3QSUA

Structure of staphylococcus aureus hfq in complex with a7 rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
b'NIQDKALENFKANQTEVTVFFLNGFQMKGVIEEYDKYVVSLNSQGKQHLIYKHAISTYTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone Hfq
publication title Structural mechanism of Staphylococcus aureus Hfq binding to an RNA A-tract.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Chaperone/rna
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, N, S
ec nomenclature
pdb deposition date 2011-02-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qsuA00
4C8QA 2EWNA 5CAIA 5GANf 1U1SA 4M77C 2E64A 3SWNA 5GANd 3VU3C 4C92D 3JCMg 3JB9G 3JB9F 4M75C 2DTHA 3RESA 4M7DF 1D3BA 3JCMW 4M7AA 4PJOG 4PJOF 4A53A 5DY9A 1WPYA 3EFSA 4JRKA 4C8QB 3JCMX 3JCMV 1H641 5GAMe 2DZCA 3SWNB 2QTXA 4MMKA 5GAN7 4F7UF 4F7UG 4HT9A 4M7DE 4HA8A 2DVEA 2RA2A 3SB2A 4PJOE 4C8QC 4M77A 2RB6A 1I4K1 1D3BB 4M7AB 2FYKA 2E65A 4M78D 2I2LA 4OP0A 3HFOA 4M75G 4N0AA 3SWNC 5GAN4 4EMKB 1LJOA 4NL3A 5GMKi 4M7AC 2DZ9A 3RERA 3JCMJ 2HNIA 4XTXA 5LJ3j 1KQ2A 1WQ7A 1B34A 4EMKC 4XTVA 4C8QG 4C8QF 5GMKh 2VXEA 5GAN8 3M4GA 3QHSA 2DEQA 4XU1A 4Y91A 4JUVA 4QVCA 4J6WA 4M78A 5GAOn 4N0AC 5GANj 5GAOq 4M7AG 5LJ3g 1B34B 4C92C 1JBMA 3FB9A 5GAMh 5GAOp 3HSBA 1I5LA 3JB9H 1HXDA 1Y96A 4EMKA 2DXTA 3BY7A 5GAMf 3JCMe 3RKWA 3JB9D 3EFRA 3QSUA 5LJ3e 4M7DD 4M78B 4PJOD 4NL2A 4XTUA 4X9CA 4M77G 4M77F 3RKYA 5GAN6 5GANg 4XU0A 1I8FA 1WNLA 1HK9A 4M75F 4J6YA 2YLBA 2DTOA 4J5YA 4XU2A 4F7UE 1I81A 1Y96B 4M78C 4C92A 4DQ2A 4XQ3A 5LJ5h 5GANe 1MGQA 4M77E 2YHTA 3QO3A 5LJ5f 4WF2A 4M75E 4PNOA 5LJ5d 2Y90A 4M7DA 1U1TA 1TH7A 5GAN5 4C92B 4XTWA 3BW1A 3JCMQ 3PGGA 2VC8A 3V7RA 3RIRA 3JB9I 4M78G 4M78F 3RKXA 3JCMc 5GAN2 2RD1A 2ZGWA 4C8QD 2E41A 4C8QE 2DKGA 2DJZA 3V8KA 2CGHA 4JRIA 4M7AF 3JCMh 3INZA 5GMKj 4M7DB 3V7CA 1WQWA 4MMLA 3FIFA 2YLCA 4EMHA 2EAYA 5GMKm 3FJPA 4V2SA 4M7AE 2EJ9A 5GAMd 5GAOr 4M7DC 1N9SA 4JLIA 3QUIA 5GAMj 4X9DA 4HT8A 1LNXA 2VXFA 1BIBA 4C92F 4C92G 2K57A 4M77D 5GMKl 4RCBA 4A54A 1YCYA 1M5Q1 4XU3A 5GMKe 4M75D 4NOYA 1M8VA 5GAMg 4C92E 2E10A 3BDUA 4M7DG 5LJ5j 4PJOA 3HFNA 1BIAA 4XTZA 3V8JA 2E1HA 3JCMP 2RM4A 1LOJA 4RCCA 4EMGA 2DTIA 5GAOm 4F7UA 2FB7A 4QVDA 5I21A 3JCMb 4PJOB 5LJ3h 5LJ5g 1X01A 3GIBA 4M78E 1N9RA 3JCMf 1JRIA 4J6XA 4M75A 1KQ1A 4M7AD 2EJFA 5LJ3f 3JCMd 3V8LA 4F7UB 5GAOl 3BFMA 5GAN3 2EJGA 3L1AA 2JN0A 5LJ3d 5LJ5e 4PJOC 4M77B 2DXUA 3RUXA 3V7SA 5GANh 3L2ZA 3JB9J 4XTYA 3AHUA 4M75B
chains in the Genus database with same CATH superfamily
2CS7A 3EHQA 4IIMA 3CBPA 1R77A 1S1NA 5EG2A 3OMCA 4C0GA 4JZ4A 4M77A 1KD1C 1N8RR 2X51A 3MEVA 4E47A 3L2QA 4K11A 1MNDA 1OZ2A 1LJOA 1Q81R 1D1AA 4KBMB 3LX7A 3J81E 1QVGS 1TU0B 2R5AA 2J6OA 2RHUA 5GMKh 3QKJA 4BI8B 3QHSA 3M57A 2QGFB 3MP8A 3EG0A 3OYLA 1I5LA 1H3HA 3LWIA 2PUKB 1GCQA 2ECZA 1IXDA 5LJ3e 2KXCA 1X43A 5GANg 1VQ6Q 4KGXB 1FMVA 1HK9A 2COWA 2ED1A 4Y28E 4JLGA 2DF6A 3S3MA 1I07A 2MPXC 1PSFA 1NG2A 1AWWA 1C6VX 4KUDK 1JEGA 4E7SA 1VQOA 2XHCA 2MI6A 2VC8A 3FDRA 1RAHB 3F70A 2P0KA 4OF1A 1WZOA 3M53A 1YFNA 4JJDA 1AVZC 2RJEA 1KJWA 3QBYA 2EJ9A 2AZSA 2RNAA 3HL8A 1KFZA 2JTMA 2XK0A 4RCBA 4CRIA 3QDRB 1T3LA 2MWOA 2JMAA 3LH5A 2WACA 5GAMg 1KD1R 5LJ5j 5AYFA 3SEMA 3I55A 3PVQA 5KYUA 2HBPA 3JCMb 2RF0A 5LJ3h 1GL5A 4FT2A 4JS5A 1JRIA 5LJ3f 1OI1A 2NWMA 1M2VA 1QWFA 3NTKA 4PJNA 2JN0A 2E12A 3EG9A 1WDXA 2P84A 3X25B 1R8OB 2EWNA 4PFOA 1IGQA 3RR6A 1VQ6T 1UECA 4C8QB 3JCMX 4R56A 2AT1B 1R0CB 4MMKA 1JJ2P 3PMTA 2RB6A 3SWNC 1YHQT 1ZUKA 3VS5A 1NJIC 3CCST 4M7AC 1VQ4A 3BDLA 2KVQG 4QKUA 1KQ2A 2QA4T 1WQ7A 3CCEA 3EFOA 4C8QF 2AK5A 3M4GA 2V1QA 3CBOA 4XK8E 4R0KA 4J6WA 2QQSA 2V8JA 4B9XA 1K8AC 4M7AG 2KT8A 1JBMA 4C92C 1XTDA 2JT4A 1XOVA 4FIBA 5CKEA 2FG0A 2EYXA 1VQ8Q 2EIFA 2A0FB 3OY9A 3A8LB 2EQMA 5D6YA 3E1SA 4NS5A 4HVWA 2MMPA 1M3CA 3RIRA 4AG1C 3RBBB 4OMFB 3UDCA 1WHMA 2CP5A 4J9CA 1BB9A 4M7AE 2L2PA 3C95A 3A8MB 4M7DC 2BTTA 1LVKA 1SKUB 4F04B 1BIBA 1OOTA 2E5KA 1M8MA 4A54A 1Q86C 1VQ5T 4RMOA 1PKTA 1SSFA 4C92E 4M7DG 4RG2A 3CCVQ 1UUEA 2E1HA 1NJIR 3OW2A 1ZX6A 2DTIA 5J39A 2KY9A 4RTXA 2XDDA 1H92A 4J6XA 2QDYB 2XMFA 1FX7A 1SRLA 4F7UB 3GF5A 2RQWA 2VB6A 3PNWC 1K8AR 2LVMA 1Q95G 2IVWA 2JUFA 1OZ3A 2OX7A 1TS9A 1U8RA 1BI0A 3VU3C 3JB9F 5DY9A 2QG9B 4CC4B 2OI3A 4J83A 3G4SQ 3M0TA 3EG3A 2KE9A 2JJ9A 3CBMA 4AMCA 4F7UF 4M7DE 2RK2A 1IGUA 3NMZC 1NLPC 2JTFA 2JW4A 1QKWA 2XIDA 4LUEA 2H3JA 4NL3A 2DZ9A 2XDBA 1WYXA 2EYYA 4XTXA 2BZYA 1G3WA 2HAXA 3CXCA 4QW2A 5FW9A 3OSSC 1G83A 4M78A 1RUWA 5GAOq 5GAOp 1WHJA 2DL7A 3OSVA 4PLLA 3JB9H 3M54A 4FSXA 3CCUQ 2CZ0B 3P8HA 1Q86R 2RHIA 5IN1A 3RKYA 4OMMA 2K5IA 1QKXA 3MEUA 5KCHA 4BUGA 2H8HA 4B6MA 4C92A 4ZTJA 3OS1A 2RO0A 2OTJA 3CCRA 1ZSZA 3OYNA 4QQDA 1UHFA 3JB9I 4C8QD 2DRMA 1T0JA 4CI0C 3X20B 2JOYA 3FJPA 4IUQA 3VYGA 3I5RA 3H9NA 1WX6A 3META 1BI2A 3ZBDA 2JXBA 2F2XA 2LX9A 1YP5A 2DL5A 5CR2A 1TOVA 2B86A 2DO3A 1V29B 2O9VA 3CEYA 4N4GA 2LQKA 5D7UA 1OYXA 3OS5A 4RTZA 3G6EQ 2GGRA 4M75A 1A0NB 2R58A 2DK3A 2HEQA 3EGXA 4Y92A 2HCKA 2DXUA 1VQLQ 2A08A 2YUQA 3CCUT 1OX8A 1RLPC 1D3BA 2J06A 4YTLA 1M27C 1M4ZA 2ZPIB 1WHLA 1Z9QA 4FM4B 4ZNXA 4D8DA 4HA8A 5KYYB 2RA2A 1VQKA 4PK4A 2O01E 4F14A 1G3TA 1I5OB 1KHIA 2MOXA 3I35A 4C5HA 1W6XA 1JU5C 1ZSGA 3RNJA 1V1CA 1WIEA 2GTJA 4RG8A 2KI7A 4E6RA 1YNZA 1HXDA 2E4HA 3JB9D 3CCLA 2PNIA 2HMAA 2HQXA 1WNLA 2LZ6B 4M75F 2XDPA 2E3IA 4J5YA 1I81A 3RDVA 4XQ3A 4FT4A 1PD0A 4WF2A 2A3LA 1X2KA 1AZEA 2X3WD 3NPFA 2YWWA 3UWNA 2K6DA 3X26B 2BZ8A 2DVJA 1VQMQ 1N27A 2QXFA 2K2VA 2KYMA 1IHVA 2L3RA 2O4XB 3M55A 2GTOA 2EGCA 4JJBA 2DYBA 3VS7A 2K4YA 1QLYA 1X27A 4GLMA 4BACA 5J26A 1VQNQ 5FU6B 4LD9K 2E10A 1YJ9T 4J7IA 4XTZA 5CKDA 1LOJA 4IUTA 5GAOm 1K73C 2FB7A 1QVFA 3OYKA 3CCJQ 2HZYA 4PJOB 1IHWA 4A4EA 4BI3A 1WGSA 1I0CA 2MIOA 2LQNA 1PM3A 5KYXA 4ORZA 3OYEA 4C0FA 1RLQC 3I55T 5GANd 4F17A 1YITQ 2DIQA 3JCMg 2LTOA 1NZ9A 1KK7A 2K3BA 1VQ9A 4PJOF 3CD6A 7AT1B 2BKDN 3OYFA 1SHGA 2CZ6B 2K7AA 1UTIA 5HK0A 2E65A 4M78D 5CQYA 1LPLA 4MZTA 1M9SA 2KRSA 3A98A 4XTVA 3CPWA 2E6ZA 5IHNA 1YJNQ 2DEQA 3M58A 1OQKA 1ZHIA 1AZGB 4R55A 3FB9A 2DL4A 4FYYB 1ABOA 1VQ4T 3L2RA 1BI3A 1VIFA 2KEAA 4RTVA 4M77G 1VQ8A 2D0NA 3QZ5B 3CCET 3WXMB 2DBMA 4D8KA 5CCAA 2DL8A 2NUTA 5GANe 2YHTA 1Y71A 1G8XA 1K73R 1ACMB 4HCZA 3SFMA 1LCKA 1YWPA 1GCQC 3EHRA 3JCMQ 1PKSA 2DXCA 3V7RA 3C0CA 2WSCE 1IB8A 3P8BB 1FXXA 2QQBA 2CGHA 2RI3A 2D8HA 3PVLA 2EFIA 2OAUA 1IREB 2NUPA 4DEXA 1WFWA 3CC2A 4V2SA 2FL7A 1SF9A 4M75D 2V8KA 4OMOA 4O5VA 1WJRA 4BDZA 1BKBA 2M1HA 1X6GA 4L5GA 2F2WA 2EJFA 3OBWA 1ZUUA 5HCKA 2K79A 5GANh 4XTYA 5GANf 2HD0A 3L2VA 2Z0WA 2XU8A 2CP6A 4FYWB 2DPPB 2YRDA 2QAZA 1BBZA 1VQPA 4QQ6A 2DZCA 1JXOA 2QTXA 2DX1A 2MCNA 2D6FA 2DA9A 3GPLA 1FYNA 1I4K1 3L2UA 2EVRA 2RQTA 2RHZA 3CCMA 3GNGA 3SD4A 1QW1A 2RI2A 4EMKC 2J05A 5GAN8 5FWBA 2VWFA 3TQ7P 4L6V5 5GAMh 2O2OA 1KC8U 5GAMf 3RKWA 3EFRA 1GCPA 4PJOD 4JJCA 