3R50A

Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
153
structure length
153
Chain Sequence
ALQLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTDIITVGGVGPEPLTYTETVNIDGDIIEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAYYTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ipomoelin, a jacalin-related lectin with a compact tetrameric association and versatile carbohydrate binding properties regulated by its N terminus.
pubmed doi rcsb
molecule keywords Ipomoelin
molecule tags Carbohydrate-binding protein
source organism Ipomoea batatas
total genus 25
structure length 153
sequence length 153
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 3r50A00
3AQGA 4R6QA 1XEZA 1C3MA 1J4TA 3VY7A 1UH1A 2GUCA 3VZFA 3R50A 2GTYA 1WS4A 1X1VA 4AK4A 1ZGRA 1VBOA 3LL0A 5JM1A 1WS4C 1JOTA 1UGYA 1UGXA 3R51A 5BN6E 2GUXA 1WS5C 1UGYC 2GUEA 1KUJA 3VY6A 4AKBA 1XXQA 4PITA 4AKCA 2NU5A 3LL1A 3WOCA 4GX7A 4R6OA 4PIUA 5EXGA 1C3NA 1UGWA 3WOBA 2HYQA 1WS5A 3O44A 4WOGA 1UGWC 1KU8A 1OUWA 2JZ4A 1J4SA 2GUDA 4PIKA 1J4UA 1JACA 3APAA 5AV7A 3LLYA 5J51A 5J4TA 1M26A 2BMZA 4R6PA 3LLZA 4DDNA 3LL2A 3P8SA 1UH0A 1XXRA 4MQ0A 3R52A 1PXDA 3MIUA 4PIFA 4AKDA 3MIVA 1TOQA 3MITA 4R6NA 3VZEA 3LM1A 1C3KA 5J4XA 2BMYA 1ZGSA 3LKYA 2NUOA 2HYRA 4R6RA 1VBPA 5J50A 3VZGA 2BN0A 1TP8A
chains in the Genus database with same CATH superfamily
3AQGA 4R6QA 4QX1A 4QX3A 1XEZA 1C3MA 1J4TA 3VY7A 1I5PA 1UH1A 2GUCA 3VZFA 3R50A 4W8JA 2GTYA 1WS4A 1X1VA 4AK4A 1ZGRA 1VBOA 3LL0A 5JM1A 1WS4C 1JOTA 1UGYA 1UGXA 3R51A 5BN6E 2GUXA 1WS5C 1UGYC 1VMOA 2GUEA 4ARXA 3TOWA 3EB7A 1KUJA 3VY6A 4AKBA 1XXQA 4PITA 4AKCA 2NU5A 3LL1A 4QX2A 3WOCA 4GX7A 4R6OA 4PIUA 5EXGA 1C3NA 1UGWA 3WOBA 2QP2A 2HYQA 1WS5A 1JI6A 3O44A 4WOGA 1UGWC 1KU8A 1DLCA 1OUWA 2JZ4A 1J4SA 2GUDA 4D8MA 2C9KA 4PIKA 1J4UA 1JACA 3APAA 5AV7A 3LLYA 5J51A 5J4TA 1M26A 4QX0A 1W99A 2BMZA 4R6PA 3LLZA 4DDNA 3LL2A 3P8SA 1UH0A 1XXRA 4MQ0A 3R52A 1PXDA 3MIUA 4PIFA 1CIYA 4AKDA 3MIVA 1TOQA 3MITA 4R6NA 3VZEA 3LM1A 1C3KA 5J4XA 2BMYA 1ZGSA 3LKYA 2NUOA 2HYRA 4R6RA 1VBPA 4MOAA 5J50A 3VZGA 4ARYA 2BN0A 1TP8A
chains in the Genus database with same CATH topology
3AQGA 4R6QA 1XEZA 1C3MA 1J4TA 3VY7A 1UH1A 2GUCA 3VZFA 3R50A 2GTYA 1WS4A 1X1VA 4AK4A 1ZGRA 1VBOA 3LL0A 5JM1A 1WS4C 1JOTA 1UGYA 1UGXA 3R51A 5BN6E 2GUXA 1WS5C 1UGYC 2GUEA 1KUJA 3VY6A 4AKBA 1XXQA 4PITA 4AKCA 2NU5A 3LL1A 3WOCA 4GX7A 4R6OA 4PIUA 5EXGA 1C3NA 1UGWA 3WOBA 2HYQA 1WS5A 3O44A 4WOGA 1UGWC 1KU8A 1OUWA 2JZ4A 1J4SA 2GUDA 4PIKA 1J4UA 1JACA 3APAA 5AV7A 3LLYA 5J51A 5J4TA 1M26A 2BMZA 4R6PA 3LLZA 4DDNA 3LL2A 3P8SA 1UH0A 1XXRA 4MQ0A 3R52A 1PXDA 3MIUA 4PIFA 4AKDA 3MIVA 1TOQA 3MITA 4R6NA 3VZEA 3LM1A 1C3KA 5J4XA 2BMYA 1ZGSA 3LKYA 2NUOA 2HYRA 4R6RA 1VBPA 5J50A 3VZGA 2BN0A 1TP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQG A;  4R6Q A;  1XEZ A;  1C3M A;  1J4T A;  3VY7 A;  1UH1 A;  2GUC A;  3VZF A;  3R50 A;  2GTY A;  1WS4 A;  1X1V A;  4AK4 