3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
1K83I 1TWCI 4BXXX 3HOYI 1R9TI 2K5RA 2JR6A 3EERA 3M4OI 4Y7NI 3VMHA 3CQZI 4NB9A 2JA6I 4XX2A 3I07A 2R92I 3GTMI 3S1RI 2VUMI 3VMIA 2F4MA 5FLMI 1X3WA 3D6WA 5C3EI 1SFOI 1QYPA 1RLYA 4NOZA 1I50I 4BY7X 4A3JI 2R7ZI 1TWAI 4NBHA 4QTUA 3S15I 3Q87A 3S14I 2PK7A 1PFTA 3S16I 3S2HI 1L1OC 2DE5A 2J6AA 2P3YA 3GTJI 4A3GI 1ZB9A 2KPIA 4A3MI 4NBEA 3NDQA 1Y1VS 3H3VJ 1LQLA 1VLAA 5C44I 3GTGI 1WW9A 2JNYA 4BBSI 1N2FA 4A3LI 4A3KI 5IP9I 4NBAA 2DE6A 3S1QI 3VB9A 4X6AI 1X3ZA 5C4XI 3HOXI 4A3DI 2HF1A 1TWGI 2B63I 1USPA 4A3FI 3VMGA 3I4MI 3K7AI 1ML8A 3H0GI 1WCMI 2JA7I 1TFIA 4BY1I 2YU9I 2NVQI 4A3II 5CM2M 3PO2I 2RBLA 4NBFA 4BBRI 2JA8I 2E2HI 4Y52I 1RO4A 4BXXI 3ESWA 1ZB8A 3GTQI 1TWHI 1I6HI 4A93I 5IP7I 2DE7A 2JA5I 1Y1VI 4A3CI 3U50C 1I3QI 3M3YI 3RZOI 4BY7I 5C4JI 3PO3S 3S1MI 3FKII 2E2II 2NVXI 1DL6A 4NBGA 2DMEA 4NBBA 3RZDI 1USPB 4QTTA 3S2DI 2JS4A 3GTOI 3GCFA 2AKLA 2F4OA 4A3EI 2E2JI 3HOUI 2LW4A 2BJOA 2NVTI 1TWFI 3HOZI 3GKQA 4NB8A 3I4NI 3GTKI 2NVYI 4NBCA 3PO3I 4BY1X 3S1NI 3GTLI 3S17I 2R93I 1ENWA 1YUAA 4A3BI 3GTMS 3HOWI 4NBDA 1Y1WI 4MH4A 3GTPI 3HOVI 3LUSA 1NUIA
chains in the Genus database with same CATH superfamily
1K83I 1TWCI 4E2ZA 2E9HA 5DQVA 2JR6A 3M4OI 3G6E1 2M6NA 3J81f 2WMAB 3VMHA 1VQ6Z 2I40B 4MD9A 3CQZI 3MZKB 1X0TA 4Y72B 5BNJB 3HBLA 4XX2A 3I07A 2VUMI 3DOGB 2HU9A 2ZPFB 5LMKB 2DXCB 1X3WA 2CZ7B 1YUKA 5IDNB 4HNTA 1K8A2 3OW2Y 1RLYA 2Q4ZA 1OIUB 3O0GD 4MONA 1UGRB 4ELLA 4BCHB 3CCM1 4G6LB 3Q87A 1PFTA 3CCV1 3TNWB 2WMBB 3S2HI 2OTLZ 1L1OC 2QLVB 4MD7A 3GTJI 3CMAZ 3HB9A 4CFVB 3NDQA 4NBEA 1Y1VS 1URCB 3H3VJ 1O9KB 3MI9B 4RV9A 5IT9b 5I5ZB 4YOOA 5HVYB 1VLAA 4KRCB 4BCND 2V22B 1V29B 2JNYA 4F7JB 4EOJB 1JKWA 3CC21 2QDJA 5ACBA 1FDOA 5A2Qb 1KXUA 2F2CA 3S1QI 4NBAA 1OKVB 3MY1B 1X3ZA 2HF1A 5ICPB 2Y0SA 4F6SB 5D1OA 2UZBB 4CXAB 2PM9A 1AA6A 1YI2Z 3I4MI 2DD5B 2CZ6B 1YIJ1 2BPMB 1ML8A 4EC8B 2IV2X 1UNHD 1XO2A 3X26B 2OTJ1 2WEVB 3BLQB 5D1OB 2WXVB 3DL1A 4A3II 1Q862 2IZ4A 2V8KA 2RHBA 2QEXZ 2WPAB 1QVGZ 2QGSA 1VQK1 1RO4A 1Q861 3HKZA 3ESWA 3GTQI 4E31A 4A93I 2DE7A 4BBRM 1Y1VI 1Q822 1AHJB 4UN0A 2CYZB 1WZNA 4MFDA 1UGQB 1VQP1 5HBEB 2O53A 4MIMA 2DD4B 4NBGA 4NBBA 3I55Z 3A8LB 4QTTA 4HNUA 3GCFA 4I3ZB 4TTHA 1NJI1 2M48A 3IF8A 3G4SZ 1GY3B 2BJOA 2OOYB 1TWFI 1H1RB 3I4NI 1E9HB 4NB8A 2QA41 5IT9f 3QYHB 3BG5A 1VQ9Z 2G77A 1Q821 1H1PB 4BY1X 3KIHA 2C5NB 5LQFB 1Z03A 1VQ51 1TD6A 2W03A 2QREB 1GH6B 4HNVA 2JIMA 2ZPBB 3QWLA 4QSHA 4MH4A 3LQ5B 4ROCA 3EJ1B 1NUIA 3G71Z 1VQ41 1QVFZ 2O4HA 3M3YI 4DGLA 3HOYI 3CC41 2K5RA 4Y7NI 3CCRZ 4NH1C 3A8MB 2RPRA 4NB9A 3BHVB 1QMZB 1H24B 3VKHA 2R6MA 2R92I 3VMIA 2F4MA 4BCNB 1VINA 3VYHB 3X20B 4CFMB 1M1K1 1H28B 1QXFA 1QYPA 3CC7Z 2QRDB 2K3RA 1P9NA 1TFBA 2JIRA 3TNHB 5FGKB 4EC9B 3QHWB 4Z6YA 1F5QB 1YIT1 3CCJZ 1P5EB 4EOKB 2PK7A 3TDHB 2J6AA 3CCVZ 3G4S1 4A3GI 2KPIA 3TW6A 4A3MI 3A8HB 1W2BZ 1JOWA 3QYEA 4ROEA 2CZ0B 3I561 2R7GA 4MFEA 5CEIB 1LQLA 