1QWEA 2KK4A 1Y96B 2F5TX 2QYZA 3CC7T 1M90U 4IIOA 4DBFA 3OYYA 2SEMA 5CK9A 1PC0A 1X75C 1OV3A 1Q82U 3PGGA 2CSQA 1M1KU 1GBRA 1YJWA 3CMEA 2ZAEA 5GMKm 4OB1B 5I2MA 1XJWB 1QVGP 1ZA1B 2KMTA 3QUIA 3CCRT 4X9DA 2M9UA 4MZMA 2K57A 1YCYA 4HVVA 3THKA 4KGVB 4HCBA 2KR3A 1YHQQ 2EKOA 5I11A 3CCSQ 3M56A 2V26A 3KBGA 1WXUA 2QA4Q 1KC8C 2SRCA 2RJCA 1RAIB 1D0ZA 2DFUA 5LJ5g 5A2QE 4M77B 2GQIA 1B07A 2CP3A 2XKOC 4C8QA 2HSPA 3DLLA 1Q82C 1OX9A 1JJ2A 2DTHA 1M1FA 1IZ6A 2DM1A 3TVTA 4C0DB 4LNPA 5A0LA 4JS4A 1JXMA 5KE3A 3VKIA 2KRNA 1NM7A 4A63B 4Q5WA 4IUVA 3CMAA 1AT1B 5HY6A 1JB0E 2MK5A 4RKUE 2HBWA 3DB4A 1PCXA 2ZPGB 2ZZDA 2DL3A 4RTTA 3FLGA 4E7HA 4LXCA 3PMIA 1M2OA 1VQKT 3M0RA 3PIOA 1YIJQ 1VQ5Q 5CVIA 3CCQT 4EMKA 4GY5A 2DMOA 2CT3A 1K76A 1QP2A 4O6JA 4FYVB 1W2BA 1UGVA 2L89A 1WLPB 2PVDB 4M78C 1T0HA 1MGQA 3OYAA 3QO3A 1KC8R 3CC4A 1Q7YU 5LL6S 3G7ZA 4X1VA 1TH7A 2DRKA 4HKEA 1QCNA 5DLOA 1YI2Q 2ENMA 4M78G 3P8DA 2KAFA 1MMDA 5DLQE 4IUPA 5GMKj 1YBYA 3UF4A 3FIFA 2OJ2A 3MKDA 3VS2A 1HYOA 2JS0A 3GOXA 1ZSZC 3G71A 1Q82R 2LT1A 2LCSA 4BI4A 4C92G 2P0PA 5KYWB 1M5Q1 2LMJA 3GNFB 4EDUA 4QT7A 4HCCA 1W2BS 3OS2A 3H41A 5FU7C 4DBQA 4F7UA 5I22A 1G2BA 4M78E 2EW3A 2EQKA 3MEWA 3O8VA 4OB2B 1H3ZA 5GAOl 4J9HA 1GFCA 1PRMC 1NEBA 2KRMA 1YIJT 2BE9B 2KSSA 1UE9A 2QEXQ 1Y07A 3H0IA 1S72A 4M75C 1X69A 5IXBA 5KE2A 3QZ9B 4ZGJB 1MHNA 1UHCA 2L8DA 1NPPA 1WHGA 2EQUA 3I56Q 4ZN1A 4FW1A 4OGEA 2X9HA 4M75G 1U5SA 4Z88A 2ZPFB 2AIRB 1YI2T 3CD6T 5LJ3j 3QWYA 2VXEA 1I1JA 5FLXE 2XG8D 1ARKA 2OTLQ 1HSQA 2HQEA 1KQSA 2DYIA 1D1BA 3QJYA 1KSWA 2JVVA 1Y57A 1OU8A 4ESRA 2DXTA 3ER0A 2RQVA 2A36A 1NYGA 1ZQ1A 3OW2S 3H0FA 1VYTA 4PJJA 1RAGB 1UJ0A 1X6OA 4M75E 2IPOB 4JZ3A 2HDAA 5KCOA 2J6KA 5I2SA 5FU6C 3INZA 2QASA 2YLCA 3VS6A 1P92A 1UGSB 2QEXT 1KQSS 1KHCA 2L3QA 1FMWA 2XI9A 3OYCA 1CSKA 1OULA 2RHXA 1BIAA 3I56T 4KULA 2COZA 3CC2T 4DBRA 3JAME 3JCMP 3A1PA 3IQLA 5CKBA 3TREA 2GCXA 3CXCS 2DLPA 3EGDB 3AT1B 3UA6A 2LX7A 2OTLT 2VGMA 4OB0B 3OYDA 5D6WA 1GBQA 1MUZA 2KT1A 2FO0A 2LQWA 1VQ7A 3DB3A 5KYYA 6AT1B 3CXCP 2J6FA 3HP9A 1M3AA 3M0SA 4BY6C 3KUFA 3VS3A 1JO8A 4HT9A 3SWNB 5GAN7 4PJOE 4M7AB 2FYKA 1J3TA 2I2LA 2L3SA 4X34A 4KH1B 3OYJA 5IT9E 1EFNA 4FU6A 3UPUA 1RAEB 2KQWA 4GLKA 2F69A 1VQPT 2AKLA 2GFUA 2EQJA 4AG2C 4BE1A 4BD3A 2L5QA 2KDSA 4OMNA 4OMLA 3I5SA 4D6WA 1YJ9Q 1NPRA 1TXQA 4X9CA 3CCMT 2P4TA 2ATCB 4DA4A 3L42A 4PKCC 3VJPA 5ECAA 1ABQA 4PNOA 5L8RE 1RADB 2GNCA 3GBQA 2PUOB 2O4XA 3KXTA 3HTRA 2YUNA 2DIGA 3JCMh 4M7DB 2X4JA 4OGCA 3V7CA 3I55Q 3L2WA 1VQ6A 2CKKA 2DNUA 1N9SA 1K0XA 2FRWA 2FEIA 1V76A 4FSSA 3E9FA 5CO7A 5GMKl 1YHQA 1SEMA 1YJWT 3CMET 3Q1JA 2EBPA 3BDUA 1BCMA 2XICA 4PJOA 4QQGA 2Y4YA 1TG0A 3OB9A 2PU9B 4PLIA 2YRCA 5IHKA 3V8LA 4FCYA 4JJNK 1VQOT 1NEGA 2EQIA 2HQHA 1VQ4Q 2R57A 2DAQA 2DEUA 2WSFE 3CCEQ 4OB3B 2GF7A 1AHJB 2W0ZA 2DILA 3JCMV 1MV0B 4DOWA 2E70A 3LLRA 2CT4A 4LDVA 2VV5A 1WJQA 3R6OA 3ZL7C 2AHJB 4FL6A 4C0ZA 2K2MA 1G3YA 2QGGA 3A8GB 4FW2A 2LT4A 3ZEHA 1GFDA 2JMCA 4OVAA 3EG1A 3REAB 1OPKA 5CIUA 1PWTA 1B34B 2LDMA 3R6NA 3CMAT 2ZCFB 4XU0A 3TU4K 2NUZA 4J6YA 4UC4A 2YT6A 3KFVA 3FRNA 1N6AA 1QVFS 3M0PA 3G1JA 5LJ5d 5C6SA 3J80E 1ZBXA 5GAN5 1VYVA 1AEYA 1NYFA 3JCMc 2ZPBB 3HHTB 3PIPA 2RD1A 4II1A 4ZGDB 8AT1B 4PJLA 2J7IA 4IKFA 3X28B 2CP7A 3CQTA 5GAMd 2OAWA 3CC4T 4PL6A 3NHNA 2I0NA 3PE0A 1D0YA 1TWBA 4N4HA 4C5EA 4MDXA 2K3YA 2EPDA 3MP6A 3PFSA 4JRPA 1Q81U 4B9WA 1UG1A 4ANJA 4J9IA 1D0XA 3QWXX 4DEYA 5CKFA 2KBTA 3CPWS 1BCOA 3M5AA 4C0DC 2VKNA 2VYTA 3L1AA 5LJ5e 1RABB 3DKMA 2BE7D 3VUBA 3UA7A 2RQUA 5FROA 3CCVA 4RTWA 1O75A 2DXBA 1SRMA 1D1CA 2DD4A 3CPWP 1QMCA 3EFSA 4JRKA 2FZCB 5GAMe 1TUGB 3CC7Q 4A4KA 1YWOA 2DVEA 4C8QC 2A28A 2O31A 5GAN4 2ED0A 1EZZB 2GBQA 4FYXB 4WTOB 1M3BA 1VA7A 3RERA 3JCMJ 4C8QG 2OTJQ 4LUDA 1WXBA 3CCRQ 2CH4A 4QVCA 5GAOn 3G4SA 4GBQA 3RMSA 5CQXA 2DETA 3HSBA 4A4FA 2E6NA 2K5FA 1Y96A 1UEBA 1NBEB 1XQHA 5FWCA 2R5MA 2LJ1A 1AWJA 5LJ5h 5M9OA 2DJQA 5LJ5f 3JRZA 2JM8A 1ZBJA 2W10A 2QK0A 4C8QE 2CH4W 1W4SA 3CCUA 1YCSB 4JRIA 1QVGA 1FMKA 3TCJA 1ZUYA 3M4YA 2VXFA 3HRUA 2QTVA 1NE8A 2CYZB 4ELYC 1M1GA 3FC3A 1R0BG 1M8VA 2HKQB 1BI1A 2CUDA 1C1AA 2G6FX 2F2VA 4KGZB 2CDTA 4QVDA 3LWHA 2NYSA 3EH1A 3REBB 3GIBA 3OMGA 2E3HA 1VQKQ 1W70A 2OTJT 2EJGA 3M0QA 3CCQQ 3V7SA 1RAAB 2G3RA 4J9GA 5CAIA 3PTAA 1U1SA 3EH2A 2X35A 3JB9G 4N4IA 2M02A 3OQ5A 4A53A 2M0YA 2CREA 1TSFA 4F7UG 3MO8A 3G6EA 2V8IA 1TUDA 2BUDA 1X2QA 4E7IA 4N0AA 4HCKA 3CCLQ 4PJMA 4CC3A 1VQLA 1VQ7T 3ULRB 2CSIA 2HNIA 1M90C 4ATOA 1EIFA 5GANj 1M1KC 3FJ5A 1AWOA 2KYBA 1YJ9A 2LCCA 3LH0A 1RI9A 3FEOA 4XTUA 4M77F 5GAN6 2JM9A 1I8FA 4KRTA 1NJIU 4F7UE 2K9GA 1N5ZA 1CKAA 2MF2A 2FVUA 5J3BA 3S6WA 2X4WA 1QP3A 5IH2A 3QDFA 2C06A 2LCLA 5DM7R 2KNBB 1K8AU 2QDLA 1AWXA 4J9EA 2DKGA 3QJ6A 3GP8A 1U3OA 2EAYA 2YSQA 1G3SA 4EPCA 5KYWA 1JJ2S 3QYGB 4JLIA 5GAMj 4HT8A 1B3QA 3N5BB 1SG5A 3HRTA 4M4ZA 2A7YA 4BE0A 1VOMA 2VGNA 1WA7A 3E9GA 2L0AA 2FRYA 2ZPHB 4ELZC 1PHTA 3H8ZA 2AKKA 3V8JA 4J7FA 4A4HA 1VQMA 3CCLT 2RM4A 2BIVA 1VQ9Q 3CD6Q 4EMGA 1TTHB 4Z02A 4BDYA 4HVUA 1M90R 2LJ3A 1KQ1A 3QXEB 4A4GA 3T9NA 5KYUB 1K1ZA 3JSCA 4LE9A 1M1KR 4KUIA 1VQNA 2VVKA 1UGQB 1Q86U 5GJVB 4RUGA 1M2VB 3NGPA 2E64A 3SHWA 3EG9B 4PFZA 2NLUA 4CC7A 4VUBA 4XAXB 3CCJA 1MMGA 3TEEA 2JS2A 3SB2A 8ATCB 2PZ1A 2X3XD 3U23A 3HFOA 4LDUA 4EMKB 3VS0A 4J9FA 5A0GA 1W2BP 4LDWA 2B8AA 1Q7YC 2ROLA 4EIKA 5IAYA 1YITA 1U06A 2RHYA 4Y91A 4JRQA 5LJ3g 3EFOB 2HKNA 3QYHB 1WJSA 4AFUC 2RK1A 1UB4A 5IHIA 2YXYA 2MWPA 3CC2Q 4E7ZA 4KT0E 4LDYA 2EYZA 1E7OA 1T3SA 1RACB 3MHXA 2IIMA 1YJNA 1VQ9T 2RI5A 2CZ7B 1WHKA 2ZPEB 3VYHB 2Y90A 1MMNA 2YRVA 4XTWA 2PTKA 3BW1A 3ME9A 1UGRB 1QVPA 5GAN2 4AFQC 3EGUA 2DJZA 3V8KA 1M30A 2JNGA 2D1XA 1SSHA 1WQWA 2V1RA 1SPKA 2L3PA 2P4RA 4EMHA 2RMOA 3NTIA 5C0MA 4M77D 2HL5C 3H6ZA 5AT1B 1BK2A 2D0QB 2F5KA 2LC4A 3EGDA 3GLXA 1VQ8T 4RCCA 3OS0A 1VQPQ 5KYNA 1Q7YR 4CC2A 1VYUA 3OW2P 3C94A 4LDXA 3JCMd 4E7JA 4ZTFA 4PJOC 4JPBW 3L2ZA 3O5ZA 2RJFA 3MJXA 2RPNA 3CCMQ 3SWNA 4C5GA 4AFZC 3JCMW 4M7AA 3CC7A 2LP5A 4PJOG 3TSZA 1WPYA 5L23A 4L59A 3QIIA 1GRIA 2M0OA 1H641 4KH0B 3C12A 4AT1B 5HK3A 1KQSP 1O9SA 3CCVT 1PNJA 1ZLMA 1W1FA 1K9MU 2QQRA 5KH6A 3EG2A 5CKHA 4ME7A 4RTYA 3MP1A 2KXDA 1YJWQ 3JCMe 3MEAA 3CMEQ 4M78B 3NTHA 4JDSA 2FPDA 2DTOA 4WCIA 1K4US 3G4ST 3J7AF 1K0SA 1KIKA 4M7DA 2KGTA 1U1TA 4C92B 3OYGA 4BE2A 1VQOQ 1OU9A 4M78F 2E41A 5EC7A 4M7AF 1QQJA 3H0HA 1ZA2B 2DBKA 1ZSZB 4OMPA 4MMLA 3OYHA 1KG1A 2IG0A 3VRYA 1QCFA 3S3NA 2RH2A 3VS1A 4C92F 2X4YA 1K9MC 3C4SA 5FU7B 1XNIA 4E7LA 4NOYA 1MNEA 3E2UA 1FWZA 1RAFB 3MPUB 1PRLC 5IXFA 2F1LA 3PT9A 3D7SB 2CP2A 2DE0X 1E6HA 4E7KA 3EAEA 1X01A 3JCMf 3CCQA 4BB7A 1BU1A 1X6BA 3CMAQ 3RUXA 2GFAA 2MYSA 4J9DA 4Z89A 2M16A 1RI0A 1HD3A 4Z8AA 4M75B 1DJ7B 3OYIA 3VV0A 3VS4A 2PVGB 3A8HB 3CCSA 5GJWB 2HSEB 1D09B 2LNHB 3EGXB 4M7DF 2QA4A 2KROA 5FRMA 1UDLA 2FHDA 2K5LA 1K73U 2QI2A 4TVRA 4MDWA 1HJDA 1EX4A 4MZPA 1D3BB 