3Q67A

Human aldose reductase c298s mutant in complex with nadp+ in space group p212121
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVSALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of Cys-298 in aldose reductase function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Aldose reductase
total genus 102
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3q67A00
4QBXA 2IPJA 4HMNA 3V0UA 1GVEA 1IEIA 2PD5A 1AH3A 3LN3A 4XK2A 2F38A 4JQ3A 4IJCA 2IKGA 3ONCA 4JQ2A 2R24A 1J96A 3R58A 2ACQA 4IGSA 2C91A 2J8TA 4LB3A 3WG6A 3UG8A 3MC5A 2PEVA 2HDJA 4PMJA 3H4GA 3FJNA 2PDUA 1S1PA 3GHSA 5JH2A 1QWKA 3UZWA 1K8CA 4GCAA 2P5NA 3D3FA 3Q65A 5LIYX 1AZ2A 1RALA 3UP8A 1ZSXA 3WBYA 4Q7BA 3S3GA 1EL3A 3LNMA 4PRTA 5AZ1A 1MZRA 1X96A 3NTYA 4WDUA 2NVDA 3UGRA 4WEVX 4HBKA 5HA7A 2FVLA 4MHBA 3LZ5A 3CAQA 2BGQA 2IPWA 4LB4A 2I17A 3BURA 3CASA 4QX4A 3M4HA 1SM9A 4JTDA 1Q13A 1YNPA 2PDJA 4DBSA 2PDFA 1IHIA 2INZA 2PFHA 2PDYA 4PR4A 5LIWX 2PZNA 3LBOA 2HVOA 2R9RA 3B3DA 2FZBA 4LAUA 1OG6A 2WZTA 3R8GA 4RPQA 3CAVA 3RX4A 1T41A 3EAUA 4XZMX 4GA8A 1ZQ5A 3BUVA 4NKCA 4DBWA 1S2CA 2HEJA 3UZZA 2IKHA 1EKOA 3UYIA 3LUTA 4XZHA 3EB4A 4ZFCA 2ACUA 2PDQA 1AZ1A 3GUGA 1M9HA 3LQLA 3V0TA 1Z9AA 1RY8A 3V0SA 1ZGDA 3FX4A 1LWIA 2IQDA 4WRHA 3UFYA 3GHRA 4XO7A 4IJRA 2HV5A 5LIXX 2PDLA 4FA3A 1XGDA 4JTRA 2FZDA 2DUXA 4DZ5A 1C9WA 1PWLA 3CV7A 3M64A 3R6IA 4YU1A 4WDTA 2PDKA 3ERPA 3LZ3A 3UWEA 4FAMA 4F40A 1MRQA 2VDGA 3RX3A 2A79A 3CV6A 3R8HA 1AFSA 4DBUA 2ACRA 2PDMA 3Q67A 4QXIA 2FZ8A 1EF3A 2WZMA 3BV7A 4JIRA 4JTAA 1QRQA 4EXBA 1HW6A 4LBSA 1YE6A 2PDIA 2FZ9A 3C3UA 3V35A 4XO6A 1PYFA 4H8NA 4OTKA 1MI3A 3LEPA 4XZIA 1PZ0A 3UZYA 2ALRA 4JIIX 1YE4A 3DOPA 2PDCA 5DANA 1ADSA 3MB9A 3G5EA 2PDNA 4R9OA 4PRRA 5M2FX 1YNQA 4EXAA 2IPFA 2IKJA 5LIKX 3P2VA 2HE8A 2PDWA 2F2KA 2PDPA 2ACSA 4JTQA 1HQTA 2I16A 4JQ1A 2HVNA 5HNTA 1LQAA 2PF8A 3O0KA 2IS7A 4JQ4A 3LD5A 4YVPA 4GIEA 5AZ0A 4XVDA 4GACA 2DUZA 3F7JA 4I5XA 1JEZA 3WCZA 4WGHA 2PDBA 3UZXA 4WDWA 3O3RA 4GABA 1US0A 1Q5MA 4XZLX 2QXWA 2ISFA 4ICCX 2PDHA 1FRBA 2HE5A 4LBRA 3LQGA 1X97A 1A80A 3R94A 2IPGA 4G5DA 3R43A 3DN5A 4H7CA 1PZ1A 1Z8AA 3WBXA 1XF0A 4L1XA 3COTA 3RX2A 4XVEA 1Z89A 3N2TA 4FALA 2NVCA 2DV0A 2PDGA 3U2CA 3H7UA 4AUBA 5HNUA 2BGSA 3WBWA 2FGBA 1VP5A 4GQ0A 4JQAA 4JTCA 1EXBA 1R38A 4JIHA 5LIUX 4PUUA 2IQ0A 4XAPA 1AH4A 4ASTA 4LAZA 5KETA 4YVXA 3V36A 2PDXA 4XZNX 1X98A 1S1RA 4PUWA 3QKZA 1AH0A 3EB3A 4QR6A 3KRBA 2INEA 3CMFA 2PD9A 1VBJA 4YS1A 1XJBA 1PWMA 3ONBA 1RY0A 1ZUAX 3LENA 3BCJA 2AGTA 4FZIA 4YVVA 4Q3MA 5JH1A 4GQGA 2CLPA 2BP1A 2IKIA 1T40A 4WDXA 3H7RA 3VXGA 3R7MA 1UR3M 3N6QA 3GHUA 4L1WA 1S2AA 3M0IA 1Z3NA 5C7HA 3GHTA 3T42A 3G1RA
chains in the Genus database with same CATH superfamily
3M1ZA 1Z42A 3GNXA 1B54A 1W9DM 4H9VA 4IMGA 1XG4A 1QPRA 2OZ0A 2FHCA 1YNYA 4I90A 5D04C 4J7RA 4FI4A 3LNPA 3WJWA 3RRXA 4BQ4A 4S3DA 4IMCA 2BOFX 3KFTA 3WEMA 1RK6A 4QEEA 5C2CA 3ZWTA 4R27A 3ZR6A 3UCCA 2MUCA 5HOSA 4JFSA 4JEQA 1A53A 1DHPA 3L23A 3RCMA 1KFCA 1V51A 4O11A 3EA1A 1A50A 3CHFA 1XHGA 2C3ZA 1W91A 1B3WA 1S1PA 4OBRA 4RE0A 1TCMA 3TOYA 4GCAA 1MVYA 2P5NA 3NZQA 1BGGA 1XFCA 3KTCA 1CXEA 4NQ1A 3II1A 3PP7A 3CAKA 2RDTA 3S9IA 3IJDA 5PTDA 1VFTA 2J7FA 3H2OA 1UD5A 4D6EA 3SY8A 3V3WA 1UWRA 1EJWC 5AC6A 1JF5A 3MI2A 3E3HA 1EJXC 5C6MA 3W86A 3THCA 5AYXA 1TRDA 1OX4B 3CUHA 3PG8A 1O5KA 1DJQA 1Q4WA 3GFYA 4DM1A 1E1EA 4QP0A 3WDRA 5REQA 2ONEA 4ZQOA 1M7XA 4ZSTA 1VKFA 4OOZA 4XQ6A 2AL2B 4KWOA 1QPOA 1J0JA 3U6WA 3LBOA 1UD2A 4PTXA 3EWZA 2QHAA 1UKSA 4RPQA 1SSGA 1QR7A 1EXPA 3KHDA 5H6HA 1TMLA 3LCGA 4ACZA 4EWJA 4C1NB 3WLSA 3QGAC 3KUMA 5DXXA 3HGOA 3WQ8A 1Q63A 3GRIA 3TA9A 3ZT7A 3FCPA 3UWQA 2JKPA 1D7KA 3MSGA 5A6JA 4LYPA 3AIWA 4UTKA 1J10A 1LUCA 4AX6A 5AKQA 3VFCA 5DO8A 2QVHA 4B92A 3DHDA 4Q8OA 4WRHA 3U2OA 1P6WA 2XH7A 4DO6A 1DPMA 2XIIA 4NYUA 2ABAA 3DI0A 3V75A 2GOUA 4OECA 3UWZA 3TSMA 1R3YA 5IDZA 3TEVA 5D03A 2B0MA 3VX0A 1ZU8A 3H22A 4FF5A 4AZ7A 1K4GA 2YCLB 3WD3A 5IBXC 4DRSA 5CBJA 4M51A 4JOMA 3GAYA 2ZC8A 3OZMA 2XH2A 2YYTA 3KP0A 5HATA 4AZCA 2JBMA 1TPWA 1MO0A 5EY5A 5AHNA 5BZAA 1V6YA 3W2NA 2XTKA 4BF5A 4LV4A 1TX0A 1DOSA 2A7RA 1T7LA 2FQIA 1DIEA 4MJZA 1IGSA 3RCNA 3N25A 3KLLA 1O1ZA 3GU1A 3BMWA 3GIYA 5D2WA 1TTPA 4K3ZA 5DMLA 1JAEA 1O94A 4FEZA 5GNXA 2V5LA 4XZIA 2X41A 4ADUA 3LLDA 1NM9A 1W3JA 3NSNA 4JIIX 1HJUA 5H8MA 4CCZA 1UKOA 1DXEA 4O53A 2CCRA 1B5TA 5CJMA 1WDSA 3WNKA 4UTTC 2PDWA 2WSYA 1WNOA 2B7NA 2X1UA 3ARTA 1KGXA 4IM4A 1HQTA 3WLPA 1KM5A 1R87A 3E38A 4JY8A 1W3KA 3KAOA 2ZUVA 1R7OA 4JAWA 5F1UA 4BR1A 3CMGA 1T96A 1PL9A 2OYKA 3V1PA 3P60A 1CLVA 1WA3A 1RJPA 1EGVA 1JYWA 1TB3A 4OV9A 3OZPA 1Q8JA 3ZT6A 4XTIA 4JL2A 3W1RA 2P8BA 2QW5A 5LKYA 5K9CA 1C8XA 3W29A 1W1A1 5A2CA 4WDWA 1P6BA 2CBUA 3W53A 1N55A 2QF7A 4ICCX 2NLIA 3M9YA 1MFUA 3NYZA 4GNKB 3P7YA 5E9XA 4KCUA 4AWEA 3H2EA 1RBOB 2IPGA 3AIVA 1XSJA 3URBA 4CNTA 2E9MA 4NZJA 3MDUA 1WO2A 1R7AA 3RLGA 4A8RA 3APYA 4MNKA 1VFLA 2A3CA 3M7SA 4NI3A 4XVEA 4CNSA 2VRKA 2P88A 1VJIA 3GG1A 4UR8A 4ZGYA 3W1MA 4BQ5A 1VBHA 5F2MA 3TN4A 5E1QA 5HINA 2GJXA 2BGSA 1ZNNA 2QCEA 7XIMA 1OCJA 3ENLA 4JQAA 4LVDA 3BPWA 3K2GA 3PBUA 1KLZA 8TIMA 2VMFA 1IR2A 8CGTA 1K9TA 