3R52A

Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
152
structure length
152
Chain Sequence
LQLAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTDIITVGGVGPEPLTYTETVNIDGDIIEISGMIANYKGYNVIRSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAYYTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ipomoelin, a jacalin-related lectin with a compact tetrameric association and versatile carbohydrate binding properties regulated by its N terminus.
pubmed doi rcsb
molecule keywords Ipomoelin
molecule tags Carbohydrate-binding protein
source organism Ipomoea batatas
total genus 27
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 3r52A00
2GUEA 4PIFA 4PIKA 1WS5A 1VBPA 5J50A 5AV7A 1J4TA 1ZGSA 1TP8A 3WOBA 1ZGRA 1UGXA 3LM1A 5JM1A 1C3KA 2HYQA 3LL0A 3WOCA 1XXRA 4R6QA 4R6NA 2GUCA 1M26A 3LLYA 1PXDA 4AK4A 3VY6A 4MQ0A 4R6OA 1KU8A 4PIUA 1J4UA 3R50A 5BN6E 1JOTA 5J51A 1WS4C 1KUJA 1WS5C 2GUXA 2BN0A 1UH0A 3VZGA 4AKCA 4AKBA 3MIVA 1J4SA 3APAA 1C3NA 1XEZA 1UGWA 1XXQA 4GX7A 3R51A 2JZ4A 1UGYA 4WOGA 4R6RA 3MIUA 3MITA 3AQGA 3LL1A 5J4TA 2GTYA 4AKDA 1JACA 2HYRA 2NU5A 5J4XA 4DDNA 3VY7A 1UGWC 3LLZA 1UH1A 1UGYC 1VBOA 1TOQA 1WS4A 3LL2A 4R6PA 1C3MA 1OUWA 3O44A 3VZEA 4PITA 2BMZA 2GUDA 5EXGA 2BMYA 3P8SA 1X1VA 3R52A 3LKYA 3VZFA 2NUOA
chains in the Genus database with same CATH superfamily
2GUEA 4PIFA 4PIKA 1WS5A 1VBPA 1VMOA 5J50A 5AV7A 1J4TA 1ZGSA 1TP8A 3WOBA 1ZGRA 1UGXA 3LM1A 5JM1A 1C3KA 2HYQA 3LL0A 4ARXA 3WOCA 1XXRA 1W99A 4R6QA 4R6NA 2GUCA 1M26A 3LLYA 1PXDA 4AK4A 3VY6A 1CIYA 4MQ0A 4R6OA 1KU8A 4PIUA 1J4UA 3R50A 5BN6E 1JOTA 5J51A 1WS4C 1KUJA 1WS5C 2GUXA 2BN0A 1UH0A 1JI6A 3VZGA 4AKCA 4AKBA 3MIVA 1J4SA 2QP2A 3APAA 1C3NA 1XEZA 1UGWA 1XXQA 4GX7A 3R51A 2JZ4A 1UGYA 4QX3A 3EB7A 4WOGA 4R6RA 3MIUA 3MITA 3AQGA 3LL1A 5J4TA 2C9KA 2GTYA 4AKDA 4QX1A 1JACA 2HYRA 2NU5A 5J4XA 4DDNA 3VY7A 1UGWC 1I5PA 3LLZA 4MOAA 1UH1A 1UGYC 1VBOA 1TOQA 1WS4A 4ARYA 4D8MA 3LL2A 4R6PA 1C3MA 1OUWA 4QX2A 3O44A 3VZEA 1DLCA 4PITA 3TOWA 2BMZA 2GUDA 4W8JA 4QX0A 5EXGA 2BMYA 3P8SA 1X1VA 3R52A 3LKYA 3VZFA 2NUOA
chains in the Genus database with same CATH topology
2GUEA 4PIFA 4PIKA 1WS5A 1VBPA 5J50A 5AV7A 1J4TA 1ZGSA 1TP8A 3WOBA 1ZGRA 1UGXA 3LM1A 5JM1A 1C3KA 2HYQA 3LL0A 3WOCA 1XXRA 4R6QA 4R6NA 2GUCA 1M26A 3LLYA 1PXDA 4AK4A 3VY6A 4MQ0A 4R6OA 1KU8A 4PIUA 1J4UA 3R50A 5BN6E 1JOTA 5J51A 1WS4C 1KUJA 1WS5C 2GUXA 2BN0A 1UH0A 3VZGA 4AKCA 4AKBA 3MIVA 1J4SA 3APAA 1C3NA 1XEZA 1UGWA 1XXQA 4GX7A 3R51A 2JZ4A 1UGYA 4WOGA 4R6RA 3MIUA 3MITA 3AQGA 3LL1A 5J4TA 2GTYA 4AKDA 1JACA 2HYRA 2NU5A 5J4XA 4DDNA 3VY7A 1UGWC 3LLZA 1UH1A 1UGYC 1VBOA 1TOQA 1WS4A 3LL2A 4R6PA 1C3MA 1OUWA 3O44A 3VZEA 4PITA 2BMZA 2GUDA 5EXGA 2BMYA 3P8SA 1X1VA 3R52A 3LKYA 3VZFA 2NUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUE A;  4PIF A;  4PIK A;  1WS5 A;  1VBP A;  5J50 A;  5AV7 A;  1J4T A;  1ZGS A;  1TP8 A;  3WOB A;  1ZGR A;  1UGX A;  3LM1 A;  5JM1 A;  