1RL2A 2EYWA 2JTEA 2MAMA 4OP0A 1YN8A 3MCAB 1IO6A 1B34A 3I9QA 4QVZA 1Z9ZA 3CC4Q 4XU1A 4DBHA 4JUVA 3G6ET 3JV3A 1H8KA 4J8OA 2P0QA 3VRZA 2O9SA 2YDLA 2RN8A 1GXIE 3LGLA 2QQAA 1VQLT 2BZXA 1K9MR 1PSEA 4NL2A 2VASA 4IUUA 5HKCA 2EGEA 2ESWA 3G71Q 3URGA 2LQ8A 2D9TA 1VUBA 3RMQA 2EYQA 5D6XA 2EGAA 1YIJA 4P5NA 1Y7XA 1IRXA 1VQ5A 3UT1A 3ZFJA 2ZGWA 2LNVA 4DOVA 1PG5B 1WHHA 2COYA 2C0IA 2LJ0A 2X4XA 1LNXA 3UATA 2ABLA 4F16A 1JQQA 1WI7A 5A0DA 2EKHA 4AFSC 1AOJA 1YI2A 3HPWA 1AD5A 3HRSA 1S72Q 2LRQA 1BYMA 2DD5A 3LYIA 1N9RA 4M7AD 1QVFP 3BFMA 3A5ZB 2D8JA 2Y4XA 2O88A 3JB9J 1VQMT 4J9BA 4M77C 2YUOA 1N8RU 3X24B 4BY6B 4C92D 2C0TA 3RESA 2PVOB 3QG1A 5KYXB 3OYMA 3M59A 3G71T 1VQNT 2FPFA 1MMAA 1QCOA 3E19A 1WXTA 4PFPA 4IURA 1B7TA 2YUPA 4ZGEB 5GMKi 2QEXA 3CPFA 1VIEA 2PQWA 4ZN3A 1F1BB 2A37A 3CCJT 1TUCA 3OA6A 2RQRA 1MV3A 4N0AC 2FPEA 3NFCA 1UJYA 5FRNA 3LW5E 2CUBA 2ROTA 1NLOC 3BY7A 3I56A 3QSUA 4M7DD 3S3OA 1E6GA 1CKBA 2AZVA 2JZ2A 3BE3A 3M9QA 2QQ9A 1SHFA 1YITT 4XU2A 2YLBA 3LGFA 2WSEE 3TSWA 2CZ1B 4DQ2A 2XD0A 4M77E 1G5VA 4RTUA 1S72T 2E5QA 2GQVA 4LD6A 1N8RC 3SDZA 2DERA 2OTLA 2M51A 2NUTB 1Q81C 2RJDA 4C5IA 3RKXA 1UFFA 2VUBA 4E2FB 4HXJA 1KD1U 5GAOr 1YJNT 1Y0MA 4OMQA 1PD1A 3OYBA 1OPLA 2NUPB 3HKSA 1C0MA 3ASKA 1OEBA 4XU3A 5GMKe 1K9AA 3M0UA 3DLMA 3WVDB 3OBYA 3HFNA 1VQ7Q 2FZKB 1UGPB 3A8OB 5I21A 3VUZA 2CP0A 9ATCB 2K3XA 2FZGB 2HL3A 5GAN3 5LJ3d 4LN2A 3WVEB 2C0OA 3QPHA 2H3EB 3AHUA
chains in the Genus database with same CATH topology
1Q86U 3OYEA 4C0FA 2CS7A 2E64A 5GANd 3I55T 2DIQA 1VQ7A 3DB3A 3JCMg 2LTOA 1NZ9A 3CBPA 1VQ9A 3CD6A 4PJOF 3HP9A 2NLUA 2BKDN 3OYFA 5EG2A 4VUBA 4XAXB 3KUFA 4BY6C 3CCJA 4HT9A 3SWNB 3TEEA 5GAN7 3OMCA 3SB2A 2CZ6B 4C0GA 4PJOE 4M77A 1KD1C 4M7AB 2FYKA 3MEVA 5HK0A 2E65A 4M78D 4E47A 2I2LA 4X34A 3HFOA 3L2QA 1OZ2A 4LDUA 3OYJA 5IT9E 5CQYA 4EMKB 1LJOA 4KBMB 5A0GA 3LX7A 1M9SA 4MZTA 3J81E 1QVGS 4FU6A 2R5AA 3UPUA 4LDWA 1KQ2A 2B8AA 1Q7YC 2KQWA 2RHUA 4GLKA 4XTVA 5IAYA 2F69A 1YITA 5GMKh 3CPWA 1VQPT 3QKJA 2E6ZA 4BI8B 2GFUA 2DEQA 2RHYA 3QHSA 2EQJA 4Y91A 3M57A 3M58A 1ZHIA 3MP8A 4JRQA 4BE1A 4BD3A 2L5QA 5LJ3g 4R55A 3FB9A 3QYHB 3OYLA 1WJSA 2KDSA 2RK1A 1UB4A 1I5LA 3LWIA 2PUKB 1VQ4T 4D6WA 5LJ3e 3L2RA 2MWPA 1BI3A 1NPRA 1VIFA 4X9CA 4M77G 3CCMT 2P4TA 5GANg 1VQ8A 3QZ5B 3CCET 3WXMB 4DA4A 1HK9A 4Y28E 4KT0E 3L42A 4JLGA 4LDYA 4PKCC 5CCAA 5GANe 3S3MA 2YHTA 1Y71A 1PSFA 3MHXA 3VJPA 1YJNA 1VQ9T 2RI5A 4HCZA 3SFMA 4KUDK 2CZ7B 2ZPEB 4PNOA 3VYHB 2Y90A 5L8RE 1VQOA 2XHCA 2YRVA 4XTWA 3BW1A 3ME9A 3JCMQ 1UGRB 2DXCA 2MI6A 2PUOB 2VC8A 1QVPA 3FDRA 3F70A 2P0KA 2O4XA 2WSCE 4OF1A 3V7RA 5GAN2 3KXTA 3P8BB 1FXXA 2DJZA 2QQBA 2CGHA 2RJEA 2RI3A 3M53A 3V8KA 2DIGA 2EFIA 3JCMh 2X4JA 2JNGA 4OGCA 3V7CA 1WQWA 2OAUA 1IREB 4M7DB 3L2WA 1VQ6A 4EMHA 3CC2A 3QBYA 4V2SA 2EJ9A 2CKKA 3NTIA 2FL7A 1N9SA 5C0MA 3HL8A 2JTMA 3E9FA 2XK0A 4M77D 5CO7A 5GMKl 4RCBA 1YHQA 4CRIA 3QDRB 2MWOA 4M75D 1YJWT 3CMET 2V8KA 3Q1JA 2WACA 4O5VA 5GAMg 3BDUA 2XICA 3H6ZA 5LJ5j 4PJOA 2D0QB 2F5KA 2LC4A 2Y4YA 4QQGA 1WJRA 3OB9A 2PU9B 5AYFA 3GLXA 4PLIA 1VQ8T 4BDZA 4RCCA 1BKBA 3I55A 2M1HA 3OS0A 2HBPA 3JCMb 5LJ3h 4L5GA 4FT2A 4JS5A 1JRIA 3C94A 4LDXA 2EJFA 5LJ3f 3JCMd 1OI1A 4E7JA 3V8LA 3NTKA 3OBWA 4ZTFA 4PJOC 2JN0A 2E12A 4JJNK 1VQOT 5GANh 3L2ZA 4XTYA 3X25B 2RJFA 2R57A 1R8OB 2EWNA 5GANf 2HD0A 2DAQA 2WSFE 3L2VA 3SWNA 2XU8A 4C5GA 4OB3B 2GF7A 1AHJB 3JCMW 3CC7A 2DPPB 4PJOG 1NJIU 1VQ6T 1WPYA 4C8QB 4L59A 3JCMX 4R56A 3QIIA 1VQPA 2M0OA 3JCMV 1H641 4QQ6A 2DZCA 2D6FA 2QTXA 4MMKA 4DOWA 2E70A 3C12A 3LLRA 3PMTA 5HK3A 3GPLA 2RB6A 1I4K1 1O9SA 4LDVA 2VV5A 3SWNC 1WJQA 3R6OA 3L2UA 1YHQT 1NJIC 3CCVT 2AHJB 4FL6A 4C0ZA 1G3YA 3CCST 4M7AC 1VQ4A 3A8GB 3ZEHA 2LT4A 2RHZA 3BDLA 2KVQG 3GNGA 3SD4A 1QW1A 2RI2A 1WQ7A 3CCEA 3CCMA 4OVAA 4EMKC 2QA4T 4C8QF 5GAN8 1K9MU 3M4GA 2QQRA 5KH6A 3CBOA 4XK8E 5CKHA 4J6WA 4L6V5 5CIUA 2QQSA 2V8JA 4B9XA 4ME7A 1K8AC 4M7AG 3MP1A 1B34B 4C92C 1JBMA 2LDMA 5GAMh 1XTDA 3CMAT 1XOVA 4FIBA 3MEAA 5GAMf 3JCMe 1KC8U 3RKWA 3EFRA 4M78B 2ZCFB 3NTHA 4PJOD 5CKEA 4JDSA 4XU0A 3TU4K 4J6YA 4UC4A 2DTOA 2KK4A 1Y96B 2EIFA 3FRNA 3OY9A 3A8LB 2F5TX 2EQMA 1N6AA 3G4ST 1QVFS 3J7AF 5D6YA 3CC7T 1M90U 5LJ5d 3OYYA 5C6SA 3J80E 4M7DA 1U1TA 3E1SA 1ZBXA 4NS5A 5CK9A 4C92B 5GAN5 3OYGA 4BE2A 1X75C 2MMPA 1Q82U 3PGGA 3RIRA 4M78F 2ZPBB 3HHTB 3JCMc 3PIPA 2RD1A 4II1A 4ZGDB 2E41A 4OMFB 3CMEA 1YJWA 1M1KU 4M7AF 3UDCA 4MMLA 3OYHA 1KG1A 2IG0A 5GMKm 4IKFA 3X28B 4M7AE 4OB1B 3C95A 3A8MB 5I2MA 5GAMd 3CC4T 4PL6A 2KMTA 3S3NA 4M7DC 3QUIA 3CCRT 2RH2A 4X9DA 2M9UA 4MZMA 1BIBA 4C92F 2K57A 4A54A 1YCYA 1Q86C 1VQ5T 4RMOA 2X4YA 1K9MC 3C4SA 5FU7B 1XNIA 4E7LA 4NOYA 4HCBA 1SSFA 4N4HA 2EKOA 4C92E 1FWZA 4C5EA 4RG2A 2K3YA 4M7DG 3MP6A 3PFSA 4JRPA 4MDXA 1Q81U 3M56A 3KBGA 2E1HA 4B9WA 3OW2A 3PT9A 1KC8C 2DTIA 2RJCA 5J39A 2KY9A 2XDDA 5CKFA 4E7KA 3CPWS 3EAEA 3M5AA 1X01A 5LJ5g 3JCMf 4C0DC 4J6XA 2QDYB 1FX7A 2VYTA 5A2QE 3CCQA 4BB7A 4F7UB 3GF5A 3L1AA 5LJ5e 3PNWC 4M77B 3RUXA 2GFAA 3DKMA 3VUBA 2LVMA 2M16A 1RI0A 3AHUA 2XKOC 4M75B 1DJ7B 2IVWA 2JUFA 4C8QA 3OYIA 3VV0A 1OZ3A 1U8RA 5FROA 2PVGB 3A8HB 1O75A 1BI0A 3CCVA 2DXBA 3CCSA 3DLLA 1Q82C 2DD4A 3VU3C 3JB9F 1JJ2A 2DTHA 4M7DF 1M1FA 1IZ6A 2QA4A 5DY9A 3EFSA 4JRKA 5FRMA 4J83A 5GAMe 2FHDA 4C0DB 2K5LA 5A0LA 2QI2A 3CBMA 4TVRA 4F7UF 4MDWA 2RK2A 4A4KA 4JS4A 2DVEA 5KE3A 4M7DE 4MZPA 3VKIA 4C8QC 1D3BB 2JTFA 1RL2A 2MAMA 4OP0A 4Q5WA 4IUVA 5GAN4 2XIDA 3CMAA 3MCAB 2H3JA 4NL3A 2DZ9A 5HY6A 1JB0E 3RERA 4RKUE 3JCMJ 2XDBA 3DB4A 4XTXA 1G3WA 2ZPGB 1B34A 4QVZA 2ZZDA 4C8QG 2HAXA 3CXCA 3FLGA 4QW2A 4XU1A 4E7HA 3PMIA 4JUVA 3OSSC 4QVCA 3G6ET 1VQKT 5GAOn 4M78A 3PIOA 3G4SA 4J8OA 3RMSA 5CQXA 5GAOq 2P0QA 5GAOp 3HSBA 4A4FA 3OSVA 4PLLA 2E6NA 5CVIA 2K5FA 3CCQT 3JB9H 1GXIE 1Y96A 3LGLA 3M54A 1UEBA 1XQHA 2CZ0B 4FSXA 2QQAA 3P8HA 4GY5A 4EMKA 1VQLT 2RHIA 1QP2A 1PSEA 4NL2A 4O6JA 5IN1A 3RKYA 2K5IA 4IUUA 1W2BA 5HKCA 2R5MA 3MEUA 2L89A 2PVDB 5KCHA 4BUGA 4M78C 4C92A 5LJ5h 4ZTJA 3URGA 1MGQA 2LQ8A 5M9OA 3OS1A 3OYAA 2D9TA 3QO3A 3JRZA 1VUBA 5LJ5f 2RO0A 1Q7YU 3RMQA 5LL6S 3G7ZA 1K73U 3CC4A 2OTJA 3CCRA 2EYQA 1TH7A 4HKEA 5D6XA 3OYNA 4QQDA 1YIJA 5DLOA 4P5NA 3JB9I 1Y7XA 4M78G 1VQ5A 3UT1A 3P8DA 3ZFJA 4C8QD 2KAFA 2ZGWA 4C8QE 5DLQE 1W4SA 2LNVA 3CCUA 4JRIA 1QVGA 4IUPA 5GMKj 3TCJA 4DOVA 4CI0C 1YBYA 3FIFA 3X20B 2JOYA 3FJPA 4IUQA 3VYGA 3GOXA 3M4YA 3G71A 2X4XA 1LNXA 2LT1A 2VXFA 3HRUA 3META 4BI4A 1BI2A 4C92G 1NE8A 3ZBDA 2CYZB 4ELYC 1M1GA 2P0PA 2LX9A 1M5Q1 3FC3A 3GNFB 5A0DA 4EDUA 4HCCA 4M7AA 1W2BS 1M8VA 5CR2A 3OS2A 1BI1A 1YI2A 2DO3A 3HPWA 3HRSA 5FU7C 1V29B 2LRQA 3CEYA 1BYMA 4N4GA 4F7UA 2LQKA 4QVDA 3LWHA 2DD5A 1OYXA 3LYIA 3GIBA 3OMGA 4M78E 1N9RA 2EQKA 3MEWA 3OS5A 4M75A 3O8VA 4M7AD 4OB2B 2R58A 1H3ZA 2DK3A 2OTJT 5GAOl 3BFMA 3A5ZB 2EJGA 2DXUA 2Y4XA 3V7SA 3JB9J 1YIJT 2G3RA 1VQMT 5CAIA 2KSSA 3PTAA 1U1SA 1Y07A 4M77C 1N8RU 