4W4QA 5CEWA 4OUEA 4NJKA 1X7IA 2VRJA 4PFMA 1R6WA 5BWFA 1CPUA 5FJIA 1TRIA 3A4AA 2NUYA 4UTIA 1CXKA 4V28A 3F5KA 1R3RA 5HQLA 2QCLA 1FBAA 3UXAA 1XJBA 1OX6A 5C9UA 4QG8A 4F0HA 2OXNA 4I9JA 1RY0A 1KR1A 5E0CA 4D1JA 1JYVA 1I0DA 4QNWA 4UQ9A 1Z69A 2HVMA 5I06A 2FPVA 3ITCA 1N8FA 4Y6GA 3UWYA 4LNYA 4UOZA 1XLLA 3VILA 2V3FA 3QM3A 1V7AA 3M6YA 4GI4A 3ITGA 1XDLA 3M0IA 5XIAA 3G3DA 3CC1A 3T1GA 2KAUC 5LNUA 3RLUA 4W85A 2W63A 2ZE3A 1PCWA 5IM51 3RPTA 4GFSA 4PUKA 2EG6A 1XIFA 1ML1A 3MBFA 1XP3A 4HPHA 3ABZA 4MFDA 3BG5A 1P0NA 1G4PA 1F8MA 2RDUA 4B4FA 4H8HA 3SECA 3ARUA 3H2FA 2VGIA 3RG6A 2Q02A 4Q8NA 2HDJA 3ABSA 5BW6A 4UCFA 2YXXA 3CPGA 1S2VA 1C8QA 4N7QA 2G50A 4AZ6A 4ATLA 4IFRA 4O1CA 1E6XM 4U31A 1PO9A 4H3DA 5BXRA 1IZCA 3FJ6A 1W3TA 2X09A 3T07A 3E49A 3CWNA 1F4AA 3UPMA 2Y7GA 3UP8A 5I07A 4JFVA 1B3OA 1Q6FA 4FX8A 5FEZA 1K3UA 2W61A 3MKKA 4XV0A 3AXIA 2QZRA 4IXHA 3XINA 1KFEA 3A4JA 2XSBA 2RDXA 2X42A 2CXEA 1DWFM 2OYMA 5EA9A 1UZDA 3M43A 3HPZA 3AMDA 3HQPA 4ZE4A 5KITA 1ODZA 2I17A 1J2WA 1W5MA 2WMIA 4HYWA 4FXJA 3ZLHA 2AL1A 3USBA 5C5YA 2BVYA 4F4RA 4C90A 4G56A 2PDFA 2VC9A 3QV8A 1HP4A 4NSBA 4C1NA 4V15A 2XH0A 3RPDA 1FVPA 4KGJA 3W7LA 2PB1A 1DKWA 4JYDA 4F9DA 3W0KA 4JNMA 4M29A 5E6YA 2I57A 3TTYA 1JFXA 3WMBA 2JEPA 4WSJA 1MRAA 4AU0A 4ZFCA 2R1MA 4Q7NA 1W3IA 1T5AA 2X2YA 3K8LA 2WSRA 2VFFA 1FHVA 4JR5A 3WDHA 1RY8A 1J79A 1H3GA 4X2RA 5CJ5A 1OFDA 5HWJA 4IJRA 4IQLA 4MWAA 4GVIA 3W7EA 1RH9A 3N18A 3NXFA 1PHQA 3NDZA 2J8FA 4LEFA 4DYJA 2VRQA 4F79A 1HP5A 1PSCA 5FF4A 1DP0A 4E0CA 2VDGA 4Q7IA 1CT5A 1PTGA 2HTMA 2F61A 5I3JA 3SN4A 1VLWA 3MY9A 1J0IA 3R10A 1SGJA 4P8UA 1TV5A 3BH4A 5EBUA 1V0KA 4YIWA 1QVBA 1TE6A 1W8SA 5G2IA 4PCNA 1SJAA 2WQPA 4HU0A 3UBPC 1TV3A 4YJ5A 3P84A 4FXSA 3BWWA 2WMHA 1YE4A 1B3XA 4AX7A 3WFAA 2EXOA 3DU0A 4EXAA 3UXKA 5MHBA 3AIUA 2E6FA 3E0LA 3BOXA 4IOTA 1W56A 3F4DA 5BOOA 2ISVA 1TWZA 4YWSA 2GSHA 3A4XA 3MMDA 4R5EA 3G6MA 3BLLA 3IAQA 2DPEA 1TQXA 4CN4A 2HISA 2ZADA 4P7RA 2BFGA 4YVPA 2P0OA 2VI0A 4XAZA 4S3KA 3W85A 2NSXA 4L9ZA 2WHMA 2DUZA 4I5XA 3EWYA 1LCOA 3KM8A 3R0KA 1ZCOA 2TMDA 4REQA 1WUFA 4TUFA 1QW9A 2BTMA 4S3AA 1FWRA 2V0TA 2YBUA 3K30A 1G67A 4DY1A 2E77A 2YB1A 3WF4A 4N0RA 1NFGA 4L80A 3OW1A 3LQGA 3GG7A 2CKSA 3FVMA 4DM2A 3TMQA 1CCWB 1UA7A 1JPMA 3LCIA 4QDMA 3PTQA 3CZKA 2BB0A 5D2YA 5F4SA 4WVXA 4U33A 4GKTA 4E3VA 1TIWA 1TYGA 3H2NA 3HF3A 4JEJA 2HQAA 1XYAA 1P1XA 1ODUA 1W9PA 4R3UA 1OIFA 3VU2A 1GOKA 4RR4A 3P82A 1PB0A 3VFLA 5TAOA 4Z2JA 2FGBA 4X61A 4P5UA 2GVYA 4WF7A 2VZTA 1RR2A 3POCA 1LBLA 5G1MA 4WY0B 3N4AA 1OCNA 3Q94A 5HPCA 1EJSC 2EPKX 3G24A 4PCFA 5HK4A 1UCWA 4HN8A 3TSBA 3PAJA 1JCYA 3ICJA 4PEKA 3QTPA 4PBEA 4CCCA 3G0XA 1OFBA 3AYVA 1FH7A 3AHYA 1FXQA 4W89A 4F2TA 3OB8A 1A5KC 4LV9A 4X2PA 4KW2A 2C0HA 1XSIA 1TA3A 1R3QA 3REQA 3HO8A 4KEZA 4DZIA 5LGXA 1QW7A 1UIOA 1DJWA 3AO0A 1FFQA 1IWAA 4BY3A 5C9ZA 3MVTA 3GH7A 1WDPA 3QZAA 2CLOA 1HGWA 3BCJA 4OQVA 1WXYA 4KCVA 1XD1A 3R13A 1Q7QA 2Y61A 5A6TC 1IGWA 2E8YA 3R79A 4CD7A 1FFRA 3HQOA 1CB2A 2NW0A 3WNPA 3AIEA 2EO7A 4H1ZA 3NQ6A 5GNYA 3CV1A 3WL1A 1US3A 1TPEA 1BG4A 1YDVA 1W1TA 5LXEA 1A4MA 4CVUA 2EQDA 2D22A 3PTMA 1PCKA 2A6NA 1AH3A 3T0TA 4IL0A 3TMLA 2BV9A 2P3EA 4HU4A 2J7CA 2H90A 5ABTA 3EDFA 4O0KA 4UTFA 4BI6A 1PVNA 3MUAA 1MQRA 4NAFB 1S38A 4OKDA 3KW3A 2GUBA 2FJUB 4MF4A 1B0IA 3FHAA 4WOZA 3CPRA 3MMTA 3GHSA 1PIIA 3H7VA 4JN8A 1XD0A 2QGYA 4IPNB 3BLFA 3EEZA 2GLKA 3EX3A 2FB3A 4C7GA 5C70A 1ME8A 4PMZA 5CPQA 5CCZA 1O5QA 3KS6A 1V8EA 1EL3A 1XYFA 2HMCA 4RLIA 1IXNA 3KXQA 3NGFA 4RE3A 1JI1A 1WQ5A 3LZ5A 3CEPA 1UP0A 3DFSA 4EIVA 2EG7A 3ARZA 1J0ZA 1LLWA 2VFEA 3WK2A 4YWIA 1E55A 1Q13A 4UMCA 2WM0A 2WMKA 4AFYA 3JVAA 2INZA 2PFHA 2QPXA 2WZHA 2OQYA 1UOKA 1V3KA 3KBVA 3C2RA 1FWSA 1CYGA 3WLMA 1WAWA 1JCJA 2WZTA 2EAWA 1GHRA 4M5PA 4BS0A 1LWHA 4H04A 1TWSA 3BJSA 1VF8A 2QEZA 4K7VA 4AYGA 1AD1A 5HNNA 3QC3A 5I78A 3CUFA 3GH5A 4ENLA 2RDWA 1OT1A 3IPWA 3NAVA 3AS1A 1F6KA 3EWXA 3QBUA 2ISSA 1WXZA 3V0TA 1E0VA 5HPOA 1VHNA 4PRWA 3CEUA 3EA2A 4LUTB 4XSMA 3CZ8A 2V2CA 2POTA 2Y8UA 4Z0SA 2J66A 2FZMA 4NX5A 4H01A 1C9WA 4C6QA 1R9ZA 3GZ3A 4J2PA 1P0EA 3LMZA 4YU1A 4D72A 1HVQA 2DZWA 4FAMA 3WQEA 4IIGA 4FIRA 3MW7A 3OVPA 1K7FA 5F4XA 3OG3A 3FGCB 1UASA 3QQ1A 3A12A 1JCLA 4G9PA 4JFWA 3VOGA 3UXDA 3W7RA 5I7GA 4RKAA 4A3HA 2OSXA 3TNBA 1TELA 1H49A 4C6DA 3ARVA 3HA1A 1UMLA 4S1FA 2AAMA 2A1YA 3V35A 3SAZA 2V5KA 2PF0A 1IIGA 3CTTA 1RBLA 4IMDA 3OA5A 2YX0A 3PZTA 3W37A 4C6BA 3SURA 1ADSA 4GJIA 1GVSA 1EJVC 2V5DA 4Q6XA 3T7VA 1Q4NX 4C6NA 2IMRA 5HBFA 4R9OA 1W1PA 3FJ4A 3WUBA 5AC8A 3WQCA 1B30A 2CLKA 1A5BA 1L8NA 4HOXA 3SQMA 3FAXA 3M0LA 2GVEA 1JDEA 1MNSA 2NT0A 3ANVA 3IANA 4F0KA 1WX0A 2HK0A 4DBEA 4ZCWA 3BSGA 1E73M 4JKKA 4XVDA 1ZB5A 3U5YA 4HU8A 2J79A 3LM7A 5KZMA 3T44A 5IFPA 3IJ7A 3UA3A 5T9BG 4F2BA 3PBWA 5JU6A 1FWIC 2VKZG 3PM6A 1TPVA 4J3SA 4FLRA 1FWAC 3KL5A 1US0A 1QK2A 2VUNA 2YL9A 3ZQ9A 4MJMA 2H9AA 3TOPA 2CLHA 3IVTA 1GQJA 3GE7A 1V3LA 4Z2KA 1Z48A 1EZ2A 5FL0A 3O16A 4PYSA 4M7TA 1V5XA 4IIFA 1NTHA 5AYYA 2CITA 3APGA 2VC7A 2VUYA 3WQDA 3AS3A 3MBDA 1H4PA 2J62A 1PKLA 2P53A 3GUWA 2WMIB 4IIEA 3OBEA 1EHNA 3VE9A 4EKJA 1Q6CA 4Y9PA 2E9LA 1PJ9A 4GG9A 3QRHA 4GUHA 4BQ3A 4IX2A 3NL6A 3NQBA 1R38A 