3GTGI 2CCIB 2UZDB 2PK2A 1WW9A 4BBSI 4EOQB 2WAQA 2W9FA 1M902 2QEX1 2BS3A 4ZGDB 2E7ZA 4A3LI 3VB9A 2GU2A 3J80b 2ZPGB 3KIFA 1H4LD 3TN8B 1USPA 3VKGA 1BU2A 2CZ1B 1RNIA 2OOXB 3X28B 2JMOA 2C4GB 4FX3B 2VUGA 2EUFA 2VF1A 3PO2I 2RBLA 2QFZA 4BCQD 1RO2A 4BBRI 1FVVB 4RVFA 4BCPB 2QF7A 5T64A 1KD11 3CCU1 3CCMZ 4EOMB 3CCJ1 2LEXA 4DQYB 1OL2B 1TWHI 2BKZB 1I6HI 3CMA1 4TNUA 3U50C 5D1PA 3CME1 4BY7I 4OB3B 5C4JI 3HZJA 2VPXA 3G711 5FLXf 1KC82 1H1SB 3MONA 4E33A 3FKII 2E2II 4HLQA 3CCEZ 1UNGD 4ZGJB 3TE5B 1DL6A 3IR7A 2ZPEB 1K9M1 4BCFB 1USPB 2OZKA 1Q7Y1 2JS4A 3GTOI 3QXEB 1YJ9Z 2E2JI 3I551 3CCSZ 1VQ61 1IREB 1N8R1 4HH4A 5T67A 4HGZA 4CL1A 3CCR1 5AN9F 4CFXB 3GTKI 2C5XB 4NC6A 2NVYI 2P28A 3F3PC 2BS4A 1W98B 3PO3I 3RGFB 4BCKB 1K732 2W99A 1KQSZ 3MY5B 2R93I 1Q812 3X24B 1VQ5Z 1GUXB 2DXBB 1UGSB 1Y8CA 4RVHA 3J81b 1E7PA 3GTMS 3TW7A 3HOWI 3CCE1 2EGTA 2ZPHB 4E32A 3KHIA 4OGRB 4ZGEB 3D9XA 3G33B 4BXXX 4OB2B 4MRIA 1OI9B 3NDJA 2W9ZA 1VQL1 4F7SB 5IHYA 4JX4A 1SIWA 4E30A 4YOSA 3CCUZ 3CPWZ 4F6UB 1KRLA 2WIHB 4OB0B 3GTMI 2WFYB 2WIPB 5FLMI 2UZEB 1K731 2YADA 1PKDB 5DQWA 4HL4A 4AKHA 1Q811 4YOZA 4A3JI 5FLXb 2ZAEB 2C5OB 1TWAI 4NBHA 2ZCFB 2CJMB 1VQO1 2WHBB 3S14I 2D0QB 1K9M2 3EOCB 4EOSB 4AKIA 2DE5A 4JX5A 3CCQ1 1KC81 2QA4Z 2IW6B 1VQ71 2I53A 4EOLB 1JWHC 3NH5A 2OTJZ 3X25B 3JAMb 1FINB 2IW8B 4OB1B 1RQFA 5C44I 2B9RA 1OGUB 3MIAB 3K7AM 2W2HA 5HQ0B 3BHUB 3DTOA 4A3KI 2JUBA 1QLBA 3CCL1 3HHTB 4BCQB 1D3UB 1OIYB 1YJWZ 4BCOB 1YHQ1 3CC4Z 5HBHB 1FDIA 4RVGA 1AISB 1TWGI 2AYDA 4EORB 3FQMA 2QDYB 4AYBA 1VQLZ 1KD12 3CCQZ 1H27B 1UGPB 3BG3A 4BCGB 4RODA 3FQQA 5A2Qf 1QF8A 3K7AI 2OTL1 3F5XB 3B57A 4BCMD 1FKMA 3M03A 3P5JB 1VQNZ 2YU9I 4CFUB 5CYIB 3H4CA 4NSTB 2WJ9A 2I3CA 4EWCA 4S1TA 2JA8I 3QHRB 4EOOB 1VQM1 1W2BY 2GTIA 1S72Z 5EJCA 2E2HI 4Y52I 3QZ5B 1YHQZ 1ZB8A 2JIPA 3POMA 2AHJB 2KI7B 2W04A 2PHGA 3RZOI 1I3QI 3CD61 1YJN1 3CMEZ 1VQ4Z 2CCHB 2JIQA 2DMEA 3RZDI 2DPPB 4A3EI 2QR1B 2IW9B 5HNBB 2LW4A 2GTHA 2QQ8A 1YJ91 3BLRB 3HOZI 1S721 3JAMf 3OW2Z 4F7NB 1N4MA 4HGYA 4FM4B 1VQ91 1M1K2 3BG9A 3BG1B 4EONB 2ZZDB 1N8R2 1QVFY 3D2LA 3S1NI 1WIIA 3EIDB 3WVDB 2V3VA 4F70B 1OKWB 4EOPB 1ENWA 1YUAA 2V8IA 4NBDA 4DK1A 3GTPI 3HOVI 3LUSA 1K8A1 1VQPZ 1ZP2A 4MXUA 1H25B 1R9TI 3EERA 1VQOZ 3BHTB 2W96A 3EEDA 2X1NB 4BCIB 3QZ9B 3I56Z 1JJ2Y 2JA6I 3A8GB 4BCJB 2JIOA 4E2XA 1C9BA 3S1RI 1RO0A 2QRCB 5L2WB 3D6WA 4F6WB 5C3EI 1SFOI 2G9XB 3WVEB 4NOZA 2PMIB 5IF1B 1I50I 3CCLZ 4BCMB 1Z02A 4NFRA 4BY7X 2R7ZI 2RIQA 4CFWB 2KMGA 1YJW1 2PMZA 4QTUA 5IDPB 3S15I 1Q16A 1YITZ 3S16I 4AKGA 2P3YA 3IFUA 4OR5B 1ZB9A 2UUEB 5HBJB 1Z01A 1NJI2 3T4NB 3DDQB 2WB1A 2IN3A 1VQ7Z 3HO8A 4RS4A 5T6BA 2V8JA 1QVGY 1VQN1 1JJ2Z 4RVDA 1VQMZ 4II5B 3MZLB 1N2FA 2VPWA 4MD8A 4LOCA 1OL1B 2UZLB 5IP9I 3CPWY 2DE6A 4X6AI 2IZ3A 1AD6A 5C4XI 1G3NC 2C6TB 2LIYA 3HOXI 1VQ8Z 4KRDB 4CRLB 2B63I 4A3DI 2QKDA 4F7LB 2RT9A 1YIJZ 2ZPIB 4A3FI 1YJNZ 4EOIB 3VMGA 3S2DI 1O9KA 3BLHB 3BG0B 3H0GI 4E2WA 1WCMI 1ZH1A 