3CCUT 3X24B 4BY6B 2X35A 4C92D 4N4IA 3JB9G 4M75C 3RESA 1S72A 2PVOB 1D3BA 3OQ5A 3QG1A 4YTLA 1M4ZA 2ZPIB 4FM4B 3M59A 3QZ9B 4A53A 4ZGJB 5KE2A 3OYMA 1MHNA 2L8DA 1NPPA 3G71T 4F7UG 3MO8A 4HA8A 3G6EA 2EQUA 2RA2A 1VQKA 2V8IA 1VQNT 2BUDA 4ZN1A 4OGEA 3E19A 4E7IA 2O01E 4M75G 4N0AA 1G3TA 4IURA 1KHIA 4ZGEB 5GMKi 1VQ7T 1VQLA 2ZPFB 2QEXA 2HNIA 3CPFA 1VIEA 2PQWA 4C5HA 4ZN3A 5LJ3j 1YI2T 3CD6T 1M90C 2VXEA 4ATOA 3CCJT 5FLXE 2XG8D 3OA6A 1EIFA 4N0AC 5GANj 1M1KC 2HQEA 3NFCA 1KQSA 5FRNA 3LW5E 4RG8A 3QJYA 2JVVA 1YJ9A 2LCCA 1HXDA 3LH0A 3JB9D 2DXTA 3BY7A 3ER0A 3I56A 3QSUA 4M7DD 3S3OA 3FEOA 3CCLA 4XTUA 4M77F 5GAN6 2JZ2A 3M9QA 2HQXA 2QQ9A 1I8FA 1WNLA 1YITT 2XDPA 1ZQ1A 2YLBA 3LGFA 2WSEE 4J5YA 4M75F 1I81A 4XU2A 4F7UE 2CZ1B 4DQ2A 4XQ3A 3OW2S 2XD0A 4M77E 1G5VA 1S72T 2MF2A 2FVUA 4FT4A 1X6OA 2A3LA 2E5QA 2GQVA 4M75E 4LD6A 4WF2A 5J3BA 1N8RC 3SDZA 3S6WA 3UWNA 5KCOA 2X4WA 2OTLA 1QP3A 2C06A 1Q81C 2LCLA 5I2SA 5FU6C 2RJDA 4C5IA 5DM7R 3X26B 3RKXA 1K8AU 2DKGA 3QJ6A 2VUBA 3GP8A 1N27A 3INZA 2YLCA 2QXFA 2EAYA 2K2VA 1P92A 1G3SA 4EPCA 2L3RA 2O4XB 1UGSB 1KD1U 2QEXT 3M55A 5GAOr 3QYGB 1YJNT 1JJ2S 4JLIA 1KQSS 5GAMj 1KHCA 4HT8A 3N5BB 3OYBA 3HKSA 3HRTA 3ASKA 2K4YA 2A7YA 4BACA 5J26A 4BE0A 2XI9A 2VGNA 4XU3A 5GMKe 3E9GA 5FU6B 3OYCA 2ZPHB 4ELZC 4LD9K 3H8ZA 2E10A 3DLMA 3WVDB 2RHXA 3OBYA 1YJ9T 4J7IA 3HFNA 1BIAA 4XTZA 4J7FA 4KULA 3V8JA 4A4HA 5CKDA 3I56T 1VQMA 3CC2T 3CCLT 3JAME 3JCMP 2RM4A 1LOJA 2BIVA 4IUTA 3TREA 5CKBA 4EMGA 1UGPB 3A8OB 5GAOm 1K73C 2FB7A 2GCXA 4Z02A 5I21A 4BDYA 1QVFA 3OYKA 3VUZA 3CXCS 4PJOB 4A4EA 4BI3A 1KQ1A 3QXEB 1WGSA 2K3XA 5GAN3 5LJ3d 4A4GA 3T9NA 3JSCA 3WVEB 2OTLT 1VQNA 2VGMA 4KUIA 4OB0B 3QPHA 3OYDA 5D6WA 1UGQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q A;  2EWN A;  5CAI A;  5GAN f;  1U1S A;  4M77 C;  2E64 A;  3SWN A;  5GAN d;  3VU3 C;  4C92 D;  3JCM g;  3JB9 G;  3JB9 F;  4M75 C;  2DTH A;  3RES A;  4M7D F;  1D3B A;  3JCM W;  4M7A A;  4PJO G;  4PJO F;  4A53 A;  5DY9 A;  1WPY A;  3EFS A;  4JRK A;  4C8Q B;  3JCM X;  3JCM V;  1H64 1;  5GAM e;  2DZC A;  3SWN B;  2QTX A;  4MMK A;  5GAN 7;  4F7U F;  4F7U G;  4HT9 A;  4M7D E;  4HA8 A;  2DVE A;  2RA2 A;  3SB2 A;  4PJO E;  4C8Q C;  4M77 A;  2RB6 A;  1I4K 1;  1D3B B;  4M7A B;  2FYK A;  2E65 A;  4M78 D;  2I2L A;  4OP0 A;  3HFO A;  4M75 G;  4N0A A;  3SWN C;  5GAN 4;  4EMK B;  1LJO A;  4NL3 A;  5GMK i;  4M7A C;  2DZ9 A;  3RER A;  3JCM J;  2HNI A;  4XTX A;  5LJ3 j;  1KQ2 A;  1WQ7 A;  1B34 A;  4EMK C;  4XTV A;  4C8Q G;  4C8Q F;  5GMK h;  2VXE A;  5GAN 8;  3M4G A;  3QHS A;  2DEQ A;  4XU1 A;  4Y91 A;  4JUV A;  4QVC A;  4J6W A;  4M78 A;  5GAO n;  4N0A C;  5GAN j;  5GAO q;  4M7A G;  5LJ3 g;  1B34 B;  4C92 C;  1JBM A;  3FB9 A;  5GAM h;  5GAO p;  3HSB A;  1I5L A;  3JB9 H;  1HXD A;  1Y96 A;  4EMK A;  2DXT A;  3BY7 A;  5GAM f;  3JCM e;  3RKW A;  3JB9 D;  3EFR A;  3QSU A;  5LJ3 e;  4M7D D;  4M78 B;  4PJO D;  4NL2 A;  4XTU A;  4X9C A;  4M77 G;  4M77 F;  3RKY A;  5GAN 6;  5GAN g;  4XU0 A;  1I8F A;  1WNL A;  1HK9 A;  4M75 F;  4J6Y A;  2YLB A;  2DTO A;  4J5Y A;  4XU2 A;  4F7U E;  1I81 A;  1Y96 B;  4M78 C;  4C92 A;  4DQ2 A;  4XQ3 A;  5LJ5 h;  5GAN e;  1MGQ A;  4M77 E;  2YHT A;  3QO3 A;  5LJ5 f;  4WF2 A;  4M75 E;  4PNO A;  5LJ5 d;  2Y90 A;  4M7D A;  1U1T A;  1TH7 A;  5GAN 5;  4C92 B;  4XTW A;  3BW1 A;  3JCM Q;  3PGG A;  2VC8 A;  3V7R A;  3RIR A;  3JB9 I;  4M78 G;  4M78 F;  3RKX A;  3JCM c;  5GAN 2;  2RD1 A;  2ZGW A;  4C8Q D;  2E41 A;  4C8Q E;  2DKG A;  2DJZ A;  3V8K A;  2CGH A;  4JRI A;  4M7A F;  3JCM h;  3INZ A;  5GMK j;  4M7D B;  3V7C A;  1WQW A;  4MML A;  3FIF A;  2YLC A;  4EMH A;  2EAY A;  5GMK m;  3FJP A;  4V2S A;  4M7A E;  2EJ9 A;  5GAM d;  5GAO r;  4M7D C;  1N9S A;  4JLI A;  3QUI A;  5GAM j;  4X9D A;  4HT8 A;  1LNX A;  2VXF A;  1BIB A;  4C92 F;  4C92 G;  2K57 A;  4M77 D;  5GMK l;  4RCB A;  4A54 A;  1YCY A;  1M5Q 1;  4XU3 A;  5GMK e;  4M75 D;  4NOY A;  1M8V A;  5GAM g;  4C92 E;  2E10 A;  3BDU A;  4M7D G;  5LJ5 j;  4PJO A;  3HFN A;  1BIA A;  4XTZ A;  3V8J A;  2E1H A;  3JCM P;  2RM4 A;  1LOJ A;  4RCC A;  4EMG A;  2DTI A;  5GAO m;  4F7U A;  2FB7 A;  4QVD A;  5I21 A;  3JCM b;  4PJO B;  5LJ3 h;  5LJ5 g;  1X01 A;  3GIB A;  4M78 E;  1N9R A;  3JCM f;  1JRI A;  4J6X A;  4M75 A;  1KQ1 A;  4M7A D;  2EJF A;  5LJ3 f;  3JCM d;  3V8L A;  4F7U B;  5GAO l;  3BFM A;  5GAN 3;  2EJG A;  3L1A A;  2JN0 A;  5LJ3 d;  5LJ5 e;  4PJO C;  4M77 B;  2DXU A;  3RUX A;  3V7S A;  5GAN h;  3L2Z A;  3JB9 J;  4XTY A;  3AHU A;  4M75 B; 
#chains in the Genus database with same CATH topology
 2CS7 A;  3EHQ A;  4IIM A;  3CBP A;  1R77 A;  1S1N A;  5EG2 A;  3OMC A;  4C0G A;  4JZ4 A;  4M77 A;  1KD1 C;  1N8R R;  2X51 A;  3MEV A;  4E47 A;  3L2Q A;  4K11 A;  1MND A;  1OZ2 A;  1LJO A;  1Q81 R;  1D1A A;  4KBM B;  3LX7 A;  3J81 E;  1QVG S;  1TU0 B;  2R5A A;  2J6O A;  2RHU A;  5GMK h;  3QKJ A;  4BI8 B;  3QHS A;  3M57 A;  2QGF B;  3MP8 A;  3EG0 A;  3OYL A;  1I5L A;  1H3H A;  3LWI A;  2PUK B;  1GCQ A;  2ECZ A;  1IXD A;  5LJ3 e;  2KXC A;  1X43 A;  5GAN g;  1VQ6 Q;  4KGX B;  1FMV A;  1HK9 A;  2COW A;  2ED1 A;  4Y28 E;  4JLG A;  2DF6 A;  3S3M A;  1I07 A;  2MPX C;  1PSF A;  1NG2 A;  1AWW A;  1C6V X;  4KUD K;  1JEG A;  4E7S A;  1VQO A;  2XHC A;  2MI6 A;  2VC8 A;  3FDR A;  1RAH B;  3F70 A;  2P0K A;  4OF1 A;  1WZO A;  3M53 A;  1YFN A;  4JJD A;  1AVZ C;  2RJE A;  1KJW A;  3QBY A;  2EJ9 A;  2AZS A;  2RNA A;  3HL8 A;  1KFZ A;  2JTM A;  2XK0 A;  4RCB A;  4CRI A;  3QDR B;  1T3L A;  2MWO A;  2JMA A;  3LH5 A;  2WAC A;  5GAM g;  1KD1 R;  5LJ5 j;  5AYF A;  3SEM A;  3I55 A;  3PVQ A;  5KYU A;  2HBP A;  3JCM b;  2RF0 A;  5LJ3 h;  1GL5 A;  4FT2 A;  4JS5 A;  1JRI A;  5LJ3 f;  1OI1 A;  2NWM A;  1M2V A;  1QWF A;  3NTK A;  4PJN A;  2JN0 A;  2E12 A;  3EG9 A;  1WDX A;  2P84 A;  3X25 B;  1R8O B;  2EWN A;  4PFO A;  1IGQ A;  3RR6 A;  1VQ6 T;  1UEC A;  4C8Q B;  3JCM X;  4R56 A;  2AT1 B;  1R0C B;  4MMK A;  1JJ2 P;  3PMT A;  2RB6 A;  3SWN C;  1YHQ T;  1ZUK A;  3VS5 A;  1NJI C;  3CCS T;  4M7A C;  1VQ4 A;  3BDL A;  2KVQ G;  4QKU A;  1KQ2 A;  2QA4 T;  1WQ7 A;  3CCE A;  3EFO A;  4C8Q F;  2AK5 A;  3M4G A;  2V1Q A;  3CBO A;  4XK8 E;  4R0K A;  4J6W A;  2QQS A;  2V8J A;  4B9X A;  1K8A C;  4M7A G;  2KT8 A;  1JBM A;  4C92 C;  1XTD A;  2JT4 A;  1XOV A;  4FIB A;  5CKE A;  2FG0 A;  2EYX A;  1VQ8 Q;  2EIF A;  2A0F B;  3OY9 A;  3A8L B;  2EQM A;  5D6Y A;  3E1S A;  4NS5 A;  4HVW A;  2MMP A;  1M3C A;  3RIR A;  4AG1 C;  3RBB B;  4OMF B;  3UDC A;  1WHM A;  2CP5 A;  4J9C A;  1BB9 A;  4M7A E;  2L2P A;  3C95 A;  3A8M B;  4M7D C;  2BTT A;  1LVK A;  1SKU B;  4F04 B;  1BIB A;  1OOT A;  2E5K A;  1M8M A;  4A54 A;  1Q86 C;  1VQ5 T;  4RMO A;  1PKT A;  1SSF A;  4C92 E;  4M7D