2Z6JA 1JRBA 3EX1A 1A5CA 4QNEA 1ZAJA 1JZ4A 4BK9A 2C7FA 1ZTVA 2GUYA 4MY9A 1BEUA 4YVXA 3WN6A 5T9CE 1TTIA 4ORIA 1JCNA 3QR0A 1H7NA 4HNOA 1KTBA 3ATZA 4Q4PA 2ZX6A 5AHMA 2EGZA 4H83A 1E72M 4L56A 3ZJ8A 1XC4A 3KRBA 4FPSA 1XWYA 3LLFA 5I02A 4TQTA 1N8WA 4K6AA 3PFMA 3ARYA 2E9BA 4A29A 1IZKA 2I7GA 1W54A 3LA4A 2OWWA 1KCKA 2DSKA 3T8QA 3CQHA 4O1AA 3GHUA 5ENLA 1UP2A 1JZ3A 1JPHA 3CIXA 1HO1A 3TONA 5IBXA 3T42A 3LBCA 4IICA 2HXTA 1WZAA 4LAKA 1OF6A 3GC5A 1X1NA 1HTIA 4GXPA 2DFAA 3VIOA 3RO6A 1POJA 1J96A 3EKZA 1D3HA 2WVVA 2VM8A 1V02E 2A0NA 3F4WA 3H8AA 4GBUA 4HJWA 1FKXA 3ORWA 3FJNA 3B97A 3KHJA 3UR2A 1DJHA 4EOUA 2OLHA 2G3IA 2Y7FA 1RALA 4IH3A 1Z6KA 3SM0A 1CEOA 1I2RA 1P48A 3MJYA 4PULA 2WVSA 2QIIA 3PUDA 5LNVA 3QTGA 3CWHA 1F7BA 4EAMA 4BWLA 4ZQRA 2FPTA 1ELSA 1NWSA 3A47A 4R88A 1F07A 1UBPC 4NILA 5CXPA 4LH8A 1P1MA 2X8RA 1G9HA 2WC4A 4Y9MA 4DI9A 1BRLB 1QOPA 1BQCA 5D09A 3S83A 3O0FA 1DTNA 1CGVA 2X2GA 2XWDA 1KR0A 3W24A 1IHIA 1X1ZA 5B7YA 4PR4A 1ZHAA 4V1XA 1TIMA 3B04A 1ITXA 5EMYA 3C6CA 2Y24A 4GRSA 2X1RA 3KWSA 4A4AA 3BTNA 3RX4A 1Z32X 1PV8A 3WNMA 1ZQ5A 1WDWA 5C71A 4DBWA 4JX4A 2HEJA 1JVNA 4DBDA 3W7KA 3AXXA 3MCNA 3HJEA 2EEXA 1IE7C 1VJZA 1GJPA 1DWGM 2YFOA 3I10A 3WD2A 3LXCA 3SSZA 1W3HA 4IUGA 4PC8A 3NO1A 3EWCA 2GQ3A 2RGLA 2NQ9A 2GZXA 2OELA 2IQDA 4ACYA 5DCBA 1BLIA 1PHWA 5D02A 4TU1A 3HPSA 4E2DA 4LAMA 3U4FA 2Z1XA 1TPC1 1E1CB 3M64A 1AJ2A 3R6IA 1VHCA 1JDAA 3FEMA 3S5SA 2ZDSA 3BGAA 3KP1A 3GR4A 3WF2A 1FCBA 2VVSA 2WWDA 4ICMA 1MZHA 3P74A 1VEPA 1K8ZA 3G1VA 4N6EA 2ACRA 4IZGA 1SQ7A 3UG5A 2NX9A 5CSUA 1UIPA 4GZJA 3C2VA 3NWRA 3G8EA 3N2MA 5BXSA 2PCQA 2W6RA 2JF7A 3ARPA 1JULA 3AZSA 3L66A 3OU8A 1B90A 1TWWA 2NT1A 1GKRA 4IT1A 1H1ZA 3MUIA 3U7VA 4Q8UA 4AIOA 3O07A 1KW1A 1YTEA 4ML9A 1XLMA 3MZ2A 4XWUA 2CERA 1A5NC 1JZ5A 2Y5EA 2DUAA 3EXSA 3W4RA 5AC4A 3KCLA 3QHNA 2VEPA 2QUMA 2W91A 1GJWA 3IIZA 3BE7A 2A4AA 3TQKA 3GM8A 3NQEA 5DRIA 4RNHA 5EB8A 4FR6A 3L9CA 4MB4A 1YIXA 2VX4A 4NJHA 1S46A 3BGJA 2QT3A 3E5PA 4GACA 1WAUA 1O1HA 4GYKA 2W4XA 1JEZA 1V7YA 2VHLA 1KWGA 3VC5A 4O1FA 1DE6A 4LANA 1MXSA 7ENLA 4KFPA 4OE7A 4M8UA 3C8FA 1TVPA 1IR1A 1KXHA 1BVNP 2FB2A 1DWJM 4XZLX 1WOAA 5J5DA 2J7BA 4QHRA 1MW1A 2A3LA 3KBNA 4EK7A 4LBRA 3HFTA 1TCDA 2NX1A 4Z1DA 1AL7A 3MHUA 4UNLA 3UWUA 4RE4A 5IOBA 1QTWA 4H2CA 1U5JA 4MIMA 3A9BA 3WYZA 1OADA 3VKBA 3ABXA 3WDJA 4UTWA 3CQKA 3VGFA 1PZ3A 1SW0A 2YZRA 1OC7A 2EBNA 3KOYA 3U2CA 2GL5A 1P0KA 1BYAA 1FQ0A 4DAIA 4AUBA 3SGGA 3GY1A 1QU4A 3SBFA 3VOIA 1OWQA 1PTDA 1UZHA 3VKDA 1E1FA 2YL8A 2FH6A 4PSPA 2O4MA 5DF0A 1NEYA 2Y89A 3TTSA 3IV3A 4PUUA 1EX1A 5CLTA 3ABQA 1ALDA 2DH3A 3N29A 3TQVA 2QJIA 3P61A 2CXGA 2GSEA 3PY2A 5T8GA 1ONXA 3UG4A 2V6AA 2IXUA 4UUIA 3T2PA 2GK1A 1LP6A 3R89A 4JPGA 4M6PA 3ITXA 2QLYA 3WUEA 3CUIA 4B5NA 4DWSB 4O4WA 1P7TB 3TNOA 1XX1A 2HJPA 1OVDA 1KTNA 3MSYA 4RK8A 4IMEA 4FZIA 1GWJA 1YMYA 1SO6A 1N8IA 3VMNA 5G1YA 3I65A 3ZM8A 5E9AA 1T40A 4QAIA 1V93A 4WDXA 3SY1A 4L1WA 1XKYA 4Q8PA 7ODCA 2PP1A 1YHTA 3G1RA 3HGSA 2VDHA 4WLCA 3VNLA 3QW3A 1GVEA 1JZ6A 1AJZA 1K7XA 3WBEA 4EP8C 1W8GA 2G3FA 3QPZA 4ZEPA 3STPA 3P8JA 1I2OA 4OVXA 3WQ4A 3B4YA 3STCA 4IQEA 1TMQA 3G8RA 1A47A 2QCCA 2Y70A 4Z1AA 3LYEA 3G22A 4CKQA 3R58A 1WZLA 1OEPA 2XWEA 3WDPP 9XIAA 2EPNA 3WUGA 4LVBA 4KGLA 4MMWA 4OT7A 4Y8FA 2ISDA 5CGTA 3U4AA 3PZNA 2PDUA 1QHOA 3LDVA 2C71A 3CO8A 1E6RA 2JIWA 3GDLA 1E9LA 1E0TA 3RM9A 5H2ZA 3Q65A 2NXGA 4U2YA 2CEQA 3KRSA 1ZSXA 3MJMA 4FNQA 5EFFA 1HIZA 3IGHX 5AZ1A 3GNRA 2ZRZA 4BCEA 1W3LA 4JTHA 1M1BA 1F8IA 3W9ZA 4UR9A 3W7MA 4AC7C 4V33A 4M80A 3BC9A 2YR1A 5D9PA 4JN7A 2ZXQA 2ICSA 4O14A 4AVOA 6ENLA 1EO5A 3V5FA 3MSRA 1RD6A 2HXUA 4D8AA 1XIJA 2R9RA 3I3DA 4CN1A 4Z2GA 3Q58A 3CL6A 3GC2A 4YYFA 2NV1A 1R85A 3BUVA 3SCWA 2W27A 2NUWA 1X39A 3M7WA 3ZR4A 3SQLA 3W82A 4Z17A 3L67A 2HWGA 2ZA1A 2OLSA 5CSSA 4MTVA 2VC5A 1FCVA 1VB9A 5C9RA 3H2MA 3BG3A 1FWTA 4PN2A 1JUBA 5AN7A 5M03A 2A85A 3WQOA 2VQTA 3IUIA 2HSAA 2IW0A 2J9ZA 3WMLA 2QVNA 2WXDM 2RHGA 1SVDA 4RDVA 3S2JA 1QOXA 2JEQA 4LUYA 6REQA 4HNTA 4DYEA 1H7WA 2PTWA 1W5NA 4UFLA 4FNUA 1QNOA 3TN3A 1GW9A 3AZRA 5FF2A 1S5VA 3W1XA 2PDMA 1BWKA 3UERA 3ANUA 2BY1A 3VE7A 4TMCA 1QI4A 1EJTC 3C2FA 1E4NA 4ZO9A 4LBSA 4X3ZA 5HMFA 4NAEA 4GNJA 3WMCA 2V5BA 1ONRA 2PA6A 1FTXA 4GC4A 1J5SA 1MDRA 4RX0A 1KCLA 3BAIA 4JTIA 4R7OA 2QCMA 2HPIA 3POHA 7REQB 1MXGA 1SZFA 1YXYA 1HL2A 3F4VA 2OYLA 1H1YA 2E67A 2R91A 3O2LA 2IPFA 1RBAA 1ZFJA 5CPOA 3VDBA 2CLIA 2FYMA 3DHUA 2OT0A 1WKDA 1PBGA 4LRTA 3KVJA 4UZUA 4NZ4A 3FW6A 4FNSA 5EMLA 1KBKA 2E3ZA 3MCOA 3H12A 4MUPA 2IS7A 3MS8A 3KS5A 3HB9A 4GE8A 3NO5A 4GIEA 3UZ5A 5HXMA 4GHRA 3CXOA 3SGUA 1AA1B 4XUYA 5D2TA 3S5OA 2GVGA 3OO2A 3E02A 4J2MA 1IIHA 3W27A 2F6UA 4N9BA 4TR9A 4ICNA 4MAVA 1BSLA 3MHGA 3I68A 4ZXLA 3EDKA 3RPMA 4RUBA 4KF1A 4WJEA 1HZYA 1YEYA 4DJDD 4QITA 1LF1A 5GNZA 3VDHA 2Y6ZA 3R43A 3W83A 4LAOA 2J7GA 5M1TA 2FPYA 3M0HA 4LU0A 1Q6QA 2O9RA 4MGGA 3VIIA 3CHCA 3MYPA 3WEZA 1GQIA 2E5DA 1F3EA 3OOQA 3HQ1A 2X0SA 2PLJA 1I9CB 3GH4A 3EWWA 3DFYA 1BPLB 4ES4A 4CQ9A 3HQNA 3WLJA 2TYSA 1FA2A 2GK1B 3RGTA 1NF7A 2CYGA 1YDOA 5D37A 3F2BA 3C52A 2XM1A 2R14A 2QR6A 2X1IA 4CNOA 4HKPA 3W70A 3FNDA 4UQDA 3LCFA 2GGEA 3E1F1 3EBVA 4LJ3A 5LNRA 