2KI7 B;  3CCL Z;  3S2H I;  4MH4 A;  3GTM I;  3GKQ A;  2NVY I;  2GU2 A;  5FLX b;  2DE7 A;  1VQM Z;  5D1O B;  1I6H I;  4RVF A;  1QYP A;  1JWH C;  3CQZ I;  1YIT 1;  2QA4 Z;  3TE5 B;  2H85 A;  3F3F C;  2HF1 A;  5IT9 f;  4NH1 C;  1N8R 2;  3IX0 A;  2JMO A;  1VQ6 Z;  3GTG I;  4A3L I;  1VLA A;  2PM9 A;  1VQ4 1;  3CD6 Z;  4RVH A;  3CCM 1;  1Y1V I;  3G6E 1;  1N2F A;  1KQS Z;  4MON A;  2PMZ A;  4A3J I;  3S1R I;  1ZB9 A;  4NB9 A;  3CPW Y;  3J80 f;  4HH4 A;  2E9H A;  4E30 A;  3VMG A;  1K8A 2;  3S17 I;  3GTK I;  2P28 A;  4RV9 A;  5C4X I;  3FKI I;  1TFI A;  2OOY B;  4XX2 A;  3LUS A;  2LEX A;  1YJN 1;  1VQ5 1;  3GTO I;  2W04 A;  1SIW A;  3HOY I;  4MRI A;  3CCQ 1;  3G4S Z;  2OTL Z;  2VPZ A;  4BBS I;  4EWC A;  1NJI 1;  3S1M I;  5IT9 b;  2OOX B;  1RO2 A;  3Q87 A;  4A3K I;  2YAD A;  4Y52 I;  3GTQ I;  3PO3 I;  2NAP A;  3CCS 1;  2JUB A;  3VTN A;  3KIF A;  2E2I I; 
#chains in the Genus database with same CATH homology
 3GTL I;  1JJ2 Z;  3RZO I;  1K9M 1;  3NDI A;  3CMA Z;  2Q51 A;  1VQM 1;  3TDH B;  1VQK Z;  1P9N A;  2WAQ A;  4CL1 A;  4NBD A;  3K7A I;  4MD7 A;  3G71 1;  4E2Z A;  3CPW Z;  4BY7 I;  1L1O C;  2OZK A;  3S1N I;  3CCE Z;  1RLY A;  1K73 1;  4MXU A;  2VF1 A;  3CCU Z;  1KD1 1;  2QA4 1;  1M90 2;  2ZAE B;  2JA8 I;  3VMH A;  3MZK B;  4E2Y A;  4HGZ A;  2QKD A;  3HOU I;  3HOV I;  1QVG Y;  3F3P C;  1M1K 1;  4QTT A;  1VQ6 1;  2OTL 1;  3CCR 1;  5AN9 F;  4NBG A;  5A2Q f;  2OTJ Z;  1VQ9 1;  2E2H I;  2DE6 A;  3JAM f;  3G4S 1;  1YJ9 1;  3G71 Z;  2PK7 A;  4NBB A;  4A3C I;  3CXC Y;  3CCJ Z;  1YHQ 1;  3S2D I;  2J6A A;  1Q81 1;  2IZ4 A;  3QWU A;  3S15 I;  3BG1 B;  3HOX I;  3GTJ I;  3U50 C;  4DQY B;  4RVD A;  3HOW I;  4E32 A;  2B63 I;  4BY1 I;  1RO4 A;  1JJ2 Y;  3D9X A;  3CCV 1;  3EER A;  3CCJ 1;  1RNI A;  1X0T A;  2VUG A;  3VB9 A;  5IP7 I;  5C44 I;  4BXX I;  4QTU A;  3CC2 Z;  4RS4 A;  1YJN Z;  3PO2 I;  2YU9 I;  5T6B A;  4HGY A;  2HU9 A;  4Y7N I;  2NVX I;  3S16 I;  2G2K A;  4RVG A;  1ZH1 A;  3CCE 1;  1TWH I;  5FLX f;  4NB8 A;  1LQL A;  4A3D I;  5C3E I;  4NBC A;  5T67 A;  1VQ4 Z;  3FQQ A;  3I4N I;  2NVQ I;  1VQK 1;  3CCV Z;  1VQL Z;  1R9T I;  3CXC Z;  2R93 I;  2QLV B;  1WW9 A;  3CCR Z;  4A3B I;  1KC8 2;  1USP A;  1VQP Z;  3HKZ A;  2GTI A;  1YJ9 Z;  3CCU 1;  4A3F I;  2LFU A;  5CM2 M;  4TNU A;  2QRE B;  1NJI 2;  4E31 A;  1YHQ Z;  1YI2 Z;  1QVF Y;  1ML8 A;  5IP9 I;  1VQO 1;  3EED A;  1W2B Y;  1I50 I;  1Q86 2;  1M90 1;  2V8I A;  2EGT A;  2K3R A;  1VQ5 Z;  3CC2 1;  2VUM I;  2O53 A;  3CC7 1;  2V8K A;  2QRC B;  1Q81 2;  1QF8 A;  2JS4 A;  1K8A 1;  1VQP 1;  3PO3 S;  1KC8 1;  1VQN 1;  