G;  4RG2 A;  3CCV Q;  1UUE A;  2E1H A;  1NJI R;  3OW2 A;  1ZX6 A;  2DTI A;  5J39 A;  2KY9 A;  4RTX A;  2XDD A;  1H92 A;  4J6X A;  2QDY B;  2XMF A;  1FX7 A;  1SRL A;  4F7U B;  3GF5 A;  2RQW A;  2VB6 A;  3PNW C;  1K8A R;  2LVM A;  1Q95 G;  2IVW A;  2JUF A;  1OZ3 A;  2OX7 A;  1TS9 A;  1U8R A;  1BI0 A;  3VU3 C;  3JB9 F;  5DY9 A;  2QG9 B;  4CC4 B;  2OI3 A;  4J83 A;  3G4S Q;  3M0T A;  3EG3 A;  2KE9 A;  2JJ9 A;  3CBM A;  4AMC A;  4F7U F;  4M7D E;  2RK2 A;  1IGU A;  3NMZ C;  1NLP C;  2JTF A;  2JW4 A;  1QKW A;  2XID A;  4LUE A;  2H3J A;  4NL3 A;  2DZ9 A;  2XDB A;  1WYX A;  2EYY A;  4XTX A;  2BZY A;  1G3W A;  2HAX A;  3CXC A;  4QW2 A;  5FW9 A;  3OSS C;  1G83 A;  4M78 A;  1RUW A;  5GAO q;  5GAO p;  1WHJ A;  2DL7 A;  3OSV A;  4PLL A;  3JB9 H;  3M54 A;  4FSX A;  3CCU Q;  2CZ0 B;  3P8H A;  1Q86 R;  2RHI A;  5IN1 A;  3RKY A;  4OMM A;  2K5I A;  1QKX A;  3MEU A;  5KCH A;  4BUG A;  2H8H A;  4B6M A;  4C92 A;  4ZTJ A;  3OS1 A;  2RO0 A;  2OTJ A;  3CCR A;  1ZSZ A;  3OYN A;  4QQD A;  1UHF A;  3JB9 I;  4C8Q D;  2DRM A;  1T0J A;  4CI0 C;  3X20 B;  2JOY A;  3FJP A;  4IUQ A;  3VYG A;  3I5R A;  3H9N A;  1WX6 A;  3MET A;  1BI2 A;  3ZBD A;  2JXB A;  2F2X A;  2LX9 A;  1YP5 A;  2DL5 A;  5CR2 A;  1TOV A;  2B86 A;  2DO3 A;  1V29 B;  2O9V A;  3CEY A;  4N4G A;  2LQK A;  5D7U A;  1OYX A;  3OS5 A;  4RTZ A;  3G6E Q;  2GGR A;  4M75 A;  1A0N B;  2R58 A;  2DK3 A;  2HEQ A;  3EGX A;  4Y92 A;  2HCK A;  2DXU A;  1VQL Q;  2A08 A;  2YUQ A;  3CCU T;  1OX8 A;  1RLP C;  1D3B A;  2J06 A;  4YTL A;  1M27 C;  1M4Z A;  2ZPI B;  1WHL A;  1Z9Q A;  4FM4 B;  4ZNX A;  4D8D A;  4HA8 A;  5KYY B;  2RA2 A;  1VQK A;  4PK4 A;  2O01 E;  4F14 A;  1G3T A;  1I5O B;  1KHI A;  2MOX A;  3I35 A;  4C5H A;  1W6X A;  1JU5 C;  1ZSG A;  3RNJ A;  1V1C A;  1WIE A;  2GTJ A;  4RG8 A;  2KI7 A;  4E6R A;  1YNZ A;  1HXD A;  2E4H A;  3JB9 D;  3CCL A;  2PNI A;  2HMA A;  2HQX A;  1WNL A;  2LZ6 B;  4M75 F;  2XDP A;  2E3I A;  4J5Y A;  1I81 A;  3RDV A;  4XQ3 A;  4FT4 A;  1PD0 A;  4WF2 A;  2A3L A;  1X2K A;  1AZE A;  2X3W D;  3NPF A;  2YWW A;  3UWN A;  2K6D A;  3X26 B;  2BZ8 A;  2DVJ A;  1VQM Q;  1N27 A;  2QXF A;  2K2V A;  2KYM A;  1IHV A;  2L3R A;  2O4X B;  3M55 A;  2GTO A;  2EGC A;  4JJB A;  2DYB A;  3VS7 A;  2K4Y A;  1QLY A;  1X27 A;  4GLM A;  4BAC A;  5J26 A;  1VQN Q;  5FU6 B;  4LD9 K;  2E10 A;  1YJ9 T;  4J7I A;  4XTZ A;  5CKD A;  1LOJ A;  4IUT A;  5GAO m;  1K73 C;  2FB7 A;  1QVF A;  3OYK A;  3CCJ Q;  2HZY A;  4PJO B;  1IHW A;  4A4E A;  4BI3 A;  1WGS A;  1I0C A;  2MIO A;  2LQN A;  1PM3 A;  5KYX A;  4ORZ A;  3OYE A;  4C0F A;  1RLQ C;  3I55 T;  5GAN d;  4F17 A;  1YIT Q;  2DIQ A;  3JCM g;  2LTO A;  1NZ9 A;  1KK7 A;  2K3B A;  1VQ9 A;  4PJO F;  3CD6 A;  7AT1 B;  2BKD N;  3OYF A;  1SHG A;  2CZ6 B;  2K7A A;  1UTI A;  5HK0 A;  2E65 A;  4M78 D;  5CQY A;  1LPL A;  4MZT A;  1M9S A;  2KRS A;  3A98 A;  4XTV A;  3CPW A;  2E6Z A;  5IHN A;  1YJN Q;  2DEQ A;  3M58 A;  1OQK A;  1ZHI A;  1AZG B;  4R55 A;  3FB9 A;  2DL4 A;  4FYY B;  1ABO A;  1VQ4 T;  3L2R A;  1BI3 A;  1VIF A;  2KEA A;  4RTV A;  4M77 G;  1VQ8 A;  2D0N A;  3QZ5 B;  3CCE T;  3WXM B;  2DBM A;  4D8K A;  5CCA A;  2DL8 A;  2NUT A;  5GAN e;  2YHT A;  1Y71 A;  1G8X A;  1K73 R;  1ACM B;  4HCZ A;  3SFM A;  1LCK A;  1YWP A;  1GCQ C;  3EHR A;  3JCM Q;  1PKS A;  2DXC A;  3V7R A;  3C0C A;  2WSC E;  1IB8 A;  3P8B B;  1FXX A;  2QQB A;  2CGH A;  2RI3 A;  2D8H A;  3PVL A;  2EFI A;  2OAU A;  1IRE B;  2NUP A;  4DEX A;  1WFW A;  3CC2 A;  4V2S A;  2FL7 A;  1SF9 A;  4M75 D;  2V8K A;  4OMO A;  4O5V A;  1WJR A;  4BDZ A;  1BKB A;  2M1H A;  1X6G A;  4L5G A;  2F2W A;  2EJF A;  3OBW A;  1ZUU A;  5HCK A;  2K79 A;  5GAN h;  4XTY A;  5GAN f;  2HD0 A;  3L2V A;  2Z0W A;  2XU8 A;  2CP6 A;  4FYW B;  2DPP B;  2YRD A;  2QAZ A;  1BBZ A;  1VQP A;  4QQ6 A;  2DZC A;  1JXO A;  2QTX A;  2DX1 A;  2MCN A;  2D6F A;  2DA9 A;  3GPL A;  1FYN A;  1I4K 1;  3L2U A;  2EVR A;  2RQT A;  2RHZ A;  3CCM A;  3GNG A;  3SD4 A;  1QW1 A;  2RI2 A;  4EMK C;  2J05 A;  5GAN 8;  5FWB A;  2VWF A;  3TQ7 P;  4L6V 5;  5GAM h;  2O2O A;  1KC8 U;  5GAM f;  3RKW A;  3EFR A;  1GCP A;  4PJO D;  4JJC A;  1QWE A;  2KK4 A;  1Y96 B;  2F5T X;  2QYZ A;  3CC7 T;  1M90 U;  4IIO A;  4DBF A;  3OYY A;  2SEM A;  5CK9 A;  1PC0 A;  1X75 C;  1OV3 A;  1Q82 U;  3PGG A;  2CSQ A;  1M1K U;  1GBR A;  1YJW A;  3CME A;  2ZAE A;  5GMK m;  4OB1 B;  5I2M A;  1XJW B;  1QVG P;  1ZA1 B;  2KMT A;  3QUI A;  3CCR T;  4X9D A;  2M9U A;  4MZM A;  2K57 A;  1YCY A;  4HVV A;  3THK A;  4KGV B;  4HCB A;  2KR3 A;  1YHQ Q;  2EKO A;  5I11 A;  3CCS Q;  3M56 A;  2V26 A;  3KBG A;  1WXU A;  2QA4 Q;  1KC8 C;  2SRC A;  2RJC A;  1RAI B;  1D0Z A;  2DFU A;  5LJ5 g;  5A2Q E;  4M77 B;  2GQI A;  1B07 A;  2CP3 A;  2XKO C;  4C8Q A;  2HSP A;  3DLL A;  1Q82 C;  1OX9 A;  1JJ2 A;  2DTH A;  1M1F A;  1IZ6 A;  2DM1 A;  3TVT A;  4C0D B;  4LNP A;  5A0L A;  4JS4 A;  1JXM A;  5KE3 A;  3VKI A;  2KRN A;  1NM7 A;  4A63 B;  4Q5W A;  4IUV A;  3CMA A;  1AT1 B;  5HY6 A;  1JB0 E;  2MK5 A;  4RKU E;  2HBW A;  3DB4 A;  1PCX A;  2ZPG B;  2ZZD A;  2DL3 A;  4RTT A;  3FLG A;  4E7H A;  4LXC A;  3PMI A;  1M2O A;  1VQK T;  3M0R A;  3PIO A;  1YIJ Q;  1VQ5 Q;  5CVI A;  3CCQ T;  4EMK A;  4GY5 A;  2DMO A;  2CT3 A;  1K76 A;  1QP2 A;  4O6J A;  4FYV B;  1W2B A;  1UGV A;  2L89 A;  1WLP B;  2PVD B;  4M78 C;  1T0H A;  1MGQ A;  3OYA A;  3QO3 A;  1KC8 R;  3CC4 A;  1Q7Y U;  5LL6 S;  3G7Z A;  4X1V A;  1TH7 A;  2DRK A;  4HKE A;  1QCN A;  5DLO A;  1YI2 Q;  2ENM A;  4M78 G;  3P8D A;  2KAF A;  1MMD A;  5DLQ E;  4IUP A;  5GMK j;  1YBY A;  3UF4 A;  3FIF A;  2OJ2 A;  3MKD A;  3VS2 A;  1HYO A;  2JS0 A;  3GOX A;  1ZSZ C;  3G71 A;  1Q82 R;  2LT1 A;  2LCS A;  4BI4 A;  4C92 G;  2P0P A;  5KYW B;  1M5Q 1;  2LMJ A;  3GNF B;  4EDU A;  4QT7 A;  4HCC A;  1W2B S;  3OS2 A;  3H41 A;  5FU7 C;  4DBQ A;  4F7U A;  5I22 A;  1G2B A;  4M78 E;  2EW3 A;  2EQK A;  3MEW A;  3O8V A;  4OB2 B;  1H3Z A;  5GAO l;  4J9H A;  1GFC A;  1PRM C;  1NEB A;  2KRM A;  1YIJ T;  2BE9 B;  2KSS A;  1UE9 A;  2QEX Q;  1Y07 A;  3H0I A;  1S72 A;  4M75 C;  1X69 A;  5IXB A;  5KE2 A;  3QZ9 B;  4ZGJ B;  1MHN A;  1UHC A;  2L8D A;  1NPP A;  1WHG A;  2EQU A;  3I56 Q;  4ZN1 A;  4FW1 A;  4OGE A;  2X9H A;  4M75 G;  1U5S A;  4Z88 A;  2ZPF B;  2AIR B;  1YI2 T;  3CD6 T;  5LJ3 j;  3QWY A;  2VXE A;  1I1J A;  5FLX E;  2XG8 D;  1ARK A;  2OTL Q;  1HSQ A;  2HQE A;  1KQS A;  2DYI A;  1D1B A;  3QJY A;  1KSW A;  2JVV A;  1Y57 A;  1OU8 A;  4ESR A;  2DXT A;  3ER0 A;  2RQV A;  2A36 A;  1NYG A;  1ZQ1 A;  3OW2 S;  3H0F A;  1VYT A;  4PJJ A;  1RAG B;  1UJ0 A;  1X6O A;  4M75 E;  2IPO B;  4JZ3 A;  2HDA A;  5KCO A;  2J6K A;  5I2S A;  5FU6 C;  3INZ A;  2QAS