1AD4A 2QV4A 3TVAA 5REQB 3PWAA 1Q6DA 1XDMA 2C13A 3EX6A 4BFAA 2RJGA 1VEMA 4TV5A 3M46A 2CHRA 4GI8A 3R12A 4JNZA 1IEXA 1GVIA 1V3IA 1TPH1 2JQXA 3L4XA 3GYEA 4IP5A 3W2JA 1UQYA 1F2JA 1F73A 2CIPA 3FXYA 1O6IA 4GZ7A 3WBAA 2AGTA 1AMKA 2J78A 2PU1A 3VM5A 4LX4A 1SZGA 1LLZA 2Y63A 2FVKA 3S2CA 2GPTA 3CWOX 2YA2A 1V3JA 3I6TA 4GD0A 3LHWA 4M19A 5FCZA 5CBIA 1KWKA 4LY8A 1XCXA 1EJRC 1NIUA 4GUFA 1E6QM 2E0PA 3DFOA 4F0MA 3CQJA 2WSKA 4PMQA 3AJXA 2PRMA 2GFTA 1BAGA 3W02A 5ABGA 3WLTA 4X9SA 3DENA 5LA0A 5I00A 4AZIA 2WNWA 3KWXA 3MP3A 2BWGA 4I9MA 3PZGA 4CU8A 3N15A 5I3KA 5CZJA 2G0WA 3CZGA 3K8MA 3PPCA 3UG8A 2C18A 4PBFA 2PEVA 1EH9A 1A4LA 4LT9A 2E68A 4HPNA 1O60A 3RU6A 4XIAA 4UNIA 3B0XA 3WSUA 5FSDC 2PTYA 5F2IA 4GY1A 2VO5A 5G4HC 2VD8A 3GG0A 5EMUA 4E2VA 1SUXA 2AQWA 5IRPA 2C8NA 5AB3A 4GGHA 4PRTA 4AWSA 4HCHA 5HJXA 1X96A 3WQPA 3CH9A 2ATMA 1SSDA 2G4JA 4XKYB 3NR0A 2FDMA 1SJDA 3N2XA 2YLAA 4WKFA 1W9VA 1ZJAA 1O5RA 2J4GA 1F4HA 1WUEA 3BLIA 3OEXA 4RNFA 4LB4A 1VYPX 4UTLA 5A1AA 3G18A 3HGJA 4DO7A 3MU7A 2WV8A 1ZPTA 4QE5A 4KQNA 4I8YA 2DT3A 1YNPA 4ROPA 2QMKA 2E5CA 3ME3A 2OX1A 1U1JA 1EBGA 4CU6A 3L12A 2AAAA 3LS9A 1QJWA 4PTDA 5A5WA 1EC7A 1AQHA 3SDOA 1W1YA 2PWHA 2BVWA 5FI8A 2UY3A 3DKJA 3W87A 1SPQA 3V7PA 1C91A 3L21A 1W2VA 3UY8A 4PFHA 1S5MA 2H8ZA 1SFJA 4NKCA 1S2CA 1ZJBA 3TTEA 1OK6A 2G3NA 4XZBA 5I6SA 3GR8A 4GUGA 3NVTA 4QG6A 4V1YA 2KX9A 5BRPA 2OGYA 4AD1A 3CQIA 4X0VA 2XFRA 3IWPA 4B3LA 3LHYA 4FXFA 2EKGA 3LQLA 3MDWA 4JIPA 5BXTA 4N2YA 2MNRA 2WO5A 4A21A 4GWEA 3ZLGA 2BVDA 3INPA 2HROA 2Q3OA 4J1OA 3VDGA 3TW7A 1XFBA 3LTYA 1TWIA 1HVXA 2GJLA 4JTRA 3P3BA 3ATYA 4RXFA 4DUWA 1I2PA 3NPVA 3L4VA 4WZHA 5AC7A 2PMQA 1PYMA 3DC0A 2ZYFA 1OQFA 4FR1A 2DP3A 3AXHA 2RGMA 2ZIDA 1FWNA 2OOFA 5G5IA 4LC6A 4RW3A 1E0WA 1E3ZA 3W1AA 4CVWA 2FZ8A 3W6YA 1XIHA 2B7OA 3NL2A 3CM4A 3L2IA 4JTAA 4RPPA 3E96A 1C93A 4CCDA 2G3JA 3FV9A 4A8NA 3PVFA 1TZZA 1KM1A 4H8NA 3W01A 3LEPA 6CGTA 2V69A 1PZ0A 4DO5A 3RO8A 6ALDA 2KZHA 1G4TA 4WOQA 3DFPA 3SCRA 3B0UX 2CBIA 3MB9A 4O16A 1EC9A 5CSRA 1I1WA 3N9RA 3VNMA 1GW1A 1CXLA 5G4WA 1V6VA 2XIMA 1CLXA 3ELFA 3BARA 3WNOA 1X38A 1EP2A 1BWVA 4RDWA 2AOSA 4IWWA 4O8RA 4ZOBA 1Q8AA 3O63A 4LEQA 3CIWA 4DUXA 5HJYA 4MLRA 3S2MA 3WIJA 4FLOA 5BU6A 1S5WA 4LGXA 5G1TA 1RJQA 1YDNA 4E8DA 1NP2A 2E25A 3FEQA 1Q5MA 3MWCA 4NG3A 1VR6A 3QN3A 1ITQA 3R94A 3AXKA 3RJYA 2BNJA 3IJ9A 2G3MA 3PPFA 2XVKA 2NV9A 4BA0A 2D2JA 2BZNA 1WDDA 5FESA 3QOMA 3DH7A 4DLFA 3XISA 3GWQA 1ZLPA 4KERA 5BCAA 2EPOA 3OLDA 3SI9A 3DYPA 3IK2A 1ME7A 4R85A 3KBJA 1QT1A 3RU8X 3M0XA 3QC0A 2NWRA 3LCHA 5A2BA 3NO3A 4QLLA 3ITYA 5LIUX 1G7UA 3SCNA 1JZ2A 4ASTA 3CL7A 1NWTA 3FDGA 3C2YA 2PDXA 4H9TA 4GVHA 2BASA 4TO8A 3ZJ6A 1NDVA 4F3HA 2XVGA 1YPIA 3GK0A 4AZCB 2I14A 1DWHM 3NEVA 1RCOB 3SRDA 1ZL1A 4N9EA 4K7YA 3VDCA 4PA8A 1XIMA 1T0OA 3GXIA 3R5EA 4XD4A 2PD9A 4TX9A 3L7RA 2PGRA 1C3FA 4QG9A 1YXDA 2OG9A 3DERA 5LNWA 1DTUA 2PS2A 4QDWA 2CBJA 4X63A 1E6SM 3WD1A 3IVSA 2YXOA 5FOOA 1GEHA 4MWAD 4DJFC 1FCQA 3AUJA 3GHTA 5GJNA 3NQGA 3ITOA 4FOKA 3QHMA 1UROA 2CWXA 5FL1A 3HGRA 1Y0EA 2E09A 2GJPA 3RFAA 4JTUA 3LN3A 3GBDA 5HQEA 1LORA 2RUSA 4L6OA 3VINA 4J3UA 4KMQA 1LWJA 5K3VA 1S2TA 4E8GA 2ZKMX 4YTRA 5AHFA 1RHCA 1JDDA 3UJSA 3FA4A 4IGSA 4UXDA 3O9NA 2J8TA 1RP8A 1JUEA 1U1UA 4JTGA 2BOGX 4DNMA 1J2BA 2Y8KA 4PMJA 1F6YA 1QOQA 5KSWA 2BMBA 4WSKA 1RJRA 2D73A 2A2IA 3CB3A 5FJOA 1AW5A 3NIYA 2PGFA 1C92A 2QCGA 3B0YA 3CV2A 3LSCA 1GUVA 3FSUA 2FZNA 2DW6A 1RCXB 4XD5A 3AALA 4H4IA 4YLWA 1P7TA 3QV7A 3SN1A 2QCFA 2DJXA 5HA7A 3SRFA 3HN3A 1E0UA 2E6AA 3GLCA 1GQLA 2VZSA 1QO2A 5DX7A 2ZZ2A 2ZUSA 4CQDA 2O9OA 1ECEA 2GJXB 3PFRA 3UPWA 1X8CA 3GTIA 1IQ8A 1LOSA 2DZUA 4MY1A 1Q6LA 2FMOA 3QSTA 2PZNA 3W84A 1L6GA 2Q8LA 2OR2A 1R5YA 1R86A 3N4FA 3UESA 5TNVA 3B40A 4LVGA 3R8GA 2BGNE 4WKAA 1G94A 3RHGA 2PP3A 3UU0A 2RKXA 1EJUC 3TCSA 4M3PA 2IKHA 4WJ8A 1BG9A 3AUOA 3IGUA 3WENA 3VZYA 2J88A 1V03A 3V16A 3U57A 1RPKA 4C60A 1DJIA 4NNBA 1Q66A 4PBGA 3SB0A 2XVNA 3WDIA 3LTSA 2G5WA 3RNDA 4D6HA 3GHRA 1JYNA 3EWUA 2Z28A 2CPUA 3F03K 5DBUA 3VNIA 3NZ1A 4O19A 4FA3A 2FZDA 3M0JA 3TA6A 1JQXA 2WC7A 4B5VA 8XIAA 1JQVA 3IARA 3PWIA 1XI3A 3WLHA 1RXOB 1RQEA 3CV6A 4JDBA 1H7PA 4FK9A 5A95A 3QW4B 1ISVA 1AG1O 4EAYA 4J3XA 1MWOA 1EF3A 2YDRA 2A3AA 3GS6A 3VCNA 1XLGA 3N34A 4IFKB 2JIEA 5BMXA 1IT7A 3MTWA 4DJDC 3C3UA 1L6SA 1QI3A 3EWBX 1XIIA 5CQ1A 4V2XA 4UFKA 4HYVA 1I8JA 5FIPA 5A6LA 3RITA 3PNUA 1H0GA 2VP8A 1M68A 3PZMA 1IEVA 2VR2A 4TV6A 3DXIA 3FVDA 3E0WA 1UUMA 3BMXA 4C7DA 4NL1A 1VH7A 5FJTA 1TUXA 5FF7A 4NAEB 5TBOA 3FA3A 4YN5A 2ATSA 3SIMA 4LCQA 4RW5A 4BZYA 1H61A 3B8UA 1BSIA 3LGDA 1TQJA 2G97A 1EIXA 2YGYA 3T09A 4JYFA 7REQA 3W3OA 3T0AA 3W73A 4H19A 4AZ5A 3C86A 3AXMA 3CZEA 1FH9A 3JU2A 2UY2A 2VX6A 5HUPA 4CEUC 5AZ0A 2D20A 1EGZA 4MWAB 4OUIA 5F2LA 1J4EA 3OYZA 1QATA 2WJEA 4MUZA 3RILA 4JTJA 4U4MA 3G2GA 2ZX8A 3CHDA 2Y8VA 3BCDA 3EDJA 4GJ1A 5KINA 3EOUA 3TYCA 2WNZA 1XUZA 3VUSA 4KIRA 1UWIA 3RLVA 4ZQPA 3D3AA 1F61A 2MANA 4ADTA 1WOBA 1EIBA 3PSWA 1Z8AA 1JGMA 3OIXA 1QHZA 3RX2A 2CZEA 3UYCA 4FALA 2CBVA 3JW7A 1WZKA 2PDGA 1ZRQA 2BHUA 2J75A 5U4NA 3H6OA 2QPSA 3GSMA 1VFMA 5HNRA 5CZ0A 2BOEX 5HNUA 3G1AA 1YYAA 1VP5A 2V68A 3O6AA 4IPLA 