2KPI A;  1Z01 A;  3CC4 1;  2O4H A;  3NH8 A;  3J80 b;  3RZD I;  3J81 f;  1NUI A;  3IFU A;  2RBL A;  2RT9 A;  2R6M A;  2WB1 A;  2QRD B;  4E33 A;  1K9M 2;  1TWC I;  5A2Q b;  1Q7Y 2;  1YJW Z;  1TWG I;  4BBR I;  3CCM Z;  3FQM A;  1VQ8 1;  3I56 Z;  4A3E I;  2OTJ 1;  3H3V J;  1W2B Z;  1Q82 2;  3GCF A;  1VQL 1;  3M3Y I;  1S72 1;  4DK1 A;  1QVG Z;  4E2W A;  3I55 Z;  5C4J I;  1VQ8 Z;  1RQF A;  1VQ7 1;  3D6W A;  1KRL A;  3IF8 A;  4AYB A;  3VMI A;  2R92 I;  3NFZ A;  2W03 A;  1YIT Z;  4DGL A;  1K73 2;  1X3Z A;  2GTH A;  1WCM I;  2F4M A;  3JAM b;  3MON A;  2AKL A;  4NBH A;  2E2J I;  2R7Z I;  4NBE A;  1K83 I;  2LIY A;  1Y1W I;  2M6N A;  2JR6 A;  4S1T A;  3CME 1;  3T4N B;  1WII A;  1Q86 1;  2K5R A;  4MD9 A;  3NDJ A;  3HOZ I;  1YIJ 1;  3ESW A;  1S7M A;  2Q4Z A;  2JNY A;  1PFT A;  3CC4 Z;  1KD1 2;  1NP6 A;  1X3W A;  1TWA I;  1SFO I;  4MD8 A;  1QVF Z;  4NOZ A;  4X6A I;  1USP B;  4E2X A;  2JA7 I;  4A3M I;  3NH5 A;  5D1O A;  1DL6 A;  3KIH A;  2F4O A;  2NVT I;  2BJO A;  1Q7Y 1;  1N8R 1;  2V8J A;  3CMA 1;  2DE5 A;  3G6E Z;  1Y1V S;  2M48 A;  1KQS Y;  2JA6 I;  4NBF A;  1YI2 1;  4A3G I;  2I3C A;  1I3Q I;  1TWF I;  1YUA A;  2RPR A;  2JA5 I;  2IZ3 A;  1ZB8 A;  1VQN Z;  3MZL B;  4A3I I;  3H0G I;  3M4O I;  3I4M I;  1Z03 A;  3I55 1;  3J7A 4;  3GTM S;  2QEX 1;  1Z02 A;  3CCL 1;  3CCS Z;  1Q82 1;  3S1Q I;  3CME Z;  5FLM I;  2Y0S A;  3BG0 B;  1YIJ Z;  3OW2 Y;  2P3Y A;  3NH4 A;  3GTP I;  1M1K 2;  1RO0 A;  1YUK A;  2QR1 B;  2QEX Z;  3CCQ Z;  3CC7 Z;  3S14 I;  4NBA A;  1S72 Z;  2RIQ A;  5D1P A;  2RHB A;  1YJW 1;  1VQ7 Z;  1VQO Z;  4A93 I;  3J81 b;  3CD6 1;  4NFR A;  1VQ9 Z;  3I56 1;  5T64 A;  5LL6 f;  3OW2 Z;  3P5J B;  3I07 A;  2KI7 B;  3CCL Z;  3S2H I;  4MH4 A;  3GTM I;  3GKQ A;  2NVY I;  2GU2 A;  5FLX b;  2DE7 A;  1VQM Z;  5D1O B;  1I6H I;  4RVF A;  1QYP A;  1JWH C;  3CQZ I;  1YIT 1;  2QA4 Z;  3TE5 B;  2H85 A;  3F3F C;  2HF1 A;  5IT9 f;  4NH1 C;  1N8R 2;  3IX0 A;  2JMO A;  1VQ6 Z;  3GTG I;  4A3L I;  1VLA A;  2PM9 A;  1VQ4 1;  3CD6 Z;  4RVH A;  3CCM 1;  1Y1V I;  3G6E 1;  1N2F A;  1KQS Z;  4MON A;  2PMZ A;  4A3J I;  3S1R I;  1ZB9 A;  4NB9 A;  3CPW Y;  3J80 f;  4HH4 A;  2E9H A;  4E30 A;  3VMG A;  1K8A 2;  3S17 I;  3GTK I;  2P28 A;  4RV9 A;  5C4X I;  3FKI I;  1TFI A;  2OOY B;  4XX2 A;  3LUS A;  1YJN 1;  1VQ5 1;  3GTO I;  2W04 A;  3HOY I;  4MRI A;  3CCQ 1;  3G4S Z;  2OTL Z;  4BBS I;  4EWC A;  1NJI 1;  3S1M I;  5IT9 b;  2OOX B;  1RO2 A;  3Q87 A;  4A3K I;  2YAD A;  4Y52 I;  3GTQ I;  3PO3 I;  3CCS 1;  2JUB A;  3VTN A;  3KIF A;  2E2I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...