A;  2YLC A;  3VS6 A;  1P92 A;  1UGS B;  2QEX T;  1KQS S;  1KHC A;  2L3Q A;  1FMW A;  2XI9 A;  3OYC A;  1CSK A;  1OUL A;  2RHX A;  1BIA A;  3I56 T;  4KUL A;  2COZ A;  3CC2 T;  4DBR A;  3JAM E;  3JCM P;  3A1P A;  3IQL A;  5CKB A;  3TRE A;  2GCX A;  3CXC S;  2DLP A;  3EGD B;  3AT1 B;  3UA6 A;  2LX7 A;  2OTL T;  2VGM A;  4OB0 B;  3OYD A;  5D6W A;  1GBQ A;  1MUZ A;  2KT1 A;  2FO0 A;  2LQW A;  1VQ7 A;  3DB3 A;  5KYY A;  6AT1 B;  3CXC P;  2J6F A;  3HP9 A;  1M3A A;  3M0S A;  4BY6 C;  3KUF A;  3VS3 A;  1JO8 A;  4HT9 A;  3SWN B;  5GAN 7;  4PJO E;  4M7A B;  2FYK A;  1J3T A;  2I2L A;  2L3S A;  4X34 A;  4KH1 B;  3OYJ A;  5IT9 E;  1EFN A;  4FU6 A;  3UPU A;  1RAE B;  2KQW A;  4GLK A;  2F69 A;  1VQP T;  2AKL A;  2GFU A;  2EQJ A;  4AG2 C;  4BE1 A;  4BD3 A;  2L5Q A;  2KDS A;  4OMN A;  4OML A;  3I5S A;  4D6W A;  1YJ9 Q;  1NPR A;  1TXQ A;  4X9C A;  3CCM T;  2P4T A;  2ATC B;  4DA4 A;  3L42 A;  4PKC C;  3VJP A;  5ECA A;  1ABQ A;  4PNO A;  5L8R E;  1RAD B;  2GNC A;  3GBQ A;  2PUO B;  2O4X A;  3KXT A;  3HTR A;  2YUN A;  2DIG A;  3JCM h;  4M7D B;  2X4J A;  4OGC A;  3V7C A;  3I55 Q;  3L2W A;  1VQ6 A;  2CKK A;  2DNU A;  1N9S A;  1K0X A;  2FRW A;  2FEI A;  1V76 A;  4FSS A;  3E9F A;  5CO7 A;  5GMK l;  1YHQ A;  1SEM A;  1YJW T;  3CME T;  3Q1J A;  2EBP A;  3BDU A;  1BCM A;  2XIC A;  4PJO A;  4QQG A;  2Y4Y A;  1TG0 A;  3OB9 A;  2PU9 B;  4PLI A;  2YRC A;  5IHK A;  3V8L A;  4FCY A;  4JJN K;  1VQO T;  1NEG A;  2EQI A;  2HQH A;  1VQ4 Q;  2R57 A;  2DAQ A;  2DEU A;  2WSF E;  3CCE Q;  4OB3 B;  2GF7 A;  1AHJ B;  2W0Z A;  2DIL A;  3JCM V;  1MV0 B;  4DOW A;  2E70 A;  3LLR A;  2CT4 A;  4LDV A;  2VV5 A;  1WJQ A;  3R6O A;  3ZL7 C;  2AHJ B;  4FL6 A;  4C0Z A;  2K2M A;  1G3Y A;  2QGG A;  3A8G B;  4FW2 A;  2LT4 A;  3ZEH A;  1GFD A;  2JMC A;  4OVA A;  3EG1 A;  3REA B;  1OPK A;  5CIU A;  1PWT A;  1B34 B;  2LDM A;  3R6N A;  3CMA T;  2ZCF B;  4XU0 A;  3TU4 K;  2NUZ A;  4J6Y A;  4UC4 A;  2YT6 A;  3KFV A;  3FRN A;  1N6A A;  1QVF S;  3M0P A;  3G1J A;  5LJ5 d;  5C6S A;  3J80 E;  1ZBX A;  5GAN 5;  1VYV A;  1AEY A;  1NYF A;  3JCM c;  2ZPB B;  3HHT B;  3PIP A;  2RD1 A;  4II1 A;  4ZGD B;  8AT1 B;  4PJL A;  2J7I A;  4IKF A;  3X28 B;  2CP7 A;  3CQT A;  5GAM d;  2OAW A;  3CC4 T;  4PL6 A;  3NHN A;  2I0N A;  3PE0 A;  1D0Y A;  1TWB A;  4N4H A;  4C5E A;  4MDX A;  2K3Y A;  2EPD A;  3MP6 A;  3PFS A;  4JRP A;  1Q81 U;  4B9W A;  1UG1 A;  4ANJ A;  4J9I A;  1D0X A;  3QWX X;  4DEY A;  5CKF A;  2KBT A;  3CPW S;  1BCO A;  3M5A A;  4C0D C;  2VKN A;  2VYT A;  3L1A A;  5LJ5 e;  1RAB B;  3DKM A;  2BE7 D;  3VUB A;  3UA7 A;  2RQU A;  5FRO A;  3CCV A;  4RTW A;  1O75 A;  2DXB A;  1SRM A;  1D1C A;  2DD4 A;  3CPW P;  1QMC A;  3EFS A;  4JRK A;  2FZC B;  5GAM e;  1TUG B;  3CC7 Q;  4A4K A;  1YWO A;  2DVE A;  4C8Q C;  2A28 A;  2O31 A;  5GAN 4;  2ED0 A;  1EZZ B;  2GBQ A;  4FYX B;  4WTO B;  1M3B A;  1VA7 A;  3RER A;  3JCM J;  4C8Q G;  2OTJ Q;  4LUD A;  1WXB A;  3CCR Q;  2CH4 A;  4QVC A;  5GAO n;  3G4S A;  4GBQ A;  3RMS A;  5CQX A;  2DET A;  3HSB A;  4A4F A;  2E6N A;  2K5F A;  1Y96 A;  1UEB A;  1NBE B;  1XQH A;  5FWC A;  2R5M A;  2LJ1 A;  1AWJ A;  5LJ5 h;  5M9O A;  2DJQ A;  5LJ5 f;  3JRZ A;  2JM8 A;  1ZBJ A;  2W10 A;  2QK0 A;  4C8Q E;  2CH4 W;  1W4S A;  3CCU A;  1YCS B;  4JRI A;  1QVG A;  1FMK A;  3TCJ A;  1ZUY A;  3M4Y A;  2VXF A;  3HRU A;  2QTV A;  1NE8 A;  2CYZ B;  4ELY C;  1M1G A;  3FC3 A;  1R0B G;  1M8V A;  2HKQ B;  1BI1 A;  2CUD A;  1C1A A;  2G6F X;  2F2V A;  4KGZ B;  2CDT A;  4QVD A;  3LWH A;  2NYS A;  3EH1 A;  3REB B;  3GIB A;  3OMG A;  2E3H A;  1VQK Q;  1W70 A;  2OTJ T;  2EJG A;  3M0Q A;  3CCQ Q;  3V7S A;  1RAA B;  2G3R A;  4J9G A;  5CAI A;  3PTA A;  1U1S A;  3EH2 A;  2X35 A;  3JB9 G;  4N4I A;  2M02 A;  3OQ5 A;  4A53 A;  2M0Y A;  2CRE A;  1TSF A;  4F7U G;  3MO8 A;  3G6E A;  2V8I A;  1TUD A;  2BUD A;  1X2Q A;  4E7I A;  4N0A A;  4HCK A;  3CCL Q;  4PJM A;  4CC3 A;  1VQL A;  1VQ7 T;  3ULR B;  2CSI A;  2HNI A;  1M90 C;  4ATO A;  1EIF A;  5GAN j;  1M1K C;  3FJ5 A;  1AWO A;  2KYB A;  1YJ9 A;  2LCC A;  3LH0 A;  1RI9 A;  3FEO A;  4XTU A;  4M77 F;  5GAN 6;  2JM9 A;  1I8F A;  4KRT A;  1NJI U;  4F7U E;  2K9G A;  1N5Z A;  1CKA A;  2MF2 A;  2FVU A;  5J3B A;  3S6W A;  2X4W A;  1QP3 A;  5IH2 A;  3QDF A;  2C06 A;  2LCL A;  5DM7 R;  2KNB B;  1K8A U;  2QDL A;  1AWX A;  4J9E A;  2DKG A;  3QJ6 A;  3GP8 A;  1U3O A;  2EAY A;  2YSQ A;  1G3S A;  4EPC A;  5KYW A;  1JJ2 S;  3QYG B;  4JLI A;  5GAM j;  4HT8 A;  1B3Q A;  3N5B B;  1SG5 A;  3HRT A;  4M4Z A;  2A7Y A;  4BE0 A;  1VOM A;  2VGN A;  1WA7 A;  3E9G A;  2L0A A;  2FRY A;  2ZPH B;  4ELZ C;  1PHT A;  3H8Z A;  2AKK A;  3V8J A;  4J7F A;  4A4H A;  1VQM A;  3CCL T;  2RM4 A;  2BIV A;  1VQ9 Q;  3CD6 Q;  4EMG A;  1TTH B;  4Z02 A;  4BDY A;  4HVU A;  1M90 R;  2LJ3 A;  1KQ1 A;  3QXE B;  4A4G A;  3T9N A;  5KYU B;  1K1Z A;  3JSC A;  4LE9 A;  1M1K R;  4KUI A;  1VQN A;  2VVK A;  1UGQ B;  1Q86 U;  5GJV B;  4RUG A;  1M2V B;  3NGP A;  2E64 A;  3SHW A;  3EG9 B;  4PFZ A;  2NLU A;  4CC7 A;  4VUB A;  4XAX B;  3CCJ A;  1MMG A;  3TEE A;  2JS2 A;  3SB2 A;  8ATC B;  2PZ1 A;  2X3X D;  3U23 A;  3HFO A;  4LDU A;  4EMK B;  3VS0 A;  4J9F A;  5A0G A;  1W2B P;  4LDW A;  2B8A A;  1Q7Y C;  2ROL A;  4EIK A;  5IAY A;  1YIT A;  1U06 A;  2RHY A;  4Y91 A;  4JRQ A;  5LJ3 g;  3EFO B;  2HKN A;  3QYH B;  1WJS A;  4AFU C;  2RK1 A;  1UB4 A;  5IHI A;  2YXY A;  2MWP A;  3CC2 Q;  4E7Z A;  4KT0 E;  4LDY A;  2EYZ A;  1E7O A;  1T3S A;  1RAC B;  3MHX A;  2IIM A;  1YJN A;  1VQ9 T;  2RI5 A;  2CZ7 B;  1WHK A;  2ZPE B;  3VYH B;  2Y90 A;  1MMN A;  2YRV A;  4XTW A;  2PTK A;  3BW1 A;  3ME9 A;  1UGR B;  1QVP A;  5GAN 2;  4AFQ C;  3EGU A;  2DJZ A;  3V8K A;  1M30 A;  2JNG A;  2D1X A;  1SSH A;  1WQW A;  2V1R A;  1SPK A;  2L3P A;  2P4R A;  4EMH A;  2RMO A;  3NTI A;  5C0M A;  4M77 D;  2HL5 C;  3H6Z A;  5AT1 B;  1BK2 A;  2D0Q B;  2F5K A;  2LC4 A;  3EGD A;  3GLX A;  1VQ8 T;  4RCC A;  3OS0 A;  1VQP Q;  5KYN A;  1Q7Y R;  4CC2 A;  1VYU A;  3OW2 P;  3C94 A;  4LDX A;  3JCM d;  4E7J A;  4ZTF A;  4PJO C;  4JPB W;  3L2Z A;  3O5Z A;  2RJF A;  3MJX A;  2RPN A;  3CCM Q;  3SWN A;  4C5G A;  4AFZ C;  3JCM W;  4M7A A;  3CC7 A;  2LP5 A;  4PJO G;  3TSZ A;  1WPY A;  5L23 A;  4L59 A;  3QII A;  1GRI A;  2M0O A;  1H64 1;  4KH0 B;  3C12 A;  4AT1 B;  5HK3 A;  1KQS P;  1O9S A;  3CCV T;  1PNJ A;  1ZLM A;  1W1F A;  1K9M U;  2QQR A;  5KH6 A;  3EG2 A;  5CKH A;  4ME7 A;  4RTY A;  3MP1 A;  2KXD A;  1YJW Q;  3JCM e;  3MEA A;  3CME Q;  4M78 B;  3NTH A;  4JDS A;  2FPD A;  2DTO A;  4WCI A;  1K4U S;  3G4S T;  3J7A F;  1K0S A;  1KIK A;  4M7D A;  2KGT A;  1U1T A;  4C92 B;  3OYG A;  4BE2 A;  1VQO Q;  1OU9 A;  4M78 F;  2E41 A;  5EC7 A;  4M7A F;  1QQJ A;  3H0H A;  1ZA2 B;  2DBK A;  1ZSZ B;  4OMP A;  4MML A;  3OYH A;  1KG1 A;  2IG0 A;  3VRY A;  1QCF A;  3S3N A;  2RH2 A;  3VS1 A;  4C92 F;  2X4Y A;  1K9M C;  3C4S A;  5FU7 B;  1XNI A;  4E7L A;  4NOY A;  1MNE A;  3E2U A;  1FWZ A;  1RAF B;  3MPU B;  1PRL C;  5IXF A;  2F1L A;  3PT9 A;  3D7S B;  2CP2 A;  2DE0 X;  1E6H A;  4E7K A;  3EAE A;  1X01 A;  3JCM f;  3CCQ A;  4BB7 A;  1BU1 A;  1X6B A;  3CMA Q;  3RUX A;  2GFA A;  2MYS A;  4J9D A;  4Z89 A;  2M16 A;  1RI0 A;  1HD3 A;  4Z8A A;  4M75 B;  1DJ7 B;  3OYI A;  3VV0 A;  3VS4 A;  2PVG B;  3A8H B;  3CCS A;  5GJW B;  2HSE B;  1D09 B;  2LNH B;  3EGX B;  4M7D F;  2QA4 A;  2KRO A;  5FRM A;  1UDL A;  2FHD A;  2K5L A;  1K73 U;  2QI2 A;  4TVR A;  4MDW A;  1HJD A;  1EX4 A;  4MZP A;  1D3B B;  1RL2 A;  2EYW A;  2JTE A;  2MAM A;  4OP0 A;  1YN8 A;  3MCA B;  1IO6 A;  1B34 A;  3I9Q A;  4QVZ A;  1Z9Z A;  3CC4 Q;  4XU1 A;  4DBH A;  4JUV A;  3G6E T;  3JV3 A;  1H8K A;  4J8O A;  2P0Q A;  3VRZ A;  2O9S A;  2YDL A;  2RN8 A;  1GXI E;  3LGL A;  2QQA A;  1VQL T;  2BZX A;  1K9M R;  1PSE A;  4NL2 A;  2VAS A;  4IUU A;  5HKC A;  2EGE A;  2ESW A;  3G71 Q;  3URG A;  2LQ8 A;  2D9T A;  1VUB A;  3RMQ A;  2EYQ A;  5D6X A;  2EGA A;  1YIJ A;  4P5N A;  1Y7X A;  1IRX A;  1VQ5 A;  3UT1 A;  3ZFJ A;  2ZGW A;  2LNV A;  4DOV A;  1PG5 B;  1WHH A;  2COY A;  2C0I A;  2LJ0 A;  2X4X A;  1LNX A;  3UAT A;  2ABL A;  4F16 A;  1JQQ A;  1WI7 A;  5A0D A;  2EKH A;  4AFS C;  1AOJ A;  1YI2 A;  3HPW A;  1AD5 A;  3HRS A;  1S72 Q;  2LRQ A;  1BYM A;  2DD5 A;  3LYI A;  1N9R A;  4M7A D;  1QVF P;  3BFM A;  3A5Z B;  2D8J A;  2Y4X A;  2O88 A;  3JB9 J;  1VQM T;  4J9B A;  4M77 C;  2YUO A;  1N8R U;  3X24 B;  4BY6 B;  4C92 D;  2C0T A;  3RES A;  2PVO B;  3QG1 A;  5KYX B;  3OYM A;  3M59 A;  3G71 T;  1VQN T;  2FPF A;  1MMA A;  1QCO A;  3E19 A;  1WXT A;  4PFP A;  4IUR A;  1B7T A;  2YUP A;  4ZGE B;  5GMK i;  2QEX A;  3CPF A;  1VIE A;  2PQW A;  4ZN3 A;  1F1B B;  2A37 A;  3CCJ T;  1TUC A;  3OA6 A;  2RQR A;  1MV3 A;  4N0A C;  2FPE A;  3NFC A;  1UJY A;  5FRN A;  3LW5 E;  2CUB A;  2ROT A;  1NLO C;  3BY7 A;  3I56 A;  3QSU A;  4M7D D;  3S3O A;  1E6G A;  1CKB A;  2AZV A;  2JZ2 A;  3BE3 A;  3M9Q A;  2QQ9 A;  1SHF A;  1YIT T;  4XU2 A;  2YLB A;  3LGF A;  2WSE E;  3TSW A;  2CZ1 B;  4DQ2 A;  2XD0 A;  4M77 E;  1G5V A;  4RTU A;  1S72 T;  2E5Q A;  2GQV A;  4LD6 A;  1N8R C;  3SDZ A;  2DER A;  2OTL A;  2M51 A;  2NUT B;  1Q81 C;  2RJD A;  4C5I A;  3RKX A;  1UFF A;  2VUB A;  4E2F B;  4HXJ A;  1KD1 U;  5GAO r;  1YJN T;  1Y0M A;  4OMQ A;  1PD1 A;  3OYB A;  1OPL A;  2NUP B;  3HKS A;  1C0M A;  3ASK A;  1OEB A;  4XU3 A;  5GMK e;  1K9A A;  3M0U A;  3DLM A;  3WVD B;  3OBY A;  3HFN A;  1VQ7 Q;  2FZK B;  1UGP B;  3A8O B;  5I21 A;  3VUZ A;  2CP0 A;  9ATC B;  2K3X A;  2FZG B;  2HL3 A;  5GAN 3;  5LJ3 d;  4LN2 A;  3WVE B;  2C0O A;  3QPH A;  2H3E B;  3AHU A; 
#chains in the Genus database with same CATH homology
 1Q86 U;  3OYE A;  4C0F A;  2CS7 A;  2E64 A;  5GAN d;  3I55 T;  2DIQ A;  1VQ7 A;  3DB3 A;  3JCM g;  2LTO A;  1NZ9 A;  3CBP A;  1VQ9 A;  3CD6 A;  4PJO F;  3HP9 A;  2NLU A;  2BKD N;  3OYF A;  5EG2 A;  4VUB A;  4XAX B;  3KUF A;  4BY6 C;  3CCJ A;  4HT9 A;  3SWN B;  3TEE A;  5GAN 7;  3OMC A;  3SB2 A;  2CZ6 B;  4C0G A;  4PJO E;  4M77 A;  1KD1 C;  4M7A B;  2FYK A;  3MEV A;  5HK0 A;  2E65 A;  4M78 D;  4E47 A;  2I2L A;  4X34 A;  3HFO A;  3L2Q A;  1OZ2 A;  4LDU A;  3OYJ A;  5IT9 E;  5CQY A;  4EMK B;  1LJO A;  4KBM B;  5A0G A;  3LX7 A;  1M9S A;  4MZT A;  3J81 E;  1QVG S;  4FU6 A;  2R5A A;  3UPU A;  4LDW A;  1KQ2 A;  2B8A A;  1Q7Y C;  2KQW A;  2RHU A;  4GLK A;  4XTV A;  5IAY A;  2F69 A;  1YIT A;  5GMK h;  3CPW A;  1VQP T;  3QKJ A;  2E6Z A;  4BI8 B;  2GFU A;  2DEQ A;  2RHY A;  3QHS A;  2EQJ A;  4Y91 A;  3M57 A;  3M58 A;  1ZHI A;  3MP8 A;  4JRQ A;  4BE1 A;  4BD3 A;  2L5Q A;  5LJ3 g;  4R55 A;  3FB9 A;  3QYH B;  3OYL A;  1WJS A;  2KDS A;  2RK1 A;  1UB4 A;  1I5L A;  3LWI A;  2PUK B;  1VQ4 T;  4D6W A;  5LJ3 e;  3L2R A;  2MWP A;  1BI3 A;  1NPR A;  1VIF A;  4X9C A;  4M77 G;  3CCM T;  2P4T A;  5GAN g;  1VQ8 A;  3QZ5 B;  3CCE T;  3WXM B;  4DA4 A;  1HK9 A;  4Y28 E;  4KT0 E;  3L42 A;  4JLG A;  4LDY A;  4PKC C;  5CCA A;  5GAN e;  3S3M A;  2YHT A;  1Y71 A;  1PSF A;  3MHX A;  3VJP A;  1YJN A;  1VQ9 T;  2RI5 A;  4HCZ A;  3SFM A;  4KUD K;  2CZ7 B;  2ZPE B;  4PNO A;  3VYH B;  2Y90 A;  5L8R E;  1VQO A;  2XHC A;  2YRV A;  4XTW A;  3BW1 A;  3ME9 A;  3JCM Q;  1UGR B;  2DXC A;  2MI6 A;  2PUO B;  2VC8 A;  1QVP A;  3FDR A;  3F70 A;  2P0K A;  2O4X A;  2WSC E;  4OF1 A;  3V7R A;  5GAN 2;  3KXT A;  3P8B B;  1FXX A;  2DJZ A;  2QQB A;  2CGH A;  2RJE A;  2RI3 A;  3M53 A;  3V8K A;  2DIG A;  2EFI A;  3JCM h;  2X4J A;  2JNG A;  4OGC A;  3V7C A;  1WQW A;  2OAU A;  1IRE B;  4M7D B;  3L2W A;  1VQ6 A;  4EMH A;  3CC2 A;  3QBY A;  4V2S A;  2EJ9 A;  2CKK A;  3NTI A;  2FL7 A;  1N9S A;  5C0M A;  3HL8 A;  2JTM A;  3E9F A;  2XK0 A;  4M77 D;  5CO7 A;  5GMK l;  4RCB A;  1YHQ A;  4CRI A;  3QDR B;  2MWO A;  4M75 D;  1YJW T;  3CME T;  2V8K A;  3Q1J A;  2WAC A;  4O5V A;  5GAM g;  3BDU A;  2XIC A;  3H6Z A;  5LJ5 j;  4PJO A;  2D0Q B;  2F5K A;  2LC4 A;  2Y4Y A;  4QQG A;  1WJR A;  3OB9 A;  2PU9 B;  5AYF A;  3GLX A;  4PLI A;  1VQ8 T;  4BDZ A;  4RCC A;  1BKB A;  3I55 A;  2M1H A;  3OS0 A;  2HBP A;  3JCM b;  5LJ3 h;  4L5G A;  4FT2 A;  4JS5 A;  1JRI A;  3C94 A;  4LDX A;  2EJF A;  5LJ3 f;  3JCM d;  1OI1 A;  4E7J A;  3V8L A;  3NTK A;  3OBW A;  4ZTF A;  4PJO C;  2JN0 A;  2E12 A;  4JJN K;  1VQO T;  5GAN h;  3L2Z A;  4XTY A;  3X25 B;  2RJF A;  2R57 A;  1R8O B;  2EWN A;  5GAN f;  2HD0 A;  2DAQ A;  2WSF E;  3L2V A;  3SWN A;  2XU8 A;  4C5G A;  4OB3 B;  2GF7 A;  1AHJ B;  3JCM W;  3CC7 A;  2DPP B;  4PJO G;  1NJI U;  1VQ6 T;  1WPY A;  4C8Q B;  4L59 A;  3JCM X;  4R56 A;  3QII A;  1VQP A;  2M0O A;  3JCM V;  1H64 1;  4QQ6 A;  2DZC A;  2D6F A;  2QTX A;  4MMK A;  4DOW A;  2E70 A;  3C12 A;  3LLR A;  3PMT A;  5HK3 A;  3GPL A;  2RB6 A;  1I4K 1;  1O9S A;  4LDV A;  2VV5 A;  3SWN C;  1WJQ A;  3R6O A;  3L2U A;  1YHQ T;  1NJI C;  3CCV T;  2AHJ B;  4FL6 A;  4C0Z A;  1G3Y A;  3CCS T;  4M7A C;  1VQ4 A;  3A8G B;  3ZEH A;  2LT4 A;  2RHZ A;  3BDL A;  2KVQ G;  3GNG A;  3SD4 A;  1QW1 A;  2RI2 A;  1WQ7 A;  3CCE A;  3CCM A;  4OVA A;  4EMK C;  2QA4 T;  4C8Q F;  5GAN 8;  1K9M U;  3M4G A;  2QQR A;  5KH6 A;  3CBO A;  4XK8 E;  5CKH A;  4J6W A;  4L6V 5;  5CIU A;  2QQS A;  2V8J A;  4B9X A;  4ME7 A;  1K8A C;  4M7A G;  3MP1 A;  1B34 B;  4C92 C;  1JBM A;  2LDM A;  5GAM h;  1XTD A;  3CMA T;  1XOV A;  4FIB A;  3MEA A;  5GAM f;  3JCM e;  1KC8 U;  3RKW A;  3EFR A;  4M78 B;  2ZCF B;  3NTH A;  4PJO D;  5CKE