3G0SA 1FXPA 5A3HA 1G0CA 3THAA 4W93A 1RQHA 4H8VA 2O4QA 1HN1A 1T99A 1LQ0A 3EA3A 3MO4A 1IV8A 4ROQA 3WD4A 3NQFA 3VMOA 2REQB 1OGGA 2DH2A 3ZYZA 1UA3A 2WHLA 5AVHA 1EPXA 3DFTA 2YL5A 5FJRA 3BOLA 3DFQA 1X98A 1Q7ZA 2ZICA 3CTLA 4PUWA 2ZZ1A 2O56A 4PMDA 4IGMA 2FGLA 9CGTA 3GW3A 3GVVA 1HG3A 3VOHA 3GW0A 1BXBA 4I8DA 4CNUA 2VOMA 4RDZA 4O50A 1G01A 5ABFB 4HNLA 3ZJ7A 4HZMA 3TR9A 2WJFA 1PWMA 1CW2A 3KCJA 1F9CA 3WF0A 2HNEA 2POZA 2DT0A 3TQ0A 1E9IA 5CGMA 5JH1A 1W1IE 2CLPA 1R47A 2V30A 6A3HA 3NL3A 4XTDA 3GTHA 3N6QA 3R8RA 3DBNA 3QLDA 4ZZ9A 1Z3NA 4J3ZA 3VGHA 1VBRA 4XAGA 3NDYA 3W7DA 3H54A 4XKMA 2D2OA 1ICPA 4PH6A 4DIAA 5F1VA 3NG3A 2BS9A 3GXFA 3BVJA 1YQ2A 4PTVA 1DJXA 9RUBA 2BHYA 3OODA 1VBUA 4JX6A 4MM1A 4E38A 4WY0A 2R24A 4Q6JA 2C91A 2H9AB 3WG6A 2JKEA 1R3WA 4DLMA 4AWTA 4JX5A 3OP2A 2X16A 4GXWA 1SYTA 2QAPA 4MDPA 3BW2A 4PB4A 5HWMA 5H1WA 4LC8A 5D9NA 3KVKA 4LF1A 2PU0A 2QJMA 3YPIA 2RFGA 5ABHA 1B4EA 4M6QA 3S1WA 1FDZA 4H7ZA 4HHMA 3WBYA 4Q4KA 1JRCA 2RAGA 1QO5A 3LNMA 1M7JA 1MZRA 3RMEA 2QULA 3W74A 3QPEA 3FJLA 3MWAA 3TQPA 1J11A 1DL3A 1GGOA 2FVLA 4MHBA 4N02A 4MADA 2PI6A 3KVLA 4D8ZA 3ZJKA 3TYDA 4QX4A 3NQDA 5A6KA 4G8TA 2CC0A 3M41A 4IFKA 2WC3A 1Q2SA 4R7WA 2GGJA 5EKYA 4PCTA 8A3HA 4LPCA 5DCEA 3OJGA 4KH2A 2VZOA 1VS1A 4IPPA 4G1KA 3BSHA 3LCWA 4QS5A 1YKWA 3PG9A 5TIMA 2R82A 3T8LA 1JUKA 3I4EA 3LV5A 3CH0A 4D1IA 1V0NA 1EP3A 2W5FA 3EAUA 1GCYA 3HMJG 2CLFA 4DEFA 5LSMA 1AW1A 4MLJA 3SN0A 4C65A 1ITCA 2V38A 1F3XA 4QE1A 4U10A 3FY1A 2Q8ZA 3GUGA 1V6UA 1E1CA 1GVQA 1J93A 3GDRA 1MUWA 1M9HA 4I3GA 1VFOA 3GKFA 1S2UA 4ALDA 2FTWA 1YTKA 1BQGA 1LWIA 1HL9A 4O28A 1J18A 1Q6OA 4ZQNA 2PDLA 4NYYA 3LSBA 5H91A 2C19A 3H4XA 1ISYA 1UBSA 4HT3A 1W2PA 1HL8A 1QBBA 2CZFA 3N2CA 4GLEA 2E6DA 1UP3A 2V3DA 3H2AA 1OFEA 2CZ5A 3U3HA 1XS2A 3ZR5A 2J6VA 4FNRA 4V27A 3WJYA 1LRNA 2I56A 2PRHA 3VNJA 3W76A 1RV8A 3WJXA 1KGWA 1XRTA 3VIJA 2YYUA 1AQ0A 2FZ9A 4IP4A 1JJKA 1YBQB 5CPSA 4UOQA 4MPKA 4DO4A 1UWUA 1Q6GA 5BNKA 4AY7A 1PX8A 3DOPA 4JIEA 4MWAE 1QPQA 4MYAA 2Y0FA 1EQPA 3G5EA 5M2FX 1YNQA 4PUNA 5BWAA 3P2VA 5MKGB 5T91A 2UBPC 4I5UA 1X6NA 1LZOA 3QJAA 1CDGA 3PBGA 3C2OA 4JTQA 4A3RA 2R6OA 1DXFA 1MUMA 4UMAA 2ZX7A 3AIBA 1VFHA 3GX9A 3WL0A 2ZTJA 1ZJHA 3M6DA 4DJEC 3QMRA 2VT0A 4K2SA 1OT2A 4S3FA 3MZNA 3IGXA 2TPSA 1E4IA 2HK1A 1NP0A 1KQZA 5KZDA 3EDDA 4PTMA 3LY0A 4L7ZA 3K46A 4FLQA 4W5UA 1A5OC 1CGYA 1UH2A 2VDIA 2Y1HA 3PK7A 4Z1YA 3S0CA 1VCGA 3WEOA 3WDQA 5DT7A 1S3HA 2Y62A 4AMCA 3GO2A 4J27A 2W0UA 2J24A 1PXGA 1NDYA 1ZS2A 1GK8A 2TRSA 4QRNA 1VD6A 1EYWA 3WZ0E 2WVVB 1R30A 4W8AA 3W1PA 2UY5A 1K8XA 4ZOCA 2WMFA 3W6LA 4DJED 5TF0A 4L4OA 3DG6A 3IJ6A 3BAJA 1XF0A 3COTA 1IXPA 4P7NA 1AQMA 1OX5A 1OM0A 4NJGA 2PODA 1GOWA 1JD7A 3KE0A 4OOUA 3V5CA 1UR2A 3VZZA 3G1SA 4B2DD 1SW7A 1ZY9A 4PEEA 1KM6A 3VIMA 2B7QA 2YCKX 3PPHA 1DQWA 3RMJA 4DUVA 2C16A 3PF3A 1KCXA 1TUFA 5G2HA 2DW7A 1M01A 1TPUA 1E3XA 1NDWA 1GOOA 4TXEA 3LB0A 4FP1A 3OTRA 3B05A 1XICA 5A8PA 3AHTA 1QW8A 4B5WA 4HCDA 3CU2A 3QKZA 2R8WA 3M47A 1DIKA 2CW6A 1TR9A 4U28A 4S39A 1UUOA 4JXCA 3DG7A 4UOJA 1WBJA 2VYOA 4YS1A 2DZSA 1EPVA 4DJDA 4M1BA 2C79A 4NX0A 2OU4A 1UR0A 2CLMA 6XIMA 1J12A 1KFKA 4D6JA 5JQ9A 4ZO6A 4WUIA 3NFUA 3BANA 1XRSA 5A69A 2GWNA 4S3JA 3L5MA 4A2RA 3E9AA 2BP1A 1DEDA 3KOFA 7A3HA 1O95A 3QSRA 4B16A 4C6KA 3VGGA 1UR3M 3E12A 2GJRA 3CNYA 4B90A 3UF9A 4J3WA 4Y9OA 2ZRUA 4HQVA 4OIFA 2PSNA 2IPJA 3C8NA 2AKZA 3VIPA 5IXEA 1RVGA 3WK1A 1S5NA 1FUYA 3OA3A 3VTRA 3MI6A 2VURA 3N19B 1ICSA 4TMBA 4DJEA 4Q22A 3VX1A 1K1DA 3TC3A 4S3BA 1GEQA 2WMJA 2PWEA 3D46A 3S2LA 4GNVA 4D9PA 1XKJA 3AOFA 3ZMRA 2XIBA 4HYRA 1WBHA 2NQJA 1GYLA 1NOUA 4PSRA 5LNSA 4O1EA 3HV8A 5DEZA 3O1NA 3BXWA 1FH8A 2CNCA 3IAPA 4GI9A 3LU2A 4N6FA 3CZLA 1QWKA 4XZWA 1K8CA 1VZWA 2J47A 1NH6A 3IJ8A 2FHBA 4KEMA 4C6FA 3RJXA 1CXIA 4AHOA 2QPUA 5I3HA 4ERAA 4W7VA 3WKZA 3GNNA 2ALDA 1MUCA 3W81A 2EKCA 4CNNA 1TV4A 5D8WA 3BLEA 1Y5WA 4B4HA 3A5VA 4IIDA 1ECQA 2NVDA 3VDAA 1BGAA 3UGRA 1UKPA 3S1UA 4M7SA 4RJEA 4F8XA 4JGDA 2QGHA 3A5FA 2ZZ5A 3M4HA 1KBJA 4O4VA 4QJ4B 1VPQA 3EPNA 4PZVA 1JPDX 3MUCA 2ZA2A 3L4UA 4W86A 3AZTA 3ZIZA 4EVZA 3S1GA 3ZLFA 2EPLX 2AQOA 4S3EA 3DDMA 4K1WA 4AD2A 4HA1A 4XZMX 2ZBTA 3SY5A 3PAOA 4GGBA 4RZ5A 4HMDA 3KTXA 1R3VA 3ALFA 4CU7A 4HTBA 1MDLA 2P3ZA 3EB4A 4AZBA 2X30A 2VEGA 2YB4A 4AVNA 2DSVA 3DI1A 3HG5A 2YSWA 4PODA 2PLMA 2R1LA 1GTEA 4LWWA 1ZGDA 3DFNA 3E2SA 4FF7A 4HK6A 4JTSA 1DE5A 3D5HA 1XGDA 3TYZA 1XLEA 3AMCA 1PWLA 1GOIA 2R1KA 2XG9A 3NPWA 1CGWA 2F6XA 2Z26A 3EB2A 1VIZA 3FYYA 4G7EA 3UPBA 1OG0A 1ZBVA 3QKEA 2QKFA 4ILSA 3C4UA 1XH1A 3N9KA 6PTDA 1RUSA 1A3XA 2NQZA 4DUOA 1AJ0A 4JYEA 1C90A 3AWNA 2JALA 1CXFA 3A3XA 3Q67A 2ZRYA 2R94A 1M5WA 1O68A 1WXJA 2OZTA 3LPOA 2ADAA 3BV7A 1VAHA 4O18A 3AC0A 4IG2A 1VENA 4R9XA 4P8XA 4IUOA 4MNLA 1HO4A 3A21A 4WHBA 3NQ8A 1US2A 3W1QA 4NXSA 3MMWA 5B7ZA 1O7AA 5BXPA 5AFDA 2ZUMA 3MMUA 3BZJA 5A6SA 3C2EA 4HB7A 1D7FA 5DANA 3FYPA 1FWDC 1MEIA 3BLPX 1EEXA 3CHEA 1IEWA 1OYCA 4DWSD 5EPDA 4QDPA 5FD0A 8XIMA 2ZUUA 3WF1A 5EGRA 1D2KA 1BXNA 5IFTA 1ZALA 1XGEA 2GUUA 4AISA 4UQAA 1M03A 3W7OA 1YW1A 9XIMA 3NOEA 4X60A 4M24A 3KZSA 4JQ4A 1W5OA 2Z00A 2ZVRA 4F2UA 3T05A 3QQWA 4MZ1A 4ORMA 1GQNA 4FMVA 4L6HA 2FH8A 