2PK9B 2JA7I 1Q7Y2 1TFIA 3NH8A 4BY1I 1S7MA 2NVQI 5EFQB 3TNIB 5CM2M 2VPZA 3F3FC 1KQSY 4NBFA 3G6EZ 3CC2Z 1GUXA 1VQKZ 3CXCY 3NFZA 3DDPB 2G2KA 1H26B 4E2YA 4BXXI 1UNLD 1VQ81 4JX6A 5IP7I 1JSUB 4BBSM 2JA5I 4AI6A 4A3CI 3CC71 1JSTB 2VPYA 3DJBA 1YI21 3PO3S 3NH4A 3CD6Z 3QWUA 3S1MI 4M6VA 4CFUD 2NVXI 1VOLA 2NAPA 2KR6A 2Q51A 3VTNA 2AKLA 2F4OA 3HOUI 2C5VB 1H1QB 4ELJA 5LL6f 3CCS1 2NVTI 1NP6A 3QYGB 3GKQA 2LFUA 3IX0A 4CFNB 4NBCA 1M901 2PJQA 3NDIA 1VYWB 2JGZB 3J80f 3CXCZ 3GTLI 3S17I 2V45A 4IMYB 1WJ2A 3A8OB 3VYGB 3QYBA 2H85A 4A3BI 1Y1WI 2IVXA 4YC3B 3J7A4 2BS2A
chains in the Genus database with same CATH topology
1K83I 1TWCI 4E2ZA 2E9HA 2JR6A 3M4OI 3G6E1 2M6NA 3J81f 3VMHA 1VQ6Z 4MD9A 3CQZI 3MZKB 1X0TA 4XX2A 3I07A 2VUMI 2HU9A 1X3WA 1YUKA 1K8A2 3OW2Y 1RLYA 2Q4ZA 4MONA 3CCM1 3Q87A 1PFTA 3CCV1 3S2HI 2OTLZ 1L1OC 2QLVB 4MD7A 3GTJI 3CMAZ 4NBEA 3NDQA 1Y1VS 3H3VJ 4RV9A 5IT9b 1VLAA 2JNYA 3CC21 5A2Qb 3S1QI 4NBAA 1X3ZA 2HF1A 2Y0SA 5D1OA 2PM9A 1YI2Z 3I4MI 1YIJ1 1ML8A 2OTJ1 5D1OB 4A3II 1Q862 2IZ4A 2V8KA 2RHBA 2QEXZ 1QVGZ 1VQK1 1RO4A 1Q861 3HKZA 3ESWA 3GTQI 4E31A 4A93I 2DE7A 1Y1VI 1Q822 1VQP1 2O53A 4NBGA 3I55Z 4NBBA 4QTTA 3GCFA 1NJI1 2M48A 3IF8A 3G4SZ 2BJOA 2OOYB 1TWFI 3I4NI 4NB8A 2QA41 5IT9f 1VQ9Z 1Q821 4BY1X 3KIHA 1Z03A 1VQ51 2W03A 2QREB 4MH4A 3G71Z 1NUIA 1QVFZ 3M3YI 1VQ41 2O4HA 4DGLA 3HOYI 3CC41 2K5RA 4Y7NI 3CCRZ 4NH1C 2RPRA 4NB9A 2R92I 2R6MA 3VMIA 2F4MA 1M1K1 1QYPA 3CC7Z 2QRDB 2K3RA 1P9NA 1YIT1 3CCJZ 2PK7A 3TDHB 2J6AA 3CCVZ 3G4S1 4A3GI 2KPIA 4A3MI 1W2BZ 3I561 1LQLA 3GTGI 1WW9A 4BBSI 2WAQA 1M902 2QEX1 4A3LI 3VB9A 2GU2A 3J80b 3KIFA 1USPA 1RNIA 2OOXB 2JMOA 2VUGA 2VF1A 3PO2I 2RBLA 1RO2A 4BBRI 4RVFA 5T64A 1KD11 3CCU1 3CCMZ 3CCJ1 4DQYB 1TWHI 1I6HI 3CMA1 4TNUA 3U50C 5D1PA 3CME1 4BY7I 5C4JI 3G711 5FLXf 1KC82 3MONA 4E33A 3FKII 2E2II 3CCEZ 3TE5B 1DL6A 1K9M1 2OZKA 1USPB 1Q7Y1 3S2DI 2JS4A 3GTOI 2E2JI 1YJ9Z 1VQ61 3I551 3CCSZ 1N8R1 4HH4A 5T67A 4HGZA 4CL1A 3CCR1 5AN9F 3GTKI 2NVYI 2P28A 3F3PC 3PO3I 1KQSZ 1K732 2R93I 1Q812 1VQ5Z 4RVHA 3J81b 3GTMS 3HOWI 3CCE1 2EGTA 4E32A 3D9XA 4BXXX 4MRIA 3NDJA 1VQL1 4E30A 3CCUZ 3CPWZ 1KRLA 3GTMI 5FLMI 1K731 2YADA 1Q811 4A3JI 5FLXb 2ZAEB 1TWAI 4NBHA 1VQO1 3S14I 1K9M2 2DE5A 3CCQ1 1KC81 2QA4Z 1VQ71 1JWHC 3NH5A 2OTJZ 3JAMb 1RQFA 5C44I 4A3KI 2JUBA 3CCL1 1YJWZ 1YHQ1 3CC4Z 4RVGA 1TWGI 1KD12 3FQMA 4AYBA 1VQLZ 3CCQZ 3FQQA 2OTL1 5A2Qf 1QF8A 3K7AI 1VQNZ 3P5JB 2YU9I 2I3CA 4EWCA 4S1TA 2JA8I 1VQM1 1W2BY 2GTIA 1S72Z 2E2HI 4Y52I 1YHQZ 1ZB8A 2KI7B 2W04A 3RZOI 1I3QI 3CD61 1YJN1 3CMEZ 1VQ4Z 2DMEA 3RZDI 4A3EI 2QR1B 2LW4A 2GTHA 1YJ91 3HOZI 1S721 3JAMf 3OW2Z 4HGYA 1VQ91 1M1K2 3BG1B 1N8R2 1QVFY 3S1NI 1WIIA 1ENWA 1YUAA 2V8IA 4NBDA 4DK1A 3GTPI 3HOVI 3LUSA 1K8A1 1VQPZ 4MXUA 1R9TI 3EERA 1VQOZ 3EEDA 3I56Z 1JJ2Y 2JA6I 4E2XA 3S1RI 1RO0A 2QRCB 3D6WA 5C3EI 1SFOI 4NOZA 1I50I 3CCLZ 1Z02A 4NFRA 4BY7X 2R7ZI 2RIQA 1YJW1 2PMZA 4QTUA 3S15I 1YITZ 3S16I 2P3YA 