A;  1ZGR A;  1VBO A;  3LL0 A;  5JM1 A;  1WS4 C;  1JOT A;  1UGY A;  1UGX A;  3R51 A;  5BN6 E;  2GUX A;  1WS5 C;  1UGY C;  2GUE A;  1KUJ A;  3VY6 A;  4AKB A;  1XXQ A;  4PIT A;  4AKC A;  2NU5 A;  3LL1 A;  3WOC A;  4GX7 A;  4R6O A;  4PIU A;  5EXG A;  1C3N A;  1UGW A;  3WOB A;  2HYQ A;  1WS5 A;  3O44 A;  4WOG A;  1UGW C;  1KU8 A;  1OUW A;  2JZ4 A;  1J4S A;  2GUD A;  4PIK A;  1J4U A;  1JAC A;  3APA A;  5AV7 A;  3LLY A;  5J51 A;  5J4T A;  1M26 A;  2BMZ A;  4R6P A;  3LLZ A;  4DDN A;  3LL2 A;  3P8S A;  1UH0 A;  1XXR A;  4MQ0 A;  3R52 A;  1PXD A;  3MIU A;  4PIF A;  4AKD A;  3MIV A;  1TOQ A;  3MIT A;  4R6N A;  3VZE A;  3LM1 A;  1C3K A;  5J4X A;  2BMY A;  1ZGS A;  3LKY A;  2NUO A;  2HYR A;  4R6R A;  1VBP A;  5J50 A;  3VZG A;  2BN0 A;  1TP8 A; 
#chains in the Genus database with same CATH topology
 3AQG A;  4R6Q A;  4QX1 A;  4QX3 A;  1XEZ A;  1C3M A;  1J4T A;  3VY7 A;  1I5P A;  1UH1 A;  2GUC A;  3VZF A;  3R50 A;  4W8J A;  2GTY A;  1WS4 A;  1X1V A;  4AK4 A;  1ZGR A;  1VBO A;  3LL0 A;  5JM1 A;  1WS4 C;  1JOT A;  1UGY A;  1UGX A;  3R51 A;  5BN6 E;  2GUX A;  1WS5 C;  1UGY C;  1VMO A;  2GUE A;  4ARX A;  3TOW A;  3EB7 A;  1KUJ A;  3VY6 A;  4AKB A;  1XXQ A;  4PIT A;  4AKC A;  2NU5 A;  3LL1 A;  4QX2 A;  3WOC A;  4GX7 A;  4R6O A;  4PIU A;  5EXG A;  1C3N A;  1UGW A;  3WOB A;  2QP2 A;  2HYQ A;  1WS5 A;  1JI6 A;  3O44 A;  4WOG A;  1UGW C;  1KU8 A;  1DLC A;  1OUW A;  2JZ4 A;  1J4S A;  2GUD A;  4D8M A;  2C9K A;  4PIK A;  1J4U A;  1JAC A;  3APA A;  5AV7 A;  3LLY A;  5J51 A;  5J4T A;  1M26 A;  4QX0 A;  1W99 A;  2BMZ A;  4R6P A;  3LLZ A;  4DDN A;  3LL2 A;  3P8S A;  1UH0 A;  1XXR A;  4MQ0 A;  3R52 A;  1PXD A;  3MIU A;  4PIF A;  1CIY A;  4AKD A;  3MIV A;  1TOQ A;  3MIT A;  4R6N A;  3VZE A;  3LM1 A;  1C3K A;  5J4X A;  2BMY A;  1ZGS A;  3LKY A;  2NUO A;  2HYR A;  4R6R A;  1VBP A;  4MOA A;  5J50 A;  3VZG A;  4ARY A;  2BN0 A;  1TP8 A; 
#chains in the Genus database with same CATH homology
 3AQG A;  4R6Q A;  1XEZ A;  1C3M A;  1J4T A;  3VY7 A;  1UH1 A;  2GUC A;  3VZF A;  3R50 A;  2GTY A;  1WS4 A;  1X1V A;  4AK4 A;  1ZGR A;  1VBO A;  3LL0 A;  5JM1 A;  1WS4 C;  1JOT A;  1UGY A;  1UGX A;  3R51 A;  5BN6 E;  2GUX A;  1WS5 C;  1UGY C;  2GUE A;  1KUJ A;  3VY6 A;  4AKB A;  1XXQ A;  4PIT A;  4AKC A;  2NU5 A;  3LL1 A;  3WOC A;  4GX7 A;  4R6O A;  4PIU A;  5EXG A;  1C3N A;  1UGW A;  3WOB A;  2HYQ A;  1WS5 A;  3O44 A;  4WOG A;  1UGW C;  1KU8 A;  1OUW A;  2JZ4 A;  1J4S A;  2GUD A;  4PIK A;  1J4U A;  1JAC A;  3APA A;  5AV7 A;  3LLY A;  5J51 A;  5J4T A;  1M26 A;  2BMZ A;  4R6P A;  3LLZ A;  4DDN A;  3LL2 A;  3P8S A;  1UH0 A;  1XXR A;  4MQ0 A;  3R52 A;  1PXD A;  3MIU A;  4PIF A;  4AKD A;  3MIV A;  1TOQ A;  3MIT A;  4R6N A;  3VZE A;  3LM1 A;  1C3K A;  5J4X A;  2BMY A;  1ZGS A;  3LKY A;  2NUO A;  2HYR A;  4R6R A;  1VBP A;  5J50 A;  3VZG A;  2BN0 A;  1TP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...