3NJ3A 1OZQA 4LBUA 3WQWA 4AH7A 3WO8A 3TUUA 3GFZA 3WLLA 4AXKA 4E3TA 4DI8A 2G37A 3MSDA 5LXXA 2DVUA 1HUVA 3A22A 3HJZA 4AIEA 4O1BA 4HOZA 1V6WA 2QXWA 3M0MA 2WBKA 3VCRA 4GFIA 1G69A 4QIUA 4MFEA 4MDOA 5AYBA 4GX8A 3A6OA 1X97A 1GHSA 1ZBKA 3SCQA 1XLIA 2ZRXA 2C15A 4DELA 3G1FA 1MW3A 3LCLA 3BJTA 3W2MA 4O8AA 3IV8A 4ATDA 3DGBA 3AU2A 3CUZA 4WR3A 2XFWA 4JNYA 5I03A 4GYPA 1DJNA 2OWXA 3MYOA 5A6BA 1ZBCA 2PWVA 3H7UA 3W2KA 1KB3A 4LXFA 1VPXA 1W1VA 4NZCA 2Z1VA 4GQ0A 4UTMA 2Q3RA 3IIPA 3URQA 1U1HA 4KBXA 3PB2A 2FMNA 1F76A 5CC6A 1JF6A 3QR1A 1U22A 4EPKA 5KZEA 1RVKA 3L4WA 3BAKA 3S9ZA 4UFMA 3BLDA 3OQ8A 2IQ0A 2FTPA 2Z2AA 2WNNA 3K13A 4Q4OA 1F5ZA 1O12A 2Q6ZA 4Q8QA 3OPSA 2J7HA 4Z2LA 4ZE5A 3T2OA 4Z2HA 2WK2A 3WK0A 2F84A 3GDTA 3QHOA 3WH8A 4B15A 4O57A 4UFHA 5FA5A 1XLFA 4RZ6A 4M1RA 1M65A 4AF0B 4QLJA 1N82A 3E0FA 3N14A 2JK2A 2REQA 3MHFA 1KGUA 3N1AA 4IXXA 3F5JA 4QQ3A 4MZ8A 2DJLA 1A5LC 3TU9A 1XIEA 3LENA 1WDRA 5I0DA 4AW7A 4H6KA 1E4MM 1EDTA 4DJFA 3SIZA 1L6WA 1TJ0A 1B3ZA 4GZIA 4YTTA 1MQPA 4JTFA 1K02A 4W7WA 4OHQA 4YNGA 1FX6A 3OQEA 1TPFA 2PGEA 5BYWA 3KZPA 4ZO7A 3SUVA 5FSEC 3VO0A 3B4UA 3APTA 1GOQA 1GORA 3FOKA 3QPYA 5DMYA 3TZNA 1R2RA 4EWND 2EJAA 3RR4A 3SSJA 3LXAA 1F3WA 3S6DA 2C6QA 3E2VA 4F0RA 2FTYA 1JGIA 3EMZA 3UQNA 3AHVA 4KCWA 3SJ3A 2D2HA 4XSLA 1ISZA 2Z7GA 4UTJA 1KTCA 1PKYA 3UD6A 3N17A 4B91A 3SUTA 1R3SA 5I77A 3ZZ1A 1PDZA 5D33A 5DT5A 2NLYA 3QV9A 4C6JA 4JKLA 2CU0A 1SR0A 4K8HA 4XX6A 1EC8A 3ZVIA 3M5ZA 3G6LA 3S2NA 1B57A 3GTNA 3PS7A 1H7OA 1OZMA 3MI3A 1QASA 1XR2A 1HKWA 5D38A 3AMLA 4O15A 3S5ZA 1QDSA 1EWEA 4JICA 4S2CA 5MKGA 1TPB1 2RH9A 3SUSA 2D23A 3AYRA 4O17A 2VWTA 2YFNA 3P81A 2CZDA 1W37A 2VVNA 3C61A 3ABRA 3HZ3A 2BXYA 1XG3A 2AQVA 5CPTA 4LY4A 5M17A 4RNIA 3M0VA 2YXGA 4XISA 4KFNA 3NPUA 3TCEA 4AD0A 2HVOA 2HCVA 3TJIA 4HA4A 3OZOA 2WBGA 5HANA 1UJPA 3DHFA 2O7SA 4ZENA 2R1NA 4I9AA 3EDEA 5K4XA 2VFDA 4H9MA 1L2UA 2FLIA 2PDQA 2XH4A 3OGSA 4HMCA 2EPMX 2VGBA 1AZ1A 2QS8A 1JL8A 3F4NA 3N11A 4FXRA 3C56A 3DIPA 4WY0F 3ITLA 4LYQA 5K4ZA 2OB3A 3FDKA 1E5NA 3CHVA 5JIPA 4XO7A 2WSQA 4KEUA 1EDQA 1SZEA 3CMJA 4HN4A 4DPPA 4E8CA 1RD5A 4WK9A 2A7PA 3HOJA 1DVJA 2XGBA 1HKKA 3DEQA 3AU6A 4PMXA 4TOQA 5AECA 3R2GA 3BK0A 1W9UA 4I6KA 1JNDA 1G4SA 3U48A 3GVWA 3GVGA 1G1YA 2V8ZA 2W62A 3H70A 2A7NA 2QDDA 1ICQA 5I79A 5DXYA 3MV01 3NSXA 3Q4DA 2PDIA 3FHQA 1H60A 3C5QA 1IWPA 2OCZA 5CSYA 1J8VA 3GNOA 1I4NA 3QV6A 1LLOA 2WHJA 1R2TA 1SJBA 1JZ7A 1W31A 2B81A 4GQBA 3CUXA 3UR7A 5BRBA 1MXDA 2ZQ0A 1LL6A 2OZ3A 2VGGA 4LVFA 4NIRA 4BI5A 2YPIA 4ZODA 1NVMA 3TAKA 4JKMA 3AISA 4XBSA 4H7VA 1VRXA 3TN5A 2BXZA 2V3GA 3T0DA 1UR4A 2HE8A 4L5ZA 1OYBA 4ZQMA 4GO9A 3WQVA 1IYXA 4XZ9A 1T8QA 1I2NA 1XYCA 1ZZMA 3D6NA 5E93A 4RCXA 2OO0A 3GXMA 5K7JA 2O7QA 2BSLA 1JXJA 5CC5A 5CG0A 1WE5A 5FJJA 3T40A 3B9AA 2Z27A 2NV2A 4G7FA 4AF0A 3GTXA 3SFWA 2ZZ3A 4U5KA 3HG3A 3WCZA 2BY3A 3CO4A 1JI2A 3TLLA 2VGFA 2OOGA 3EZ4A 4GC3A 4GIAA 2WHKA 3IUDA 2ISFA 2VQUA 3BO9A 3N3MA 3OZYA 4L1GA 1LG2A 2PDHA 3B9NA 3LHVA 3QGKC 3ARSA 4G1NA 3QF0A 2HE5A 5CLWA 5CC3A 3I6RA 1E0XA 5GQBA 4WX2A 3IIVA 2GSJA 4LOCA 1I0BA 3GDKA 3URAA 2DORA 1RQBA 2YCEA 4K39A 1TJRA 2QV5A 4FLSA 1Z89A 1UHVA 1NFPA 1UZ1A 1XL9A 3SUWA 2YCJA 1CGUA 1ONWA 2Y7DA 4ZL1A 3KVMA 1V6TA 3DZ1A 1KM2A 2XN2A 5A6BD 3EPOA 2OKTA 3FIGA 3VM7A 1TR1A 2D3NA 1PIGA 2VL4A 1LROA 2BVTA 2NXIA 2QJGA 3AHZA 4R34A 1QFEA 4R33A 1CX9A 1HJVA 1TTQA 1TPDA 1UQZA 1J01A 2XVPA 4E6MA 5H8PA 2ZDRA 1K8YA 3BG9A 2DZVA 4GCXA 2DSUA 2E5BA 4QFUA 5FAJA 1LTDA 5KETA 1YTDA 1X1OA 1X8FA 4IG2B 1JYXA 2Z25A 4W8LA 2OEMA 3DYMA 2PP0A 3GIQA 1BTMA 1CIUA 2ZWYA 5A2AA 3W00A 1R9XA 2WZIA 5C0QA 4X22A 2HZGA 4QR6A 1QXLA 1PX4A 2HBVA 1XLJA 4P8WA 1JDFA 2FDSA 3RUBL 4F9JA 3F2DA 3BL3A 2FVMA 2ANUA 3FKKA 5IHRA 2VCCA 4WGXA 1GQKA 1UH4A 4RZBA 4ZO8A 3UNTA 3L0GA 3BQ5A 3HPAA 1FY6A 3LI0A 1FP8A 4MVAA 5FJPA 4WQ6A 1TVNA 4QJ5B 1KBBA 3DBPA 3ECQA 1J9YA 3W1LA 4B5XA 3QMSA 1NQ6A 3HV9A 1E6PA 3TIMA 3P67A 5FJUA 3O05A 4MB3A 1OCQA 1QBAA 4QBXA 5DCDA 4HMNA 3DYOA 3UWVA 4QAWA 4CQCA 5HMEA 5D4YA 2DZPA 1TZ9A 4RV8A 3R0DA 5E70A 2WQDA 3AHXA 4QE4A 1H7XA 1YADA 4IJCA 2XSAA 3IRSA 4TTGA 2QDGA 3CGTA 3NCOA 3E74A 3GNDA 3PSVA 4LB3A 1CB7B 1G5AA 4AZHA 4YTUA 3VOCA 1YLVA 3OVRA 2V67A 3TXZA 2A3HA 3THDA 1LG1A 3D0CA 2VD9A 3UZWA 2PUZA 2YBTA 4PL2A 3ZVHA 2W79A 2HNHA 4D8LA 1QK0A 3IRDA 2QNEA 3NQ7A 1D8CA 3I3EA 2A5HA 3S3GA 1PPIA 1X7FA 3NQ2A 3VYLA 3W7GA 3VOFA 2DQXA 4O52A 3GDMA 3MKVA 4MB1A 3L4TA 7TIMA 4O0QA 4WEVX 2ZZ6A 1GYMA 1NFBA 2F6KA 3CQ0A 3I4KA 3QR3A 5AYIA 3T81A 2IPWA 3N6JA 3B0PA 3WLOA 4JTDA 1A3WA 2P50A 4WXZA 4HPJA 3ZT5A 3QGVA 3U0HA 1AMYA 2W3ZA 2B4GA 4ZOAA 2WJDA 2Z1KA 3CUGA 4WXYA 3PZVA 1Q3NA 2FFCA 3S47A 2PURA 5EMMA 3ALGA 3QYQA 3B3DA 2D69A 2ASHA 3CAVA 4HVXA 5D9OA 2H6RA 4HZ8A 2WWCA 1I2QA 4J4KA 3THQA 4N4QA 3OBAA 1RP9A 4F48A 2PBGA 5AYZA 2ACUA 1CBGA 3AQUA 1GPFA 5EMKA 4AMAA 2XUCA 1XBVA 3O7UA 5CAHA 5A8GA 2BX7A 1RK5A 3KOXA 3V0SA 5FKYA 2UZ9A 5IDIA 3W07A 3L5AA 2QJJA 3NUKA 1W17A 2YKKA 1HJSA 4DZ5A 2PWUA 4DB7A 3BLOA 2I9EA 4WDTA 2PDKA 1UKQA 4ZBCA 5C8BB 2G41A 4AXNA 2X0HA 4QQUA 5G2WA 1MRQA 3BAWA 4W5ZA 3N13A 2A6LA 4GQQA 3K4DA 4CD8A 4UBPC 1O66A 1AFSA 4D71A 1BYDA 4HD5A 2JE8A 4FNTA 4RL3A 