3IFUA 1ZB9A 1Z01A 1NJI2 3T4NB 2WB1A 1VQ7Z 4RS4A 5T6BA 2V8JA 1QVGY 1VQN1 1JJ2Z 4RVDA 1VQMZ 3MZLB 1N2FA 4MD8A 3CPWY 5IP9I 2DE6A 4X6AI 2IZ3A 5C4XI 2LIYA 3HOXI 1VQ8Z 4A3DI 2B63I 2QKDA 2RT9A 1YIJZ 4A3FI 1YJNZ 3VMGA 3BG0B 3H0GI 4E2WA 1WCMI 1ZH1A 2JA7I 1Q7Y2 1TFIA 3NH8A 4BY1I 1S7MA 2NVQI 5CM2M 1KQSY 3F3FC 4NBFA 3G6EZ 3CC2Z 1VQKZ 3CXCY 3NFZA 2G2KA 4E2YA 4BXXI 1VQ81 5IP7I 2JA5I 4A3CI 3CC71 1YI21 3PO3S 3NH4A 3CD6Z 3QWUA 3S1MI 2NVXI 2Q51A 3VTNA 2AKLA 2F4OA 3HOUI 5LL6f 3CCS1 2NVTI 1NP6A 3GKQA 2LFUA 3IX0A 1M901 4NBCA 3NDIA 3CXCZ 3J80f 3GTLI 3S17I 2H85A 4A3BI 1Y1WI 3J7A4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 I;  1TWC I;  4BXX X;  3HOY I;  1R9T I;  2K5R A;  2JR6 A;  3EER A;  3M4O I;  4Y7N I;  3VMH A;  3CQZ I;  4NB9 A;  2JA6 I;  4XX2 A;  3I07 A;  2R92 I;  3GTM I;  3S1R I;  2VUM I;  3VMI A;  2F4M A;  5FLM I;  1X3W A;  3D6W A;  5C3E I;  1SFO I;  1QYP A;  1RLY A;  4NOZ A;  1I50 I;  4BY7 X;  4A3J I;  2R7Z I;  1TWA I;  4NBH A;  4QTU A;  3S15 I;  3Q87 A;  3S14 I;  2PK7 A;  1PFT A;  3S16 I;  3S2H I;  1L1O C;  2DE5 A;  2J6A A;  2P3Y A;  3GTJ I;  4A3G I;  1ZB9 A;  2KPI A;  4A3M I;  4NBE A;  3NDQ A;  1Y1V S;  3H3V J;  1LQL A;  1VLA A;  5C44 I;  3GTG I;  1WW9 A;  2JNY A;  4BBS I;  1N2F A;  4A3L I;  4A3K I;  5IP9 I;  4NBA A;  2DE6 A;  3S1Q I;  3VB9 A;  4X6A I;  1X3Z A;  5C4X I;  3HOX I;  4A3D I;  2HF1 A;  1TWG I;  2B63 I;  1USP A;  4A3F I;  3VMG A;  3I4M I;  3K7A I;  1ML8 A;  3H0G I;  1WCM I;  2JA7 I;  1TFI A;  4BY1 I;  2YU9 I;  2NVQ I;  4A3I I;  5CM2 M;  3PO2 I;  2RBL A;  4NBF A;  4BBR I;  2JA8 I;  2E2H I;  4Y52 I;  1RO4 A;  4BXX I;  3ESW A;  1ZB8 A;  3GTQ I;  1TWH I;  1I6H I;  4A93 I;  5IP7 I;  2DE7 A;  2JA5 I;  1Y1V I;  4A3C I;  3U50 C;  1I3Q I;  3M3Y I;  3RZO I;  4BY7 I;  5C4J I;  3PO3 S;  3S1M I;  3FKI I;  2E2I I;  2NVX I;  1DL6 A;  4NBG A;  2DME A;  4NBB A;  3RZD I;  1USP B;  4QTT A;  3S2D I;  2JS4 A;  3GTO I;  3GCF A;  2AKL A;  2F4O A;  4A3E I;  2E2J I;  3HOU I;  2LW4 A;  2BJO A;  2NVT I;  1TWF I;  3HOZ I;  3GKQ A;  4NB8 A;  3I4N I;  3GTK I;  2NVY I;  4NBC A;  3PO3 I;  4BY1 X;  3S1N I;  3GTL I;  3S17 I;  2R93 I;  1ENW A;  1YUA A;  4A3B I;  3GTM S;  3HOW I;  4NBD A;  1Y1W I;  4MH4 A;  3GTP I;  3HOV I;  3LUS A;  1NUI A; 
#chains in the Genus database with same CATH topology
 1K83 I;  1TWC I;  4E2Z A;  2E9H A;  5DQV A;  2JR6 A;  3M4O I;  3G6E 1;  2M6N A;  3J81 f;  2WMA B;  3VMH A;  1VQ6 Z;  2I40 B;  4MD9 A;  3CQZ I;  3MZK B;  1X0T A;  4Y72 B;  5BNJ B;  3HBL A;  4XX2 A;  3I07 A;  2VUM I;  3DOG B;  2HU9 A;  2ZPF B;  5LMK B;  2DXC B;  1X3W A;  2CZ7 B;  1YUK A;  5IDN B;  4HNT A;  1K8A 2;  3OW2 Y;  1RLY A;  2Q4Z A;  1OIU B;  3O0G D;  4MON A;  1UGR B;  4ELL A;  4BCH B;  3CCM 1;  4G6L B;  3Q87 A;  1PFT A;  3CCV 1;  3TNW B;  2WMB B;  3S2H I;  2OTL Z;  1L1O C;  2QLV B;  4MD7 A;  3GTJ I;  3CMA Z;  3HB9 A;  4CFV B;  3NDQ A;  4NBE A;  1Y1V S;  1URC B;  3H3V J;  1O9K B;  3MI9 B;  4RV9 A;  5IT9 b;  5I5Z B;  4YOO A;  5HVY B;  1VLA A;  4KRC B;  4BCN D;  2V22 B;  1V29 B;  2JNY A;  4F7J B;  4EOJ B;  1JKW A;  3CC2 1;  2QDJ A;  5ACB A;  1FDO A;  5A2Q b;  1KXU A;  2F2C A;  3S1Q I;  4NBA A;  1OKV B;  3MY1 B;  1X3Z A;  2HF1 A;  5ICP B;  2Y0S A;  4F6S B;  5D1O A;  2UZB B;  4CXA B;  2PM9 A;  1AA6 A;  1YI2 Z;  3I4M I;  2DD5 B;  2CZ6 B;  1YIJ 1;  2BPM B;  1ML8 A;  4EC8 B;  2IV2 X;  1UNH D;  1XO2 A;  3X26 B;  2OTJ 1;  2WEV B;  3BLQ B;  5D1O B;  2WXV B;  3DL1 A;  4A3I I;  1Q86 2;  2IZ4 A;  2V8K A;  2RHB A;  2QEX Z;  2WPA B;  1QVG Z;  2QGS A;  1VQK 1;  1RO4 A;  1Q86 1;  3HKZ A;  3ESW A;  3GTQ I;  4E31 A;  4A93 I;  2DE7 A;  4BBR M;  1Y1V I;  1Q82 2;  1AHJ B;  4UN0 A;  2CYZ B;  1WZN A;  4MFD A;  1UGQ B;  1VQP 1;  5HBE B;  2O53 A;  4MIM A;  2DD4 B;  4NBG A;  4NBB A;  3I55 Z;  3A8L B;  4QTT A;  4HNU A;  3GCF A;  4I3Z B;  4TTH A;  1NJI 1;  2M48 A;  3IF8 A;  3G4S Z;  1GY3 B;  2BJO A;  2OOY B;  1TWF I;  1H1R B;  3I4N I;  1E9H B;  4NB8 A;  2QA4 1;  5IT9 f;  3QYH B;  3BG5 A;  1VQ9 Z;  2G77 A;  1Q82 1;  1H1P B;  4BY1 X;  3KIH A;  2C5N B;  5LQF B;  1Z03 A;  1VQ5 1;  1TD6 A;  2W03 A;  2QRE B;  1GH6 B;  4HNV A;  2JIM A;  2ZPB B;  3QWL A;  4QSH A;  4MH4 A;  3LQ5 B;  4ROC A;  3EJ1 B;  1NUI A;  3G71 Z;  1VQ4 1;  1QVF Z;  2O4H A;  3M3Y I;  4DGL A;  3HOY I;  3CC4 1;  2K5R A;  4Y7N I;  3CCR Z;  4NH1 C;  3A8M B;  2RPR A;  4NB9 A;  3BHV B;  1QMZ B;  1H24 B;  3VKH A;  2R6M A;  2R92 I;  3VMI A;  2F4M A;  4BCN B;  1VIN A;  3VYH B;  3X20 B;  4CFM B;  1M1K 1;  1H28 B;  1QXF A;  1QYP A;  3CC7 Z;  2QRD B;  2K3R A;  1P9N A;  1TFB A;  2JIR A;  3TNH B;  5FGK B;  4EC9 B;  3QHW B;  4Z6Y A;  1F5Q B;  1YIT 1;  3CCJ Z;  1P5E B;  4EOK B;  2PK7 A;  3TDH B;  2J6A A;  3CCV Z;  3G4S 1;  4A3G I;  2KPI A;  3TW6 A;  4A3M I;  3A8H B;  1W2B Z;  1JOW A;  3QYE A;  4ROE A;  2CZ0 B;  3I56 1;  2R7G A;  4MFE A;  5CEI B;  1LQL A;  3GTG I;  2CCI B;  2UZD B;  2PK2 A;  1WW9 A;  4BBS I;  4EOQ B;  2WAQ A;  2W9F A;  1M90 2;  2QEX 1;  2BS3 A;  4ZGD B;  2E7Z A;  4A3L I;  3VB9 A;  2GU2 A;  3J80 b;  2ZPG B;  3KIF A;  1H4L D;  3TN8 B;  1USP A;  3VKG A;  1BU2 A;  2CZ1 B;  1RNI A;  2OOX B;  3X28 B;  2JMO A;  2C4G B;  4FX3 B;  2VUG A;  2EUF A;  2VF1 A;  3PO2 I;  2RBL A;  2QFZ A;  4BCQ D;  1RO2 A;  4BBR I;  1FVV B;  4RVF A;  4BCP B;  2QF7 A;  5T64 A;  1KD1 1;  3CCU 1;  3CCM Z;  4EOM B;  3CCJ 1;  2LEX A;  4DQY B;  1OL2 B;  1TWH I;  2BKZ B;  1I6H I;  3CMA 1;  4TNU A;  3U50 C;  5D1P A;  3CME 1;  4BY7 I;  4OB3 B;  5C4J I;  3HZJ A;  2VPX A;  3G71 1;  5FLX f;  1KC8 2;  1H1S B;  3MON A;  4E33 A;  3FKI I;  2E2I I;  4HLQ A;  3CCE Z;  1UNG D;  4ZGJ B;  3TE5 B;  1DL6 A;  3IR7 A;  2ZPE B;  1K9M 1;  4BCF B;  1USP B;  2OZK A;  1Q7Y 1;  2JS4 A;  3GTO I;  3QXE B;  1YJ9 Z;  2E2J I;  3I55 1;  3CCS Z;  1VQ6 1;  1IRE B;  