1C3K A;  2HYQ A;  3LL0 A;  3WOC A;  1XXR A;  4R6Q A;  4R6N A;  2GUC A;  1M26 A;  3LLY A;  1PXD A;  4AK4 A;  3VY6 A;  4MQ0 A;  4R6O A;  1KU8 A;  4PIU A;  1J4U A;  3R50 A;  5BN6 E;  1JOT A;  5J51 A;  1WS4 C;  1KUJ A;  1WS5 C;  2GUX A;  2BN0 A;  1UH0 A;  3VZG A;  4AKC A;  4AKB A;  3MIV A;  1J4S A;  3APA A;  1C3N A;  1XEZ A;  1UGW A;  1XXQ A;  4GX7 A;  3R51 A;  2JZ4 A;  1UGY A;  4WOG A;  4R6R A;  3MIU A;  3MIT A;  3AQG A;  3LL1 A;  5J4T A;  2GTY A;  4AKD A;  1JAC A;  2HYR A;  2NU5 A;  5J4X A;  4DDN A;  3VY7 A;  1UGW C;  3LLZ A;  1UH1 A;  1UGY C;  1VBO A;  1TOQ A;  1WS4 A;  3LL2 A;  4R6P A;  1C3M A;  1OUW A;  3O44 A;  3VZE A;  4PIT A;  2BMZ A;  2GUD A;  5EXG A;  2BMY A;  3P8S A;  1X1V A;  3R52 A;  3LKY A;  3VZF A;  2NUO A; 
#chains in the Genus database with same CATH topology
 2GUE A;  4PIF A;  4PIK A;  1WS5 A;  1VBP A;  1VMO A;  5J50 A;  5AV7 A;  1J4T A;  1ZGS A;  1TP8 A;  3WOB A;  1ZGR A;  1UGX A;  3LM1 A;  5JM1 A;  1C3K A;  2HYQ A;  3LL0 A;  4ARX A;  3WOC A;  1XXR A;  1W99 A;  4R6Q A;  4R6N A;  2GUC A;  1M26 A;  3LLY A;  1PXD A;  4AK4 A;  3VY6 A;  1CIY A;  4MQ0 A;  4R6O A;  1KU8 A;  4PIU A;  1J4U A;  3R50 A;  5BN6 E;  1JOT A;  5J51 A;  1WS4 C;  1KUJ A;  1WS5 C;  2GUX A;  2BN0 A;  1UH0 A;  1JI6 A;  3VZG A;  4AKC A;  4AKB A;  3MIV A;  1J4S A;  2QP2 A;  3APA A;  1C3N A;  1XEZ A;  1UGW A;  1XXQ A;  4GX7 A;  3R51 A;  2JZ4 A;  1UGY A;  4QX3 A;  3EB7 A;  4WOG A;  4R6R A;  3MIU A;  3MIT A;  3AQG A;  3LL1 A;  5J4T A;  2C9K A;  2GTY A;  4AKD A;  4QX1 A;  1JAC A;  2HYR A;  2NU5 A;  5J4X A;  4DDN A;  3VY7 A;  1UGW C;  1I5P A;  3LLZ A;  4MOA A;  1UH1 A;  1UGY C;  1VBO A;  1TOQ A;  1WS4 A;  4ARY A;  4D8M A;  3LL2 A;  4R6P A;  1C3M A;  1OUW A;  4QX2 A;  3O44 A;  3VZE A;  1DLC A;  4PIT A;  3TOW A;  2BMZ A;  2GUD A;  4W8J A;  4QX0 A;  5EXG A;  2BMY A;  3P8S A;  1X1V A;  3R52 A;  3LKY A;  3VZF A;  2NUO A; 
#chains in the Genus database with same CATH homology
 2GUE A;  4PIF A;  4PIK A;  1WS5 A;  1VBP A;  5J50 A;  5AV7 A;  1J4T A;  1ZGS A;  1TP8 A;  3WOB A;  1ZGR A;  1UGX A;  3LM1 A;  5JM1 A;  1C3K A;  2HYQ A;  3LL0 A;  3WOC A;  1XXR A;  4R6Q A;  4R6N A;  2GUC A;  1M26 A;  3LLY A;  1PXD A;  4AK4 A;  3VY6 A;  4MQ0 A;  4R6O A;  1KU8 A;  4PIU A;  1J4U A;  3R50 A;  5BN6 E;  1JOT A;  5J51 A;  1WS4 C;  1KUJ A;  1WS5 C;  2GUX A;  2BN0 A;  1UH0 A;  3VZG A;  4AKC A;  4AKB A;  3MIV A;  1J4S A;  3APA A;  1C3N A;  1XEZ A;  1UGW A;  1XXQ A;  4GX7 A;  3R51 A;  2JZ4 A;  1UGY A;  4WOG A;  4R6R A;  3MIU A;  3MIT A;  3AQG A;  3LL1 A;  5J4T A;  2GTY A;  4AKD A;  1JAC A;  2HYR A;  2NU5 A;  5J4X A;  4DDN A;  3VY7 A;  1UGW C;  3LLZ A;  1UH1 A;  1UGY C;  1VBO A;  1TOQ A;  1WS4 A;  3LL2 A;  4R6P A;  1C3M A;  1OUW A;  3O44 A;  3VZE A;  4PIT A;  2BMZ A;  2GUD A;  5EXG A;  2BMY A;  3P8S A;  1X1V A;  3R52 A;  3LKY A;  3VZF A;  2NUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...