3UNDA 4EANA 1K9EA 4JIRA 3IK4A 4H6EA 4EXBA 1KO0A 1LRQA 4HK7A 1BD0A 4HU3A 3BOFA 3EPMA 5E6ZA 3GQYA 4IISA 3ANYA 3CBWA 1E51A 1R46A 4MOZA 5KEZA 2ZUNA 3W72A 2NUXA 1A3HA 3BW3A 1NARA 2VFIA 2PDCA 3P14A 3TYBA 4ECLA 4AG0A 1Q2RA 3AMKA 1C29A 3OVGA 4U3AA 2G96A 1EX5A 4LS1A 4PRRA 3HPXA 1UOZA 4GMEA 4O1DA 5XIMA 1XQLA 1LT7A 2QCHA 4HSHA 4KS0A 4X9YA 3WELA 2I5IA 3LMYA 3VIHA 4JY9A 5FF3A 1Y7VA 1DJYA 3GIPA 4D6DA 3S5YA 5RUBA 4JD4A 2HVNA 3LCXA 4DPQA 4WSHA 3O0KA 1L9WA 4XKYA 1IWBA 1KKRA 3EOSA 3IGSA 4BI7A 3B06A 4GINA 3WH7A 4W88A 1UG6A 2WPBA 4FO4A 3XIMA 4Z2IA 3TWBA 2VXNA 2YZ5A 1WKFA 3GAKA 4NNCA 1WZMA 3T4CA 2PBOA 1WB0A 1K6AA 3BDKA 1DQUA 4Y8EA 5T26A 4LFYA 1XLAA 3N73A 3E0IA 3M5VA 4JFUA 4MNMA 4MNJA 1YRRA 1P5BA 1ONEA 1UWQA 1A80A 1KRMA 7CGTA 1ISXA 5HMDA 5CZSA 3LGGA 1GZ1A 5CAKA 3VD5A 1SO5A 4FB7A 4PGLA 4JHZA 3K1DA 1BKSA 4L1XA 1ZAHA 4NJJA 2J13A 2W92A 3N2TA 2OKOA 4P7OA 2DDXA 5B80A 2NVCA 1QNPA 3CLWA 1TMHA 2VCBA 4ZSUA 4P61A 3GXTA 2DVTA 3ZSTA 2BDQA 4O13A 5HQMA 1TJ1A 2D1ZA 4DF0A 3OYXA 2QAFA 2X7VA 4JCLA 2BY0A 4YYCA 3PBVA 1Q6EA 3FKRA 2ZA3A 3TYUA 3L4ZA 3QFEA 3FAWA 4P7LA 1GT8A 4I7VA 3FGCA 3BAYA 3SRHA 1H41A 3M5YA 4IGNA 2X05A 2PZ0A 2QF8A 3USZA 3ARXA 3CMFA 5HR7A 1VCFA 1KRCC 1I6NA 2DVXA 1R0MA 1D9EA 1FCUA 1ZUAX 3W71A 3UWWA 2GDVA 6TAAA 3KOWA 2QUUA 5JMUA 3GVQA 4E2BA 3TN6A 2JF6A 4YVVA 2X7WA 3TWAA 2CFFA 2IKIA 1OK4A 3NA8A 3H7RA 3R7MA 3BLKA 1V08A 5L6UA 1UD4A 1Y65A 5F4WA 1N7KA 1OGBA 3PJWA 3WLNA 4GYJA 1S2WA 1KFBA 1E9ZB 1FWBC 4UTUA 4C6MA 1K03A 4FOUA 1UYQA 3STFA 3H55A 3L2MA 4JHOA 1V4YA 4GISA 3O6DA 3WH6A 2YL6A 4XD6A 2AMGA 3VK5A 4US6A 4HSNA 4J28A 4QISA 4LW7A 4MKSA 1UH3A 3KOZA 1KXTA 2IKGA 2WAGA 4DJFD 4BEUA 1ZP4A 3P5ZA 1XPYA 3P8IA 4QLKA 5AHLA 3EXTA 4GJJA 4AY8A 1VPYA 5F2GA 1HF6A 1WP6A 1LUCB 4BHYA 3BGGA 2Z1WA 1HNYA 3U2EA 3OHMB 2XU2A 1WCGA 4DF2A 5JH2A 4K1GA 4IX0A 3W7HA 5DMMA 4BJHA 3AYSA 3GXNA 5LIYX 2ZE0A 4I7UA 2VX5A 1KFWA 3QY6A 3WX7A 2GQ8A 3S8HA 3NVDA 1L8PA 2C14A 3NM1A 3TX9A 2YDAA 1WKEA 3TW6A 3UGVA 1VBGA 3MV11 3ARQA 2WB5A 4HBKA 2B31A 3Q2DA 4H9UA 5DFAA 3E2RA 4HHPA 4MKVA 1WYIA 2D24A 4EE9A 5L9FA 3UCDA 4GUIA 5HUOA 2PDJA 2XPKA 1PKNA 3LHUA 4JL1A 4KT2A 1FWWA 2G8ZA 2I9UA 4S3GA 1PX3A 3LPGA 5M5DA 1NAL1 2WVUA 3L65A 3W28A 1BYBA 3JUGA 1BF6A 1BHGA 1B4KA 4W87A 4ERIA 1RPXA 1V6XA 3PZUA 2YW3A 1P43A 3MPGA 2TODA 1T41A 5M3WA 4H2HA 3SUUA 4UC5A 1P0DA 2DQWA 3UVIA 1J0KA 3TTOA 3L68A 1JCXA 2VNCA 1U30A 3WLIA 3NL5A 2YOCA 2BLEA 2DY3A 2O0TA 2PC4A 3W88A 4AD3A 3FS2A 1B9ZA 3TJ4A 3KLKA 1GKPA 3GXPA 1XLHA 3NQAA 3GNPA 4PB3A 3QY7A 1K70A 1H11A 4EF9A 4HCLA 2ZX5A 3ERPA 2OFJA 1HJXA 3EMQA 4TX8A 1UPPA 5CPNA 5DMNA 1FHDA 1GOMA 4A3UA 3AIRA 4URIA 4AYSA 1OFAA 5CPLA 1TKKA 3Q45A 3PZ9A 1E40A 5G4EA 4PUDA 1E6NA 1H2JA 4DWSA 2GYIA 1H7RA 4NI8A 6TIMA 1QRQA 5FEWA 1HW6A 2QYGA 1XIDA 1H0IA 3MUZ1 4LSBA 4XO6A 3HURA 1MI3A 4FSAA 5AVNA 5FEXA 3VD9A 4CQAA 3WMSA 5BOEA 1XUUA 4Q4QA 2ZXBA 2Y4SA 4GQRA 5J5RA 1VEOA 5AHIA 3L0NA 4H8UA 5ECUA 2IKJA 2OEKA 3UCQA 2DZAA 4IP7A 1NF0A 2VCAA 4RNJA 5HWNA 3CT7A 1CXHA 1Q45A 3IEBA 3WJZA 4HGXA 3EYPA 2GQ9A 1KM0A 4JQ1A 2Q09A 1A5AA 1LQAA 3RM4A 2Z4GA 2PF8A 1DORA 2O55A 3B9DA 3QZ6A 2AL2A 1CGTA 4HNVA 4JN6A 1SW3A 3NNTA 3G1HA 2H3BA 1R2SA 3L0KA 1C7SA 4K38A 1XRVA 1X6UA 3GU2A 4HSOA 3DCPA 1BXCA 2VZVA 4OFCA 3URNA 4ATWA 1Q65A 2PC8A 1ZBWA 2GGIA 2PDBA 3O3RA 3S1VA 2DT2A 3AWOA 3WY1A 3WFLA 4JTLA 1EOMA 1MW0A 4N42A 3T78A 1H5YA 3F4CA 1Z44A 1X6LA 4UNKA 5CJNA 1D3CA 2VTFA 2RJHA 2QMJA 4US5A 3GDBA 5E0KA 4LALA 4OJYA 3Q37A 1XRFA 2J8GA 4TX6A 3R11A 1A0EA 4C6EA 4RE2A 3RCYA 4A8LA 2TAAA 4DZAA 4CQBA 1W5PA 2CHOA 2GVJA 3SADA 2H3DA 1KXVA 3KL0A 4IJBA 4ACZB 4AIBA 3R4IA 4UWMA 3M07A 5LHEA 3AFBA 3OHIA 4PMNA 5A6AA 1TVLA 2Y5JA 1NSJA 5E5CA 1GJUA 4LTSA 4XIMA 4DWDA 2Y88A 3KRUA 3SCVA 3U5UA 4LF2A 4OBSA 4GO8A 4XB3A 3S1XA 1EXBA 1EJ7L 4D6CA 1REQB 3GB6A 2INFA 2CLLA 1OX4A 3W7JA 3SCPA 1U33A 4LUJA 2WCAA 1KRAC 3PR2A 4L9XA 3F2CA 3C0LA 3A13A 3B8SA 1YPXA 1AH0A 1KA9F 4UTWC 4Z1BA 3W6MA 1CLKA 2OLAA 4EF8A 2A21A 4C1LA 3L4YA 1U83A 4EXQA 5GJMA 4IMAA 1VFFA 1NDZA 2QCDB 3QY8A 4DF1A 4OBTA 3WQ5A 1AQFA 1A5UA 3V1HA 5D2XA 2J77A 5LGZA 4GQGA 4TIMA 4HMEA 2ZWZA 1DJGA 1SZNA 1KM3A 4XAFA 4U5IA 5E0FA 1S2AA 3BCFA 1WKYA 1E71M 1EEPA 4IIHA 2Q01A 5EU9A 1Y8BA 4WIWA 1KXQA 4XD3A 1WV2A 1GZGA 3V0UA 3RIKA 2Z6IA 1KBLA 2DSZA 3RYSA 4B3ZA 3D47A 4UFIA 2CWNA 1M3UA 3SR7A 3QH2A 4JIQA 4PCPA 3A4WA 1AODA 3N04A 4JQ3A 3SCOA 4GX9A 3QLLA 1NU5A 3VMPA 2BBFA 5CH9A 4JQ2A 1KBIA 5C7VA 4H6QA 5JUVA 1XISA 5IHSA 1QHPA 3PHAA 3EGJA 1E15A 3VIFA 4DAFA 1J6OA 3N2BA 3JZUA 4AIUA 4INFA 1TTJA 4GBDA 3D3FA 4US5D 1B3VA 2OSYA 1K77A 3O06A 4F66A 5AY7A 1C8VA 2PTDA 3W1NA 4IMFA 4IPJA 2AGKA 3TTQA 1OGSA 1W0MA 1W5QA 3PANA 3W7QA 3NTYA 1I45A 4HNNA 1SO3A 1K9FA 4MJ4A 3L2LA 5I2UA 3V5OA 4DVOA 4MAZA 2J7DA 4U3CA 3NOYA 4TVUA 1NELA 4M81A 1EQCA 3N12A 3EXRA 3TFCA 5KZ6A 3RK8A 1OD0A 3GR7A 3PC0A 1ENUA 1W9BM 4AHPA 2PCEA 1R8LA 5LIWX 2P76A 5ECVA 3CYJA 4ZQCA 3PWGA 3WNNA 4KPLA 1ITUA 2OO6A 4DXVA 4NASA 4EX4A 1OABA 1MEHA 1Y5VA 4C6OA 1UR1A 3H53A 4OU1A 1EOKA 4WJXA 1AUSL 4KETA 4JTEA 2DT1A 1VRDA 3MO7A 5BROA 3VGBA 3KDNA 1A0CA 3DESA 1IZJA 4WD0A 3G3MA 3LUTA 2QJNA 4KRTA 4Y90A 2BG5A 1AK5A 2I5QA 