1N8R 1;  4HH4 A;  5T67 A;  4HGZ A;  4CL1 A;  3CCR 1;  5AN9 F;  4CFX B;  3GTK I;  2C5X B;  4NC6 A;  2NVY I;  2P28 A;  3F3P C;  2BS4 A;  1W98 B;  3PO3 I;  3RGF B;  4BCK B;  1K73 2;  2W99 A;  1KQS Z;  3MY5 B;  2R93 I;  1Q81 2;  3X24 B;  1VQ5 Z;  1GUX B;  2DXB B;  1UGS B;  1Y8C A;  4RVH A;  3J81 b;  1E7P A;  3GTM S;  3TW7 A;  3HOW I;  3CCE 1;  2EGT A;  2ZPH B;  4E32 A;  3KHI A;  4OGR B;  4ZGE B;  3D9X A;  3G33 B;  4BXX X;  4OB2 B;  4MRI A;  1OI9 B;  3NDJ A;  2W9Z A;  1VQL 1;  4F7S B;  5IHY A;  4JX4 A;  1SIW A;  4E30 A;  4YOS A;  3CCU Z;  3CPW Z;  4F6U B;  1KRL A;  2WIH B;  4OB0 B;  3GTM I;  2WFY B;  2WIP B;  5FLM I;  2UZE B;  1K73 1;  2YAD A;  1PKD B;  5DQW A;  4HL4 A;  4AKH A;  1Q81 1;  4YOZ A;  4A3J I;  5FLX b;  2ZAE B;  2C5O B;  1TWA I;  4NBH A;  2ZCF B;  2CJM B;  1VQO 1;  2WHB B;  3S14 I;  2D0Q B;  1K9M 2;  3EOC B;  4EOS B;  4AKI A;  2DE5 A;  4JX5 A;  3CCQ 1;  1KC8 1;  2QA4 Z;  2IW6 B;  1VQ7 1;  2I53 A;  4EOL B;  1JWH C;  3NH5 A;  2OTJ Z;  3X25 B;  3JAM b;  1FIN B;  2IW8 B;  4OB1 B;  1RQF A;  5C44 I;  2B9R A;  1OGU B;  3MIA B;  3K7A M;  2W2H A;  5HQ0 B;  3BHU B;  3DTO A;  4A3K I;  2JUB A;  1QLB A;  3CCL 1;  3HHT B;  4BCQ B;  1D3U B;  1OIY B;  1YJW Z;  4BCO B;  1YHQ 1;  3CC4 Z;  5HBH B;  1FDI A;  4RVG A;  1AIS B;  1TWG I;  2AYD A;  4EOR B;  3FQM A;  2QDY B;  4AYB A;  1VQL Z;  1KD1 2;  3CCQ Z;  1H27 B;  1UGP B;  3BG3 A;  4BCG B;  4ROD A;  3FQQ A;  5A2Q f;  1QF8 A;  3K7A I;  2OTL 1;  3F5X B;  3B57 A;  4BCM D;  1FKM A;  3M03 A;  3P5J B;  1VQN Z;  2YU9 I;  4CFU B;  5CYI B;  3H4C A;  4NST B;  2WJ9 A;  2I3C A;  4EWC A;  4S1T A;  2JA8 I;  3QHR B;  4EOO B;  1VQM 1;  1W2B Y;  2GTI A;  1S72 Z;  5EJC A;  2E2H I;  4Y52 I;  3QZ5 B;  1YHQ Z;  1ZB8 A;  2JIP A;  3POM A;  2AHJ B;  2KI7 B;  2W04 A;  2PHG A;  3RZO I;  1I3Q I;  3CD6 1;  1YJN 1;  3CME Z;  1VQ4 Z;  2CCH B;  2JIQ A;  2DME A;  3RZD I;  2DPP B;  4A3E I;  2QR1 B;  2IW9 B;  5HNB B;  2LW4 A;  2GTH A;  2QQ8 A;  1YJ9 1;  3BLR B;  3HOZ I;  1S72 1;  3JAM f;  3OW2 Z;  4F7N B;  1N4M A;  4HGY A;  4FM4 B;  1VQ9 1;  1M1K 2;  3BG9 A;  3BG1 B;  4EON B;  2ZZD B;  1N8R 2;  1QVF Y;  3D2L A;  3S1N I;  1WII A;  3EID B;  3WVD B;  2V3V A;  4F70 B;  1OKW B;  4EOP B;  1ENW A;  1YUA A;  2V8I A;  4NBD A;  4DK1 A;  3GTP I;  3HOV I;  3LUS A;  1K8A 1;  1VQP Z;  1ZP2 A;  4MXU A;  1H25 B;  1R9T I;  3EER A;  1VQO Z;  3BHT B;  2W96 A;  3EED A;  2X1N B;  4BCI B;  3QZ9 B;  3I56 Z;  1JJ2 Y;  2JA6 I;  3A8G B;  4BCJ B;  2JIO A;  4E2X A;  1C9B A;  3S1R I;  1RO0 A;  2QRC B;  5L2W B;  3D6W A;  4F6W B;  5C3E I;  1SFO I;  2G9X B;  3WVE B;  4NOZ A;  2PMI B;  5IF1 B;  1I50 I;  3CCL Z;  4BCM B;  1Z02 A;  4NFR A;  4BY7 X;  2R7Z I;  2RIQ A;  4CFW B;  2KMG A;  1YJW 1;  2PMZ A;  4QTU A;  5IDP B;  3S15 I;  1Q16 A;  1YIT Z;  3S16 I;  4AKG A;  2P3Y A;  3IFU A;  4OR5 B;  1ZB9 A;  2UUE B;  5HBJ B;  1Z01 A;  1NJI 