A;  4JDS A;  4XU0 A;  3TU4 K;  4J6Y A;  4UC4 A;  2DTO A;  2KK4 A;  1Y96 B;  2EIF A;  3FRN A;  3OY9 A;  3A8L B;  2F5T X;  2EQM A;  1N6A A;  3G4S T;  1QVF S;  3J7A F;  5D6Y A;  3CC7 T;  1M90 U;  5LJ5 d;  3OYY A;  5C6S A;  3J80 E;  4M7D A;  1U1T A;  3E1S A;  1ZBX A;  4NS5 A;  5CK9 A;  4C92 B;  5GAN 5;  3OYG A;  4BE2 A;  1X75 C;  2MMP A;  1Q82 U;  3PGG A;  3RIR A;  4M78 F;  2ZPB B;  3HHT B;  3JCM c;  3PIP A;  2RD1 A;  4II1 A;  4ZGD B;  2E41 A;  4OMF B;  3CME A;  1YJW A;  1M1K U;  4M7A F;  3UDC A;  4MML A;  3OYH A;  1KG1 A;  2IG0 A;  5GMK m;  4IKF A;  3X28 B;  4M7A E;  4OB1 B;  3C95 A;  3A8M B;  5I2M A;  5GAM d;  3CC4 T;  4PL6 A;  2KMT A;  3S3N A;  4M7D C;  3QUI A;  3CCR T;  2RH2 A;  4X9D A;  2M9U A;  4MZM A;  1BIB A;  4C92 F;  2K57 A;  4A54 A;  1YCY A;  1Q86 C;  1VQ5 T;  4RMO A;  2X4Y A;  1K9M C;  3C4S A;  5FU7 B;  1XNI A;  4E7L A;  4NOY A;  4HCB A;  1SSF A;  4N4H A;  2EKO A;  4C92 E;  1FWZ A;  4C5E A;  4RG2 A;  2K3Y A;  4M7D G;  3MP6 A;  3PFS A;  4JRP A;  4MDX A;  1Q81 U;  3M56 A;  3KBG A;  2E1H A;  4B9W A;  3OW2 A;  3PT9 A;  1KC8 C;  2DTI A;  2RJC A;  5J39 A;  2KY9 A;  2XDD A;  5CKF A;  4E7K A;  3CPW S;  3EAE A;  3M5A A;  1X01 A;  5LJ5 g;  3JCM f;  4C0D C;  4J6X A;  2QDY B;  1FX7 A;  2VYT A;  5A2Q E;  3CCQ A;  4BB7 A;  4F7U B;  3GF5 A;  3L1A A;  5LJ5 e;  3PNW C;  4M77 B;  3RUX A;  2GFA A;  3DKM A;  3VUB A;  2LVM A;  2M16 A;  1RI0 A;  3AHU A;  2XKO C;  4M75 B;  1DJ7 B;  2IVW A;  2JUF A;  4C8Q A;  3OYI A;  3VV0 A;  1OZ3 A;  1U8R A;  5FRO A;  2PVG B;  3A8H B;  1O75 A;  1BI0 A;  3CCV A;  2DXB A;  3CCS A;  3DLL A;  1Q82 C;  2DD4 A;  3VU3 C;  3JB9 F;  1JJ2 A;  2DTH A;  4M7D F;  1M1F A;  1IZ6 A;  2QA4 A;  5DY9 A;  3EFS A;  4JRK A;  5FRM A;  4J83 A;  5GAM e;  2FHD A;  4C0D B;  2K5L A;  5A0L A;  2QI2 A;  3CBM A;  4TVR A;  4F7U F;  4MDW A;  2RK2 A;  4A4K A;  4JS4 A;  2DVE A;  5KE3 A;  4M7D E;  4MZP A;  3VKI A;  4C8Q C;  1D3B B;  2JTF A;  1RL2 A;  2MAM A;  4OP0 A;  4Q5W A;  4IUV A;  5GAN 4;  2XID A;  3CMA A;  3MCA B;  2H3J A;  4NL3 A;  2DZ9 A;  5HY6 A;  1JB0 E;  3RER A;  4RKU E;  3JCM J;  2XDB A;  3DB4 A;  4XTX A;  1G3W A;  2ZPG B;  1B34 A;  4QVZ A;  2ZZD A;  4C8Q G;  2HAX A;  3CXC A;  3FLG A;  4QW2 A;  4XU1 A;  4E7H A;  3PMI A;  4JUV A;  3OSS C;  4QVC A;  3G6E T;  1VQK T;  5GAO n;  4M78 A;  3PIO A;  3G4S A;  4J8O A;  3RMS A;  5CQX A;  5GAO q;  2P0Q A;  5GAO p;  3HSB A;  4A4F A;  3OSV A;  4PLL A;  2E6N A;  5CVI A;  2K5F A;  3CCQ T;  3JB9 H;  1GXI E;  1Y96 A;  3LGL A;  3M54 A;  1UEB A;  1XQH A;  2CZ0 B;  4FSX A;  2QQA A;  3P8H A;  4GY5 A;  4EMK A;  1VQL T;  2RHI A;  1QP2 A;  1PSE A;  4NL2 A;  4O6J A;  5IN1 A;  3RKY A;  2K5I A;  4IUU A;  1W2B A;  5HKC A;  2R5M A;  3MEU A;  2L89 A;  2PVD B;  5KCH A;  4BUG A;  4M78 C;  4C92 A;  5LJ5 h;  4ZTJ A;  3URG A;  1MGQ A;  2LQ8 A;  5M9O A;  3OS1 A;  3OYA A;  2D9T A;  3QO3 A;  3JRZ A;  1VUB A;  5LJ5 f;  2RO0 A;  1Q7Y U;  3RMQ A;  5LL6 S;  3G7Z A;  1K73 U;  3CC4 A;  2OTJ A;  3CCR A;  2EYQ A;  1TH7 A;  4HKE A;  5D6X A;  3OYN A;  4QQD A;  1YIJ A;  5DLO A;  4P5N A;  3JB9 I;  1Y7X A;  4M78 G;  1VQ5 A;  3UT1 A;  3P8D A;  3ZFJ A;  4C8Q D;  2KAF A;  2ZGW A;  4C8Q E;  5DLQ E;  1W4S A;  2LNV A;  3CCU A;  4JRI A;  1QVG A;  4IUP A;  5GMK j;  3TCJ A;  4DOV A;  4CI0 C;  1YBY A;  3FIF A;  3X20 B;  2JOY A;  3FJP A;  4IUQ A;  3VYG A;  3GOX A;  3M4Y A;  3G71 A;  2X4X A;  1LNX A;  2LT1 A;  2VXF A;  3HRU A;  3MET A;  4BI4 A;  1BI2 A;  4C92 G;  1NE8 A;  3ZBD A;  2CYZ B;  4ELY C;  1M1G A;  2P0P A;  2LX9 A;  1M5Q 1;  3FC3 A;  3GNF B;  5A0D A;  4EDU A;  4HCC A;  4M7A A;  1W2B S;  1M8V A;  5CR2 A;  3OS2 A;  1BI1 A;  1YI2 A;  2DO3 A;  3HPW A;  3HRS A;  5FU7 C;  1V29 B;  2LRQ A;  3CEY A;  1BYM A;  4N4G A;  4F7U A;  2LQK A;  4QVD A;  3LWH A;  2DD5 A;  1OYX A;  3LYI A;  3GIB A;  3OMG A;  4M78 E;  1N9R A;  2EQK A;  3MEW A;  3OS5 A;  4M75 A;  3O8V A;  4M7A D;  4OB2 B;  2R58 A;  1H3Z A;  2DK3 A;  2OTJ T;  5GAO l;  3BFM A;  3A5Z B;  2EJG A;  2DXU A;  2Y4X A;  3V7S A;  3JB9 J;  1YIJ T;  2G3R A;  1VQM T;  5CAI A;  2KSS A;  3PTA A;  1U1S A;  1Y07 A;  4M77 C;  1N8R U;  3CCU T;  3X24 B;  4BY6 B;  2X35 A;  4C92 D;  4N4I A;  3JB9 G;  4M75 C;  3RES A;  1S72 A;  2PVO B;  1D3B A;  3OQ5 A;  3QG1 A;  4YTL A;  1M4Z A;  2ZPI B;  4FM4 B;  3M59 A;  3QZ9 B;  4A53 A;  4ZGJ B;  5KE2 A;  3OYM A;  1MHN A;  2L8D A;  1NPP A;  3G71 T;  4F7U G;  3MO8 A;  4HA8 A;  3G6E A;  2EQU A;  2RA2 A;  1VQK A;  2V8I A;  1VQN T;  2BUD A;  4ZN1 A;  4OGE A;  3E19 A;  4E7I A;  2O01 E;  4M75 G;  4N0A A;  1G3T A;  4IUR A;  1KHI A;  4ZGE B;  5GMK i;  1VQ7 T;  1VQL A;  2ZPF B;  2QEX A;  2HNI A;  3CPF A;  1VIE A;  2PQW A;  4C5H A;  4ZN3 A;  5LJ3 j;  1YI2 T;  3CD6 T;  1M90 C;  2VXE A;  4ATO A;  3CCJ T;  5FLX E;  2XG8 D;  3OA6 A;  1EIF A;  4N0A C;  5GAN j;  1M1K C;  2HQE A;  3NFC A;  1KQS A;  5FRN A;  3LW5 E;  4RG8 A;  3QJY A;  2JVV A;  1YJ9 A;  2LCC A;  1HXD A;  3LH0 A;  3JB9 D;  2DXT A;  3BY7 A;  3ER0 A;  3I56 A;  3QSU A;  4M7D D;  3S3O A;  3FEO A;  3CCL A;  4XTU A;  4M77 F;  5GAN 6;  2JZ2 A;  3M9Q A;  2HQX A;  2QQ9 A;  1I8F A;  1WNL A;  1YIT T;  2XDP A;  1ZQ1 A;  2YLB A;  3LGF A;  2WSE E;  4J5Y A;  4M75 F;  1I81 A;  4XU2 A;  4F7U E;  2CZ1 B;  4DQ2 A;  4XQ3 A;  3OW2 S;  2XD0 A;  4M77 E;  1G5V A;  1S72 T;  2MF2 A;  2FVU A;  4FT4 A;  1X6O A;  2A3L A;  2E5Q A;  2GQV A;  4M75 E;  4LD6 A;  4WF2 A;  5J3B A;  1N8R C;  3SDZ A;  3S6W A;  3UWN A;  5KCO A;  2X4W A;  2OTL A;  1QP3 A;  2C06 A;  1Q81 C;  2LCL A;  5I2S A;  5FU6 C;  2RJD A;  4C5I A;  5DM7 R;  3X26 B;  3RKX A;  1K8A U;  2DKG A;  3QJ6 A;  2VUB A;  3GP8 A;  1N27 A;  3INZ A;  2YLC A;  2QXF A;  2EAY A;  2K2V A;  1P92 A;  1G3S A;  4EPC A;  2L3R A;  2O4X B;  1UGS B;  1KD1 U;  2QEX T;  3M55 A;  5GAO r;  3QYG B;  1YJN T;  1JJ2 S;  4JLI A;  1KQS S;  5GAM j;  1KHC A;  4HT8 A;  3N5B B;  3OYB A;  3HKS A;  3HRT A;  3ASK A;  2K4Y A;  2A7Y A;  4BAC A;  5J26 A;  4BE0 A;  2XI9 A;  2VGN A;  4XU3 A;  5GMK e;  3E9G A;  5FU6 B;  3OYC A;  2ZPH B;  4ELZ C;  4LD9 K;  3H8Z A;  2E10 A;  3DLM A;  3WVD B;  2RHX A;  3OBY A;  1YJ9 T;  4J7I A;  3HFN A;  1BIA A;  4XTZ A;  4J7F A;  4KUL A;  3V8J A;  4A4H A;  5CKD A;  3I56 T;  1VQM A;  3CC2 T;  3CCL T;  3JAM E;  3JCM P;  2RM4 A;  1LOJ A;  2BIV A;  4IUT A;  3TRE A;  5CKB A;  4EMG A;  1UGP B;  3A8O B;  5GAO m;  1K73 C;  2FB7 A;  2GCX A;  4Z02 A;  5I21 A;  4BDY A;  1QVF A;  3OYK A;  3VUZ A;  3CXC S;  4PJO B;  4A4E A;  4BI3 A;  1KQ1 A;  3QXE B;  1WGS A;  2K3X A;  5GAN 3;  5LJ3 d;  4A4G A;  3T9N A;  3JSC A;  3WVE B;  2OTL T;  1VQN A;  2VGM A;  4KUI A;  4OB0 B;  3QPH A;  3OYD A;  5D6W A;  1UGQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...