1M7PA 1CNVA 1LRTA 3PJXA 4NP7A 2PLKA 2QCNA 3SRKA 3S5NA 1PE1A 5CG7A 1RAKA 3FX4A 2V81A 4GK8A 3EEGA 3CIVA 1UC4A 4M6UA 4ZFMA 4OV4A 3TAOA 5LIXX 2PGWA 2XIOA 4N9DA 1KM4A 4J35A 2V9DA 1ZCCA 1NOFA 3MQTA 3MCMA 3ID7A 1QNVA 5K2ZA 1W6TA 2EG8A 1UR8A 3UWEA 3NURA 3M0YA 5DQPA 1UD8A 2DIKA 1HKMA 1NOWA 1I1XA 3MANA 3RAOA 2OEJA 1FDYA 3R8HA 4GVFA 1XCFA 3LPFA 1O5XA 2X40A 2GQAA 4QXIA 3AS2A 1EFZA 1S5TA 4K37A 4BWLC 4KWSA 4Y7EA 1QI0A 1IF2A 4E4UA 4AEFA 1M41A 1KC7A 2YCLA 3ITTA 3BW4A 4IQJA 2YLLA 4E4FA 3I3BA 1K6WA 1B31A 3O15A 3WQ6A 4I7WA 1HJQA 3TZFA 1C7TA 1EO7A 4CCEA 3M5XA 1YX1A 3OLIA 1TV7A 4N4PA 3NPXA 1M04A 3DG3A 4BF9A 1XCWA 1OINA 2WVTA 3MT1A 4I5RA 3HG2A 3TYAA 2VWSA 3UJRA 2ZUWA 3QVQA 5BOFA 5D05A 1PKMA 3AMGA 1K9DA 2Q8XA 3MP5A 1V3HA 2GDUA 2VR5A 2V3EA 4LS0A 2XVLA 1L0PA 1VYSX 3NYDA 3FSTA 5DRCA 2ZZ4A 4GOAA 1CZ1A 3B8DA 2OX4A 4S23A 4UQEA 3B9EA 2J6XA 3P5YA 3VOJA 3MUY1 1F05A 1CI1A 3FK4A 1M53A 4LRSA 1QNSA 4GIRA 4AEOA 2JKAA 4GKLA 4MJ2A 3IACA 4NHVA 2PWDA 1EA9C 5DLCA 3EX2A 2XIQA 2WCGA 3RR1A 1E9YB 4WGHA 2PE4A 3KTSA 4GIYA 4R7JA 3E0VA 2YDSA 3RF9A 3G1YA 1UW9A 1XW8A 5KMYA 4EPEC 2J74A 5SWUA 3FYOA 4G6CA 2ZVIA 3MKCA 1M6JA 1L2QA 1FRBA 3W22A 3FN9A 2QUTA 2DIEA 3UA4A 1JCTA 4CD4A 5BMWA 2ODOA 3DN5A 4E2OA 4PL1A 2CESA 3OG2A 3CPUA 3DAQA 2Y7EA 3LG3A 3QZEA 2VZUA 1YBQA 4ZR8A 1REQA 5FEPA 3EOEA 1TZ7A 4KKXA 1XDJA 5F7UA 1JZ8A 4AHQA 1ZENA 3DGRA 1FHLA 4YCOA 2ON3A 2E6YA 2VX7A 2ZOXA 3K4AA 2Z1SA 1EA0A 3O8AA 5HR6A 1TJ2A 2J27A 1UZ4A 1VC4A 3UG3A 4JIHA 1CGXA 3LERA 3K5XA 5DY2A 1AH4A 1IXQA 3TC6A 4CD6A 3UT0A 3TXVA 4MKNA 4GY0A 1RLCL 2ZZ7A 1I75A 3ZO9A 4FS9A 2VEIA 3TROA 1F3TA 3V18A 1W1B1 1UWAA 1PTAA 3R0UA 3R1ZA 4YTQA 4N9CA 4H9YA 1OFPA 4HHLA 3VKAA 2INEA 1IT8A 4KRZA 2PPGA 1QPKA 1XBXA 1FKWA 2D3LA 4ZB5A 3W2UA 4Q4RA 3AJ7A 2VEFA 3HTWA 4QCEA 4GPNA 3EKGA 1SMAA 2O9PA 1B9BA 3H4WA 3IUHA 4DQWA 3WD0A 4PMUA 1F6PA 1H1NA 3LBMA 1V79A 5DY3A 2GGHA 3UW6A 2P8CA 3CAWA 2JGQA 3SEPA 4W9TA 3VNZA 4E4PA 3GYCA 4JS3A 2WSPA 5JXQA 3TJLA 4A3QA 2DZTA 4JTTA 5CZKA 4M82A 1P0BA 2V2DA 4AD4A 4MPQA 3DUGA 1W9XA 1D8WA 1GONA 2F38A 3A23A 3GTFA 4MY8A 1POKA 2ISWA 1G4EA 3W7CA 3PNZA 4FIQA 1ADDA 2F9RA 4W84A 3CS2A 1UD6A 3AAMA 4A2SA 3M44A 2CLEA 3DKLA 4PB5A 4ZB2A 1XH2A 3H4GA 2ZXDA 3VGDA 2IQTA 2O92A 4UFJA 3VIGA 4YL2A 1BWLA 1RLDA 4AZGA 3AROA 2HS8A 4UMBA 4L65A 3T4WA 4UTTA 2EJ1A 3QOKA 4YCPA 4JTKA 4XAYA 2VFGA 4Y9AA 2XGZA 2JGYA 1CECA 3B8VA 1DIOA 4TVDA 4ZXOA 3FLUA 4KFOA 2G4FA 1GVYA 4GZEA 1SJCA 2I5GA 2ZCGA 2VC6A 4Y96A 3CAQA 2BGQA 3LX9A 1T8XA 1HX0A 4XBKA 3BURA 4WKHA 1MW2A 1SO4A 4Z08A 1K4HA 3HG4A 2ZX9A 4DBSA 4GH3A 1J5TA 4Y9NA 5EMJA 1HKIA 5EFDA 2EF9A 3PUGA 5AC5A 3CUJA 1W32A 3LGEA 3VNKA 1OC6A 1A5SA 2FZBA 4LAUA 3SFKA 1ZP3A 1LOQA 4O12A 2NZLA 1PEZA 2Z2BA 4GA8A 1VQTA 3UYIA 4XZHA 1CENA 1FWJC 3B9OA 2R1PA 3OGVA 3REQB 1L6FA 2DEPA 2ABBA 4C7FA 3UY7A 4B5SA 2NQ5A 3MA8A 3TYEA 1Z9AA 2ZUTA 4LUIA 2YJQA 1KKOA 2GWGA 3JZEA 2X1SA 1J0YA 3UFYA 3N9SA 4IHCA 2YIHA 4S38A 3RRAA 4J40A 3NDOA 4O54A 1GNXA 5KTLA 2Q71A 5E09A 2W67A 4L9YA 2Z2UA 3NEHA 1UPMB 1QCWA 3T55A 1KFJA 3ARRA 1J6PA 4NZ1A 1OB0A 3TJXA 3PTDA 1RSCA 7TAAA 3H24A 2WZEA 1HGYA 3H23A 1XSKA 3VPLA 4X0NA 1QMLA 1DWIM 3KEHA 4R53A 2YW4A 4L4PA 2OZ8A 2I1OA 3GVRA 3VKJA 4C6PA 2ZXAA 5EBAA 4GXMA 1EGMA 1TG7A 3VIKA 2DZXA 1VJSA 4A6GA 2XN0A 1YE6A 1GVFA 1MYRA 2W9MA 3SQSA 1W1ZA 2HS6A 4XG1A 5FF0A 3RXZA 5JBFA 3ARWA 4F0LA 2GVLA 4E5TA 4NAFA 2ALRA 2UV8G 4Q4SA 1FWHC 4QS6A 3K8KA 4B5UA 1D3GA 5HAOA 1XH0A 4LVAA 3UXIA 2PWFA 1GVRA 1L6YA 2FKPA 3BSMA 4ML4A 4PUEA 4LCRA 3VCCA 2YDQA 3QXBA 3U2ZA 3S9YA 3LPPA 1EF2A 1GG0A 4ZB0A 4F0SA 3LXBA 3S42A 1H51A 3LRKA 5ABEA 1KNWA 2ZC1A 1MSSA 4HTYA 1EBHA 4PMRA 5HNTA 3NQCA 1NQKA 3E5BA 3SCUA 2XZ9A 3LK6A 5K9XA 2E1WA 4YXGA 4B9YA 3LI1A 3RM8A 2WJZA 3OLEA 5C54A 2CETA 4EPDC 3F7JA 1NWRA 5GPRA 1R9YA 1AL8A 1HT6A 4JHMA 4OGZA 2DGAA 3P0WA 1DIDA 3WFZA 2D2GA 4PE8A 1WDQA 2PTXA 2OJPA 1S3TC 3DX5A 4G5DA 1XYLA 4P8VA 4KWVA 4NY2A 3UXLA 2IXVA 4REQB 4J9JA 4K8GA 4O0ZA 2EHHA 1LBMA 3TW9A 3KBWA 3WUFA 5DELA 3BAXA 4U2ZA 1U5VA 2DV0A 1Q7MA 2P1FA 2D0FA 4HZ6A 4IIBA 4TTUA 3RDKA 4KESA 2A3BA 4DWSC 2HRWA 3GXDA 2X0YA 1JNEA 3DFHA 3EOOA 3WBWA 1AVAA 2E28A 5DBTA 4B9ZA 1H50A 4HZ7A 2A3EA 1V0LA 2OQHA 1FP9A 4LYKA 2ZTKA 4P2VA 2E4TA 4Q8WA 4EPBC 1RA0A 2XFYA 3JS3A 3C0QA 3VNYA 3V36A 1KLYA 4ZA0A 4P7QA 4RZ4A 5D30A 4XZNX 3WJSA 4PMOA 3PUOA 3ZOAA 5CGQA 1EYEA 3LV6A 4Q4MA 4KCTA 4CLMA 3HU7A 1MNZA 3SO7A 1SFSA 4GYFA 4Z0JA 1BKHA 5C9XA 4KWWA 2BHZA 4NNAA 3P93A 2XGIA 3ONBA 3N3TA 3HFYA 1TJPA 2WNQA 3PUEA 1LBFA 3W7NA 4QSHA 4PUJA 4JDYA 4DXXA 3ZSSA 4S2BA 4Q3MA 3IJIA 1FWGC 3EOLA 3GU9A 1TV2A 3VVGA 4L64A 3GC4A 4J3VA 3TDFA 4Z42C 4DX3A 1IXOA 3OGRA 2ZRVA 4POCA 3B8TA 1HKJA 1OFQA 5C7HA 1J0HA 4LUTA 4D6FA 1T6MA 4DYKA 3A3HA 4HA3A 3W75A 2PD5A 3W2LA 2CHNA 1XLDA 4CUCA 3BJFA 1GZJA 2CKRA 4HHHA 2GOKA 4DZHA 2IUZA 2NSOA 2J9YA 4UQCA 3WH9A 3SCTA 1DYSA 3VD4A 1QNQA 4NZ5A 5J04A 4AAJA 3ISIX 3NXLA 2VR4A 1Y5XA 3B0VC 2VOTA 4ZTYA 5JBDA 3ONCA 3H26A 1HJWA 3AS0A 4KEVA 1PAMA 3STEA 3NZRA 2WKJA 3C0JA 1CWYA 1KD0A 1E6ZA 1QI5A 3VC6A 2P0IA 2F8QA 3FA5A 4AD5A 4MYXA 4YPJA 3WH5A 4DXKA 2NX3A 3HMCA 1AZ2A 3PZOA 4PCSA 2QJHA 1V02A 4M6VA 1SU5A <