2;  3T4N B;  3DDQ B;  2WB1 A;  2IN3 A;  1VQ7 Z;  3HO8 A;  4RS4 A;  5T6B A;  2V8J A;  1QVG Y;  1VQN 1;  1JJ2 Z;  4RVD A;  1VQM Z;  4II5 B;  3MZL B;  1N2F A;  2VPW A;  4MD8 A;  4LOC A;  1OL1 B;  2UZL B;  5IP9 I;  3CPW Y;  2DE6 A;  4X6A I;  2IZ3 A;  1AD6 A;  5C4X I;  1G3N C;  2C6T B;  2LIY A;  3HOX I;  1VQ8 Z;  4KRD B;  4CRL B;  2B63 I;  4A3D I;  2QKD A;  4F7L B;  2RT9 A;  1YIJ Z;  2ZPI B;  4A3F I;  1YJN Z;  4EOI B;  3VMG A;  3S2D I;  1O9K A;  3BLH B;  3BG0 B;  3H0G I;  4E2W A;  1WCM I;  1ZH1 A;  2PK9 B;  2JA7 I;  1Q7Y 2;  1TFI A;  3NH8 A;  4BY1 I;  1S7M A;  2NVQ I;  5EFQ B;  3TNI B;  5CM2 M;  2VPZ A;  3F3F C;  1KQS Y;  4NBF A;  3G6E Z;  3CC2 Z;  1GUX A;  1VQK Z;  3CXC Y;  3NFZ A;  3DDP B;  2G2K A;  1H26 B;  4E2Y A;  4BXX I;  1UNL D;  1VQ8 1;  4JX6 A;  5IP7 I;  1JSU B;  4BBS M;  2JA5 I;  4AI6 A;  4A3C I;  3CC7 1;  1JST B;  2VPY A;  3DJB A;  1YI2 1;  3PO3 S;  3NH4 A;  3CD6 Z;  3QWU A;  3S1M I;  4M6V A;  4CFU D;  2NVX I;  1VOL A;  2NAP A;  2KR6 A;  2Q51 A;  3VTN A;  2AKL A;  2F4O A;  3HOU I;  2C5V B;  1H1Q B;  4ELJ A;  5LL6 f;  3CCS 1;  2NVT I;  1NP6 A;  3QYG B;  3GKQ A;  2LFU A;  3IX0 A;  4CFN B;  4NBC A;  1M90 1;  2PJQ A;  3NDI A;  1VYW B;  2JGZ B;  3J80 f;  3CXC Z;  3GTL I;  3S17 I;  2V45 A;  4IMY B;  1WJ2 A;  3A8O B;  3VYG B;  3QYB A;  2H85 A;  4A3B I;  1Y1W I;  2IVX A;  4YC3 B;  3J7A 4;  2BS2 A; 
#chains in the Genus database with same CATH homology
 1K83 I;  1TWC I;  4E2Z A;  2E9H A;  2JR6 A;  3M4O I;  3G6E 1;  2M6N A;  3J81 f;  3VMH A;  1VQ6 Z;  4MD9 A;  3CQZ I;  3MZK B;  1X0T A;  4XX2 A;  3I07 A;  2VUM I;  2HU9 A;  1X3W A;  1YUK A;  1K8A 2;  3OW2 Y;  1RLY A;  2Q4Z A;  4MON A;  3CCM 1;  3Q87 A;  1PFT A;  3CCV 1;  3S2H I;  2OTL Z;  1L1O C;  2QLV B;  4MD7 A;  3GTJ I;  3CMA Z;  4NBE A;  3NDQ A;  1Y1V S;  3H3V J;  4RV9 A;  5IT9 b;  1VLA A;  2JNY A;  3CC2 1;  5A2Q b;  3S1Q I;  4NBA A;  1X3Z A;  2HF1 A;  2Y0S A;  5D1O A;  2PM9 A;  1YI2 Z;  3I4M I;  1YIJ 1;  1ML8 A;  2OTJ 1;  5D1O B;  4A3I I;  1Q86 2;  2IZ4 A;  2V8K A;  2RHB A;  2QEX Z;  1QVG Z;  1VQK 1;  1RO4 A;  1Q86 1;  3HKZ A;  3ESW A;  3GTQ I;  4E31 A;  4A93 I;  2DE7 A;  1Y1V I;  1Q82 2;  1VQP 1;  2O53 A;  4NBG A;  3I55 Z;  4NBB A;  4QTT A;  3GCF A;  1NJI 1;  2M48 A;  3IF8 A;  3G4S Z;  2BJO A;  2OOY B;  1TWF I;  3I4N I;  4NB8 A;  2QA4 1;  5IT9 f;  1VQ9 Z;  1Q82 1;  4BY1 X;  3KIH A;  1Z03 A;  1VQ5 1;  2W03 A;  2QRE B;  4MH4 A;  3G71 Z;  1NUI A;  1QVF Z;  3M3Y I;  1VQ4 1;  2O4H A;  4DGL A;  3HOY I;  3CC4 1;  2K5R A;  4Y7N I;  3CCR Z;  4NH1 C;  2RPR A;  4NB9 A;  2R92 I;  2R6M A;  3VMI A;  2F4M A;  1M1K 1;  1QYP A;  3CC7 Z;  2QRD B;  2K3R A;  1P9N A;  1YIT 1;  3CCJ Z;  2PK7 A;  3TDH B;  2J6A A;  3CCV Z;  3G4S 1;  4A3G I;  2KPI A;  4A3M I;  1W2B Z;  3I56 1;  1LQL A;  3GTG I;  1WW9 A;  4BBS I;  2WAQ A;  1M90 2;  2QEX 1;  4A3L I;  3VB9 A;  2GU2 A;  3J80 b;  3KIF A;  1USP A;  1RNI A;  2OOX B;  2JMO A;  2VUG A;  2VF1 A;  3PO2 I;  2RBL A;  1RO2 A;  4BBR I;  4RVF A;  5T64 A;  1KD1 1;  3CCU 1;  3CCM Z;  3CCJ 1;  4DQY B;  1TWH I;  1I6H I;  3CMA 1;  4TNU A;  3U50 C;  5D1P A;  3CME 1;  4BY7 I;  5C4J I;  3G71 1;  5FLX f;  1KC8 2;  3MON A;  4E33 A;  3FKI I;  2E2I I;  3CCE Z;  3TE5 B;  1DL6 A;  1K9M 1;  2OZK A;  1USP B;  1Q7Y 1;  3S2D I;  2JS4 A;  3GTO I;  2E2J I;  1YJ9 Z;  1VQ6 1;  3I55 1;  3CCS Z;  1N8R 1;  4HH4 A;  5T67 A;  4HGZ A;  4CL1 A;  3CCR 1;  5AN9 F;  3GTK I;  2NVY I;  2P28 A;  3F3P C;  3PO3 I;  1KQS Z;  1K73 2;  2R93 I;  1Q81 2;  1VQ5 Z;  4RVH A;  3J81 b;  3GTM S;  3HOW I;  3CCE 1;  2EGT A;  4E32 A;  3D9X A;  4BXX X;  4MRI A;  3NDJ A;  1VQL 1;  4E30 A;  3CCU Z;  3CPW Z;  1KRL A;  3GTM I;  5FLM I;  1K73 1;  2YAD A;  1Q81 1;  4A3J I;  5FLX b;  2ZAE B;  1TWA I;  4NBH A;  1VQO 1;  3S14 I;  1K9M 2;  2DE5 A;  3CCQ 1;  1KC8 1;  2QA4 Z;  1VQ7 1;  1JWH C;  3NH5 A;  2OTJ Z;  3JAM b;  1RQF A;  5C44 I;  4A3K I;  2JUB A;  3CCL 1;  1YJW Z;  1YHQ 1;  3CC4 Z;  4RVG A;  1TWG I;  1KD1 2;  3FQM A;  4AYB A;  1VQL Z;  3CCQ Z;  3FQQ A;  2OTL 1;  5A2Q f;  1QF8 A;  3K7A I;  1VQN Z;  3P5J B;  2YU9 I;  2I3C A;  4EWC A;  4S1T A;  2JA8 I;  1VQM 1;  1W2B Y;  2GTI A;  1S72 Z;  2E2H I;  4Y52 I;  1YHQ Z;  1ZB8 A;  2KI7 B;  2W04 A;  3RZO I;  1I3Q I;  3CD6 1;  1YJN 1;  3CME Z;  1VQ4 Z;  2DME A;  3RZD I;  4A3E I;  2QR1 B;  2LW4 A;  2GTH A;  1YJ9 1;  3HOZ I;  1S72 1;  3JAM f;  3OW2 Z;  4HGY A;  1VQ9 1;  1M1K 2;  3BG1 B;  1N8R 2;  1QVF Y;  3S1N I;  1WII A;  1ENW A;  1YUA A;  2V8I A;  4NBD A;  4DK1 A;  3GTP I;  3HOV I;  3LUS A;  1K8A 1;  1VQP Z;  4MXU A;  1R9T I;  3EER A;  1VQO Z;  3EED A;  3I56 Z;  1JJ2 Y;  2JA6 I;  4E2X A;  3S1R I;  1RO0 A;  2QRC B;  3D6W A;  5C3E I;  1SFO I;  4NOZ A;  1I50 I;  3CCL Z;  1Z02 A;  4NFR A;  4BY7 X;  2R7Z I;  2RIQ A;  1YJW 1;  2PMZ A;  4QTU A;  3S15 I;  1YIT Z;  3S16 I;  2P3Y A;  3IFU A;  1ZB9 A;  1Z01 A;  1NJI 2;  3T4N B;  2WB1 A;  1VQ7 Z;  4RS4 A;  5T6B A;  2V8J A;  1QVG Y;  1VQN 1;  1JJ2 Z;  4RVD A;  1VQM Z;  3MZL B;  1N2F A;  4MD8 A;  3CPW Y;  5IP9 I;  2DE6 A;  4X6A I;  2IZ3 A;  5C4X I;  2LIY A;  3HOX I;  1VQ8 Z;  4A3D I;  2B63 I;  2QKD A;  2RT9 A;  1YIJ Z;  4A3F I;  1YJN Z;  3VMG A;  3BG0 B;  3H0G I;  4E2W A;  1WCM I;  1ZH1 A;  2JA7 I;  1Q7Y 2;  1TFI A;  3NH8 A;  4BY1 I;  1S7M A;  2NVQ I;  5CM2 M;  1KQS Y;  3F3F C;  4NBF A;  3G6E Z;  3CC2 Z;  1VQK Z;  3CXC Y;  3NFZ A;  2G2K A;  4E2Y A;  4BXX I;  1VQ8 1;  5IP7 I;  2JA5 I;  4A3C I;  3CC7 1;  1YI2 1;  3PO3 S;  3NH4 A;  3CD6 Z;  3QWU A;  3S1M I;  2NVX I;  2Q51 A;  3VTN A;  2AKL A;  2F4O A;  3HOU I;  5LL6 f;  3CCS 1;  2NVT I;  1NP6 A;  3GKQ A;  2LFU A;  3IX0 A;  1M90 1;  4NBC A;  3NDI A;  3CXC Z;  3J80 f;  3GTL I;  3S17 I;  2H85 A;  4A3B I;  1Y1W I;  3J7A 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...